IMD 1.17: 21/11/2008 22:06:10 AT&T UNIX PC System Software Version 3.51 Foundation Set 1031015-MC01 Ver 3.51 7 of 12    UQVQFloppy(  Ƀ^Iw   /< N1X OQ./HJf/H#0N90HH.N1z @-Hf$90HH.N1z @-Hf . N:.W/N1XOJo Hn/N1POJm0.H=@`BnpѮUP`R R -f`2HH @hg2n @Tgn0 @?g @Afp# `p# `. ,` @ag& @bg @dfp# `p# `t` "| #Rp mJ fp# p# ` @rgn0 @lg @pfdp# `bp# `Vp# ` @sg0 @tg @uf.p# J f(p`p# # `p# ` . . |/9 t/9 /.NO pl ."n ./< N1XO` . !N1. N1B 9 |ѹ  9 tѹ x 9 ѹ R .mpl*. /9 x/9 /.N&O . #N1.N1xL N^NuNVH$n`dHH @cg, @lg @wf,./< 0N1XO`6./< +`. /< 5`. :/<0N1XOp.N1xJfLN^NuNq-Npђ RJfXSJoTpn. /N1XOJf. /*N1XOJft`B/N1 XOrg`t`R "| Jfp op otp# `hp ./.Hk N1POJg`L.N$.HSNXO/HSNFXO/HSNXO//< n/<0N1O kf(0k.0k/0k//< /<0N1OJ l kg kg kg kf0k./< /<0N1PO kg kfH.N./< /<0N1PO kfP0k.0k//< /<0N1O `, kg kf.N./< /<0N1PO. /<0lwcwc: cannot open %s %s total %7ld%7ld%7ldusage: wc [-clw] [name ...] @(#) fndcmd:fndcmd.sl 1.68 0707070000020215271007550000020000020000031610440000017757000001000000013244bin/whoR ʜ  .text  .data @.bss  .lN1XON1&@ gJ f&Jkm k n0+H"|  fJkf. [`JgfJngBp .Hk /.N1POHn nHhN1tPO0.H2.Hg"`h.0N1FL N^NuNV. /./<0N1PO. /<0N1XO. /<0N1XO. /<0N1XO. F/<0N1XO. n/<0N1XO. /<0N1XO. /<0N1XO. /<0N1XOp.N1xN^NuNVp ././< N8PO |  N^NuNVp . nHh /< NPO |  N^NuNVH $nSBnt&n `  o=|`RRKJgib  mtBJnf6 .RJjDD`S-@`(fp.`p R`R R n Jgm괮mBL N^NuNVH $n&| t`LA0(HH"|0 1HHrW€f AJ0(f A(`^A0(@RpeB |  L N^NuNVH nA .N1$@B*X./< N1XOJ l n hg hg n hg hf nA ./< 3HnN1POHnHnN1tPOrf. ;`BN1-@ Qo. B/< N1XO`TpRJSl |  L N^Nu/< N1X OQ./HJf/H#0N @(#) fndcmd:fndcmd.sl 1.68 0707070000020305750407550000000000030000021337750404252656500000400000000000dev0707070000020274460206660000000000030000020004000000017757000001400000000000dev/console0707070000020274470206660000000000030000020024000000017757000001200000000000dev/error0707070000020274500604000000By PBn` jfp ./.Hj N1POJf | 8p Q Ep.HR/9 dN1POJfJg4p .Hj /.N1POJfp .Hj /9 `N1PO` y `Jfp .Hj /9 `N1PO``JfZ nf". `/9 d/< /<0N1O .0p/p /Hj N1jO . /<0N1XORnN1$@ fJg, y `Jf"./9 d/< /<0N1O `$ y `Jf(. d/< /<0N1POp.N1x``Jy Pf@N1.N1 @-HNf. -/<0N1XOp.N1xp . nN/` p./< 8HnN1POB.B9 hHn0/<000000030000020000000000017757000001200000000000dev/fp0000707070000020274510604000000000000030000020000010000017757000001200000000000dev/fp0010707070000020274520604000000000000030000020000020000017757000001200000000000dev/fp0020707070000020274530604000000000000030000020000030000017757000001200000000000dev/fp0030707070000020274540604000000000000030000020000040000017757000001200000000000dev/fp0040707070000020274550604000000000000030000020000050000017757000001200000000000dev/fp005070707000002027456060400 N1tPO 9 l2..p/N1nXOp.N1. L/< N1RXO# \BN1J9 hf&J \f. N/<0N1XOp.N1x.(NHnVN1XOHnVN1XO-@R @B(J9 hg&.R/.Hn/< bBBp/N1O`..R/.Hn/< /9 \N1O. \N1L. /<0N1XO`DR.N`:J9 hg.BBp/N1O `. \HSN1XO. \N1L.0HxHnZN1PO&@ g !f`N8L N^NuNV.p/N1nXO.p/N1nXO.p/N1nXO.p/N1nXON^NuNVHN10000000000030000020000060000017757000001200000000000dev/fp0060707070000020274570604000000000000030000020000070000017757000001200000000000dev/fp0070707070000020274600604000000000000030000020000100000017757000001200000000000dev/fp0080707070000020274610604000000000000030000020000110000017757000001200000000000dev/fp0090707070000020274620604000000000000030000020000120000017757000001200000000000dev/fp00a0707070000020274630604000000000000030000020000130000017757000001200000000000dev/fp00b07070700000202746406$pf. /<0`xJf,B/./< /< /< N1TOBN1x`:.p/N1nXO.p/N1nXOBN1԰f.(N(. /<0N1XOLN^NuNV. `/9 d/< /<0N1O p.N1xN^NuNVJ9 hg$.  BBp/N1O BN1xN^Nu. /9 \N1XO`Nq04000000000000030000020000140000017757000001200000000000dev/fp00c0707070000020274650604000000000000030000020000150000017757000001200000000000dev/fp00d0707070000020274660604000000000000030000020000160000017757000001200000000000dev/fp00e0707070000020274670604000000000000030000020000170000017757000001200000000000dev/fp00f0707070000020274700604000000000000030000020000200000017757000001200000000000dev/fp0100707070000020274710604000000000000030000020000210000017757000001200000000000dev/fp0110707070000020274   720604000000000000030000020000220000017757000001200000000000dev/fp0120707070000020274730604000000000000030000020000230000017757000001200000000000dev/fp0130707070000020274740604000000000000030000020000240000017757000001200000000000dev/fp0140707070000020274750604000000000000030000020000250000017757000001200000000000dev/fp0150707070000020274760604000000000000030000020000260000017757000001200000000000dev/fp0160707070000020274770604000000000000030000020000270000017757000001200000000000dev/fp0170707070000020707070000020275300204000000000000030000020020070000017757000001300000000000dev/rfp0070707070000020275310204000000000000030000020020100000017757000001300000000000dev/rfp0080707070000020275320204000000000000030000020020110000017757000001300000000000dev/rfp0090707070000020275330204000000000000030000020020120000017757000001300000000000dev/rfp00a0707070000020275340204000000000000030000020020130000017757000001300000000000dev/rfp00b0707070000020275350204000000000000030000020020140000017757000001300000000000d0275000604000000000000030000020000300000017757000001200000000000dev/fp0180707070000020275010604000000000000030000020000310000017757000001200000000000dev/fp0190707070000020275020604000000000000030000020000320000017757000001200000000000dev/fp01a0707070000020275030604000000000000030000020000330000017757000001200000000000dev/fp01b0707070000020275040604000000000000030000020000340000017757000001200000000000dev/fp01c0707070000020275050604000000000000030000020000350000017757000001200000000000dev/fp01d07070700ev/rfp00c0707070000020275360204000000000000030000020020150000017757000001300000000000dev/rfp00d0707070000020275370204000000000000030000020020160000017757000001300000000000dev/rfp00e0707070000020275400204000000000000030000020020170000017757000001300000000000dev/rfp00f0707070000020275410204000000000000030000020020200000017757000001300000000000dev/rfp0100707070000020275420204000000000000030000020020210000017757000001300000000000dev/rfp011070707000002027543020400000000000003000002002022000001775700000130000020275060604000000000000030000020000360000017757000001200000000000dev/fp01e0707070000020275070604000000000000030000020000370000017757000001200000000000dev/fp01f0707070000020275100606660000000000030000020000400000017757000001200000000000dev/fp0200707070000020275110606660000000000030000020000410000017757000001200000000000dev/fp0210707070000020275120204400000030000030000020014010000017757000001100000000000dev/kmem0707070000020275140204400000030000030000020014000000017757000001000000000000dev/mem0707070000000000dev/rfp0120707070000020275440204000000000000030000020020230000017757000001300000000000dev/rfp0130707070000020275450204000000000000030000020020240000017757000001300000000000dev/rfp0140707070000020275460204000000000000030000020020250000017757000001300000000000dev/rfp0150707070000020275470204000000000000030000020020260000017757000001300000000000dev/rfp0160707070000020275500204000000000000030000020020270000017757000001300000000000dev/rfp017070707000002027551020400000000000003000002002030000001775000020275150206660000000000030000020014020000017757000001100000000000dev/null0707070000020275130202220000000000030000020030000000017757000000700000000000dev/lp0707070000020275160206660000000000030000020040000000017757000001000000000000dev/ph00707070000020275170206660000000000030000020040010000017757000001000000000000dev/ph10707070000020275200202220000000000030000020030400000017757000001200000000000dev/rawlp0707070000020275210204000000000000030000020020000000017757000001300000000000dev/rfp00007070700007000001300000000000dev/rfp0180707070000020275520204000000000000030000020020310000017757000001300000000000dev/rfp0190707070000020275530204000000000000030000020020320000017757000001300000000000dev/rfp01a0707070000020275540204000000000000030000020020330000017757000001300000000000dev/rfp01b0707070000020275550204000000000000030000020020340000017757000001300000000000dev/rfp01c0707070000020275560204000000000000030000020020350000017757000001300000000000dev/rfp01d07070700000202755702040000000000000300000200203020275220204000000000000030000020020010000017757000001300000000000dev/rfp0010707070000020275230204000000000000030000020020020000017757000001300000000000dev/rfp0020707070000020275240204000000000000030000020020030000017757000001300000000000dev/rfp0030707070000020275250204000000000000030000020020040000017757000001300000000000dev/rfp0040707070000020275260204000000000000030000020020050000017757000001300000000000dev/rfp0050707070000020275270204000000000000030000020020060000017757000001300000000000dev/rfp00660000017757000001300000000000dev/rfp01e0707070000020275600204000000000000030000020020370000017757000001300000000000dev/rfp01f0707070000020275610206660000000000030000020020400000017757000001300000000000dev/rfp0200707070000020275620206660000000000030000020020410000017757000001300000000000dev/rfp0210707070000020275630606440000030000030000020000010000017757000001100000000000dev/swap0707070000020275640206660000000000030000060034000000017757000001300000000000dev/syscon070707000002027564020666000000000003000   0060034000000017757000001300000000000dev/systty0707070000020275650206660000000000030000020010000000017757000001000000000000dev/tty0707070000020275660206660000000000030000020000000000017757000001300000000000dev/tty0000707070000020275640206660000000000030000060034000000017757000001300000000000dev/window0707070000020275670206660000000000030000020034010000017757000000700000000000dev/w10707070000020275730206660000000000030000020034020000017757000000700000000000dev/w20707070000020275740206660000000000030000e d -exec rm -rf {} \; >/dev/null 2>&1 0707070000020274041007550000020000020000031641720000017757000001500000005057etc/.drvload#sccs "@(#)fndetc:.drvload 1.2" # # called from /etc/rc to load drivers at boot time: # /etc/.drvload # requires: # /etc/master (with entries for loadable devices) # /etc/lddrv (directory) # /etc/lddrv/lddrv (setuid root) # /etc/lddrv/mkifile # /etc/lddrv/drivers # .o files for loadable drivers in /etc/lddrv # if [ ! -f /etc/lddrv/drivers ] then exit fi cd /etc/lddrv exec < dr020034030000017757000000700000000000dev/w30707070000020275750206660000000000030000020034040000017757000000700000000000dev/w40707070000020275760206660000000000030000020034050000017757000000700000000000dev/w50707070000020275770206660000000000030000020034060000017757000000700000000000dev/w60707070000020276000206660000000000030000020034070000017757000000700000000000dev/w70707070000020276010206660000000000030000020034100000017757000000700000000000dev/w8070707000002027602020666000000000003000002003411000001ivers >> /usr/adm/drv.log 2>&1 find . -name unix.sym ! -newer /unix -exec rm {} \; if [ ! -r unix.sym ] then echo creating unix.sym ./mkifile /unix unix.sym fi # Addition by F. Dewey 5/86 to take care of drivers that cause a panic # during binding. The name of the current driver is kept in /etc/current.driver # so that if, on the reboot after a panic or hang, the file contains # the name of a driver, that driver is removed from the /etc/drivers # file for subsequent bootups. if [ -s /etc/current.7757000000700000000000dev/w90707070000020275700206660000000000030000020034120000017757000001000000000000dev/w100707070000020275710206660000000000030000020034130000017757000001000000000000dev/w110707070000020275720206660000000000030000020034140000017757000001000000000000dev/w120707070000020274021006440000020000020000031641660000017757000001500000001055etc/.badlist#sccs "@(#)fndetc:.badlist 1.2" # # FILE: /etc/.badlist # USED BY: cpio and tapecpio # # CREATED: # 01/17/86 - Mark Emmerich # driver ] then read driver /tmp/$$.drv mv /tmp/$$.drv /etc/lddrv/drivers exec < drivers >> /usr/adm/drv.log 2>&1 fi clean=0 while read driver do echo "/etc/.drvload: driver $driver currently being loaded" echo $driver >/etc/current.driver sync;sync;sync sleep 1 if [ -z "$driver" ] then continue fi ./lddrv -q $driver if [ "$?" != "0" ] then ./lddrv -av $driver retcode="$?" else retcode="0" fi if MODIFIED: # 07/18/86 - MDE: Add /etc/drvtab to badlist # ## ## The following is a list of file names never to be restored. ## This file is used by cpio to determine whether a file can ## be restored. A maximum of 50 files may be listed. ## ## File names MUST begin in the first column and be terminated ## with a new line. Comments begin with a '#' in the first ## column. ## /etc/utmp /etc/wtmp /etc/drvtab 0707070000020274031007550000020000020000031641670000017757000001500000001057etc/.cleanup#sccs "@[ \( "$retcode" = "0" \) -a \( -x ./${driver}.rc \) ] then ./${driver}.rc retcode="$?" if [ "$retcode" != "0" ] then ./lddrv -dv $driver fi else if [ \( "$retcode" != "0" \) -a \( -x ./${driver}.brc \) ] then ./${driver}.brc fi fi if [ "$retcode" != "0" ] then if [ "$clean" = "0" ] then echo "Can't load and initialize the following drivers:\n " >>/tmp/dr.err clean=1 fi if [ -f /etc/lddrv/InstDrv ] then ( Dname="Unnamed" while read Name do name=`e(#)fndetc:.cleanup 1.1" # Clean out and initialize the mount table > /etc/mnttab devnm / | setmnt /etc/mountable # Clean out wtmp > /etc/wtmp if [ -x /usr/lib/ex3.7preserve ] then # Do ex/vi saving /usr/lib/ex3.7preserve - fi # Clean up temp files, etc. rm -rf /tmp/* rm -rf /usr/tmp/* rm -f /usr/spool/uucp/LCK* rm -f /usr/spool/uucp/STST* rm -f /usr/spool/uucp/LTMP* rm -f /usr/spool/lp/SCHEDLOCK rm -f /usr/spool/lp/FIFO # Clean the /lost+found directory if one exists #find /lost+found -mtime +7 -typxpr "$Name" : '\(Name=\).*'` if [ -n "$name" ] then read File File=`expr "$File" : 'File=\(.*\)'` if [ "$driver" = "$File" ] then Dname=`expr "$Name" : 'Name=\(.*\)'` fi fi done echo "$Dname driver ($driver)" >>/tmp/dr.err ) >/tmp/dr.err fi fi # if we got this far, the current driver didnt cause a panic or # system hang, so it is OK to remove it from the current driver.file. rm -f /e   tc/current.driver echo "/etc/.drvload: driver $driver loading completed\n" done if [ -f /tmp/dr.err ] then /usr/bin/erricon -sN "`cat /tmp/dr.err`" rm -f /tmp/dr.err fi 0707070000020274051007550000020000020000031641760000017757000001300000000006etc/.extraxxxxx 0707070000020274101007550000020000020000030000000000017757000001500000000000etc/.lineone0707070000020274111007550000020000020000030000000000017757000001500000000000etc/.linetwo070707000002027412100755000002000002000003164207000001775700000220/etc/.lineone/etc/.linetwo/dev/ph1/dev/ph0Failed to open modem port. Error return= %dAnswer Tone2100 Hz ToneAnswer Tone2100 Hz Tone1800 Hz Guard Tone1800 Hz Guard Tone/etc/.modemr/etc/.modem file not found.NONOIOCTL Failed in setting the following parameter:0000000021etc/.lpstartsched/usr/lib/lpsched 0707070000020274131007770000020000020000031642100000017757000001300000000016etc/.modemIAT=NO IGT=NO 0707070000020263221007550000020000020000031163370000017757000001700000004520etc/.modeminitR p P .text .data P@.bss P P.lib X X%s Error Returned = %d@(#) adminbin:adminbin.sl 1.137 0707070000020262361007550000020000020000031614400000017757000001300000004260etc/.phclrR   .text .data @.bss .lib /< XN1X OQ./HJf/H#0Npf p./< ` p./< %N1XO-@Jl.0/< .N1XON1xJ PgJp.HxP/.N1PO-@Jl . [N/< N1X OQ./HJf/H#0Np-@`&pf.`./.N1nXORplN1`6. "N . &Np.N1xN^Nu nl0n.N1N=@`BN1Bp.N1Bp.N1Bp./< N1XO-@.N1N.N1NN1$p.p /p/BBN1O3 N1DBHxW 0y /N1PO. 0y /N1XO. 0y p.HxP /.N1PO-@JlP. g`DBHxP/.N1PO-@Jl . tNRBHxP /.N1PO-@Jl . N.J Tg*p.HxP /.N1PO-@Jl . NN^NuBHxP /.N1PO-@Jl. N`NV. /< N1RXO-@Jf. N1N1x.p(/HnN1PO-@Jg"p./< HnN1POJfB P`p# T# PN^Nup# P.p(/HnN1PO-@Jg$p./< HnN1POJg p# T`B T`NV./< N1XO.0/< N1XON^Nu/N1XO0n.N10n.N1B.}+uN1`NV. */.N1XOJf. N1RXO# J gzBB/9 N1PO. N/.N1XOJfTHnNXOHnNXOHnNXOHnNXOBHnHnHnHn/< h/< ]/< R`HN^NuHnNXXOHnNNXOHnNDXOB/< HnHnHn/< /< w/< lN1TO. N1F`NV. p/HnN1POHn/.N1PO.N1 S"nB1N^NuNV./.N1nXON^NuNV./.N1nXON129 HfZBHxW0y /N1PO=@0@./< Hn   N1POp.HnN1XO=@0@.N10n.N1BN^Nu/dev/windowPhone Managerph0ph1ph0/etc/.lineoner/etc/.linetworph0/etc/phupd/etc/phupdph0/etc/phupd/etc/phupdph1NO/dev/w%d@(#) fndcmd:fndcmd.sl 1.68 0707070000020262371007550000020000020000031614460000017757000001400000000056etc/.phinit#sccs "@(#)fndcmd:phinit.sh 1.2" /etc/.phclr 070707000002027414100777000002000002000003000000000001ull\" ">> /usr/lib/crontab 0707070000020274151007550000020000020000031642110000017757000001500000000005etc/.version3.51 0707070000020274161006440000000000030000031642120000017757000000700000000010etc/TZPST8PDT 0707070000020262401007550000020000020000031614470000017757000001500000004600etc/bldotherR   .text .data @.bss  .lib  7757000001300000000000etc/.rs2320707070000020274061007550000020000020000031641770000017757000001500000003641etc/.firstrc#sccs "@(#)fndetc:.firstrc 1.3" # .firstrc will be run the first two times the Unix PC is booted from # hard disk. It runs twice becuase in the middle of .firstrc, the system # is rebooted to force the updating of the system clock, after the user # has changed it. This was done to keep the user from changing the time # zone, without rebooting to have it take effect. # #directory where files that are to be converted are kept CONVDIR=/u/CONV3.5 if [ ! -r /etc/.installdate ] then > /etc/.installdate message -i "\ When you start the UNIX pc for the first time, you must set the date \ and time. Please press Enter, and the system will prompt you for this \ information.\n\nPress Enter to continue." /usr/bin/setdate asdf message -i "\ System will now be rebooted to synchronize the system clock.\n\n\ Press ENTER to continue." sync;sync;sync;sync;sync reboot fi if [ ! -d $CONVD/< N1X OQ./HJf/H#0N /etc/.installdate chmod -w /etc/.installdate fi message -c "\ UNIX provides for a non-office login called \"root\". You should \ provide a password for this login in order to maintain security for \ your system. Touch Enter to provide a root password now, or Cancel \ to skip." if [ "$?" = "0" ] then password -n root 1 fi message -i "\ To use your telephone with the UNIX pc Telephone software, use the \ Hardware Setup selection of the Administration menu.\nWhen"QJ1fR |  RpЮ./< /.N1POp./< $UA/Backup.menu << END Menu = Partial Backup includes files changed since $2 $3 Label = Backup Prompt =Complete Backup saves whole system, Partial Backup saves changed items. Name = Complete Backup - has not been done yet. Name = Partial Backup - has not been done yet. Name = Backup one user END echo "`date '+%S'` * * * * /bin/su uucpadm -c \"/usr/lib/uucp/uudemon.hr > /dev/n0/< EN1XO`Name = Office of .........Name = Filecabinet of .........Default = Open Open = EXEC -w /bin/su - .........Open = FM /u/......../Filecabinet Help = EXEC -d /usr/bin/uahelp -h /usr/lib/ua/ua.hlp -t "Other    Users" Configuring special office file 'OTHERS' /usr/lib/ua/OthersNONEAdding user %s /usr/lib/ua/Others error creating Others file %d@(#) fndcmd:fndcmd.sl 1.68 0707070000020274171006640000000000030000031642130000017757000001600000000013etc/checklist/dev/fp002 0707070000020274201007550000020000020000031642140000017757000001700000001004etc/cleanup.wk#sccs "@(#)fndetc:cleanup.wk 1.7" # 'perform once per week, Sunday at 0530 hours' # 'tell the status manager to empty the file /usr/adm/cronlog' DATE: March 7, 1986 # CREATED BY: Mark Emmerich # # This program reads the file SPECIAL to determine what # to do about each of the programs contained therein. # SPECIAL is assumed to have the following format: # # PATH S or # PATH C CONVPROG # # where PATH is the full path name, S indicates that the # file is to be "Saved" from the earlier version, C indicates # that the file is to be "Converted", and CONVPROG indicates # which program to use to perform  ps -e | grep "smgr" | \ while read PID TTY TIME COMMAND do if [ "$COMMAND" = "smgr" ] then kill -17 $PID fi done rm /usr/adm/sulog find / -name core -exec rm {} \; # # clean up files for lp request and remote printing. # find /usr/spool/lp/request -type f -name "[drt]*-*" -atime +2 -exec rm -f {} \; rm /usr/spool/uucppublic/*.: rm /usr/spool/uucppublic/*.g 0707070000020274211007550000020000020000031642150000017757000002000000000500etc/clockupd.wk#sccs "@(#)fndetc:clockupd.wk 1.7" # Write to the hthe conversion. SAVEDIR=/u/SAVE3.5 CONVDIR=/u/CONV3.5 LISTING=$SAVEDIR/listing SAVELIST=/tmp/SAVED export SAVEDIR CONVDIR SAVELIST # Begin a new conversion log. echo `date`"\nCONVERSION TO 3.51 BEGINNING\n\n" > /usr/adm/convert.log > $SAVELIST # Perform conversions as specified in the SPECIAL file. while read FNAME SAVE CONVPROG do if [ \( -s ${SAVEDIR}${FNAME} \) -o \ \( -s ${CONVDIR}${FNAME} \) ] then echo "Converting the file $FNAME ... \c" SNAME=`basename $FNAME` if [ "$SAVE" = "S"ardware clock every Sunday morning to accomodate # synchronization of time between s/w and h/w clock in case day light # saving time is being used. Wait a minute to prevent recursion. # Note: backslash needed to avoid SCCS conflict sleep 60 date `date +%m%d%H\%M` 0707070000020305770407550000020000020000020137710404252657300001400000000000etc/convert0707070000020273721006440000020000020000031641200000017757000002400000000505etc/convert/RENAMED##sccs "@(#)fndetc/convert:RENAMED 1.1" ## This file conta ] then cp ${SAVEDIR}${FNAME} ${FNAME} rm -r ${SAVEDIR}${FNAME} else ./${CONVPROG} ${CONVDIR}${FNAME} ${FNAME} rm -r ${CONVDIR}${FNAME} fi echo "$FNAME ---- CONVERSION ACCOMPLISHED" \ >> /usr/adm/convert.log echo "done." else echo "$FNAME no file found for conversion" \ >> /usr/adm/convert.log fi done < SPECIAL # The /usr/spool/lp tree is no longer saved due to incompatabilities with # earlier releases. ## PROTECT UPDATED VERSIONS OF THE SOFTWARE while read FILE ins the names of ua objects that have been ## renamed since release 2.0 that are to be removed from the ## current release. Add comments to this file by starting the ## line with a '#' character. Use no blank lines. Font Setup Configure Loadable Device Drivers 0707070000020273551007550000020000020000031640600000017757000003000000000745etc/convert/formconvert#sccs "@(#)fndetc/convert:formconvert 1.3" # Arg1 is the location of the saved file - full path in /u/SAVE # Arg2 is the full path in the systeCHKSUM do if [ ! "$FILE" ] then continue fi if expr "$FILE" : "#" > /dev/null 2>&1 then continue fi if [ -s "$FILE" ] then CURSUM=`sum $FILE | cut -f1 -d' '` if [ "$CURSUM" = "$CHKSUM" ] then GOODFILE="/etc/fixes/`basename $FILE`" cp $GOODFILE $FILE echo "$FILE converted on `date`" >> /etc/.fixedfiles echo "$FILE ---- CONVERSION ACCOMPLISHED" \ >> /usr/adm/convert.log fi fi done < /etc/fixes/.fixedlist # Convert the existing 3.0 (System V.0) libraries to 3.51 (System 5m of the newly read in file # from the foundation set which overwrote what used to be there. OLDFILE=$1 NEWFILE=$2 if grep "Name" $OLDFILE > /dev/null 2>&1 then ed - $OLDFILE >/dev/null << -END- ?Menu? /Name/ .,\$w /tmp/xxx q -END- cat /tmp/xxx >> $NEWFILE rm -f /tmp/xxx fi # the calling program worries about cleanup of $OLDFILE 0707070000020274011007550000020000020000031641500000017757000002400000010012etc/convert/convert#sccs "@(#)fndetc/convert:convert 1.16" # FILE: convert .2). # arconvert looks for its own libraries (/lib & /usr/lib) and does its # duty to them. # Commented out 3/18/87 - ELL # arconvert # Restore saved voice mail software. if [ -x $SAVEDIR/voicemail ] then mv /bin/mail /bin/oldmail rm -f /bin/rmail mv $SAVEDIR/voicemail /bin/mail chown bin /bin/mail chgrp mail /bin/mail chmod 2755 /bin/mail ln /bin/mail /bin/rmail echo "/bin/mail ---- CONVERSION ACCOMPLISHED" \ >> /usr/adm/convert.log fi # Change the owner and group for the file /usr/sp   ool/lp/default. This is # a bug in earlier versions. chown lp /usr/spool/lp/default >/dev/null 2>&1 chgrp other /usr/spool/lp/default >/dev/null 2>&1 # Complete the conversion log. echo `date`"\nCONVERSION TO 3.51 ACCOMPLISHED\n\n" >> /usr/adm/convert.log # Remove old version of masterupd saved by rm3.0stuff for # the conversion. rm -f $SAVEDIR/masterupd # Look for anything left behind. SREMAIN=`find $SAVEDIR -type f -print` 2> /dev/null CREMAIN=`find $CONVDIR -type f -print` 2> /dev/null if [f /tmp/missing /tmp/compare 0707070000020273671007550000020000020000031641120000017757000003000000003600etc/convert/crontabconv #sccs "@(#)fndetc/convert:crontabconv 1.3" # # crontabconv: July 2, 1986 # # This program searches the crontab file for entries # which may be missing from the new crontab. Only # differences in program name and significant argument will # be detected. If those fields are identical, then the # line will be ignored. # if [ $# -lt 2 ] then echo "usag "${SREMAIN}${CREMAIN}" ] then cat << -END- All system files have now completed their conversions. Your system is effectively a 3.51 system. There were however, files on your system which were left over after the conversion. A copy of these files has been saved in folders: $SAVEDIR or $CONVDIR should you wish to examine them. -END- sleep 18 else cat << -END- Your system files have been converted to 3.51. A log of the conversion has been saved in /use: crontabconv {old file} {new file}" exit 2 fi if [ $# -eq 3 ] then VERBOSE=$3 else VERBOSE="" fi OLDFILE=$1 NEWFILE=$2 cp $OLDFILE /tmp/missing while read LINE do RET=`getprogram "$LINE"` if [ ! "$RET" ] then continue fi eval set $RET PROG="$1" ARG="$2" # Remove email and memo from old crontab if package not installed if [ "$ARG" = "/usr/bin/email" ] then if [ ! -s /usr/bin/email ] then grep -v "${PROG}.*${ARG}" /tmp/missing > /tmp/lessline mv /tmp/lessline /tmp/missing contir/adm/convert.log. -END- sleep 2 fi if [ -s $SAVELIST ] then cat << -END- The following files have been replaced by newer versions. The old version of each has been renamed, starting with the original file name and ending with '-old', should you wish to examine them. For example, the original file "/etc/shutdown" has been renamed to "/etc/shutdown-old". -END- cat $SAVELIST echo "\n" sleep 20 fi rm -f $SAVELIST sleep 2 0707070000020273621007550000020000020000031640750000017757000002700nue fi fi if [ "$ARG" = "/usr/bin/memo" ] then if [ ! -s /usr/bin/memo ] then grep -v "${PROG}.*${ARG}" /tmp/missing > /tmp/lessline mv /tmp/lessline /tmp/missing continue fi fi # Remove uudemon.hr from old crontab if [ "$ARG" = "/usr/lib/uucp/uudemon.hr" ] then grep -v "${PROG}.*${ARG}" /tmp/missing > /tmp/lessline mv /tmp/lessline /tmp/missing continue fi # If entry in oldfile, remove from newfile if grep "${PROG}.*${ARG}" $NEWFILE > /dev/null then grep -v "${PROG}.*${000001775etc/convert/convbydiff#sccs "@(#)fndetc/convert:convbydiff 1.3" # # FILE: convbydiff # # This program looks at the differences between the old and # new versions od a file. Anything missing from the old # version is appended to the new version. # if [ $# -lt 2 ] then echo "usage: convbydiff {old file} {new file}" exit fi if [ $# -eq 3 ] then VERBOSE=$3 else VERBOSE="" fi OLDFILE=$1 NEWFILE=$2 # The old file and new file must be diff'ed. Anything missing # from the old file is appended tARG}" /tmp/missing > /tmp/lessline mv /tmp/lessline /tmp/missing fi done < $OLDFILE # Add random uudemon.hr echo "`date '+%S'` * * * * /bin/su uucpadm -c \"/usr/lib/uucp/uudemon.hr > /dev/null\" ">> /tmp/missing # Remove sccs comment line from old crontab grep -v "#sccs" /tmp/missing > /tmp/lessline mv /tmp/lessline /tmp/missing cat /tmp/missing >> $NEWFILE # Do listing update as necessary. if [ "$VERBOSE" ] then echo "new Release file updated with:" cat /tmp/missing echo fi rm -f /tmp/missingo the end of the new file. diff $OLDFILE $NEWFILE | getmissing - > /tmp/missing cp /tmp/missing /tmp/compare while read LINE do if [ -z "$LINE" ] ; then continue; fi if grep "$LINE" $NEWFILE > /dev/null then grep -v "$LINE" /tmp/missing > /tmp/lessline mv /tmp/lessline /tmp/missing fi done < /tmp/compare cat /tmp/missing >> $NEWFILE # Do listing update as necessary. if [ "$VERBOSE" ] then echo "new Release file updated with:" cat /tmp/missing echo fi # Clean up scratch files created. rm - 0707070000020273751007550000020000020000031641320000017757000002700000004344etc/convert/expanddescR  d .textd .data @.bss .lib    /< N1X OQ./HJf/H#0Nz/N1x0<N@NV .0 m .9 o .A m/< N1X OQ./HJf/H#0N. (N=@H2.Hf"0.H@H./< (/< N1POJgBN1xN^Nup`p-@Jg . "N1J  g 90 m 99 o 9, fN^NuNV. N1#  Jg" 90 m 99 o 9, gp`p-@JfN^Nu@(#) fndetc:fndetc.sl 1.159 0707070000020273771007550000020000020000031641420000017757000002700000004050etc/convert/getprogramR  |( .text| .data (@.bss ( (.lib ( (%s %d @(#) fndetc:fndetc.sl 1.159 0707070000020273731007550000020000020000031641210000017757000002700000004040etc/convert/getmissingR p    .text .data @.bss  .lib , ,/< (N1X OQ./HJf/H#0N /tmp/inittab mv /tmp/inittab $OLDFILE diff $NEWFILE $OLDFILE | getmissing - > /tmp/missing cp /tmp/missing # Next, extract the missing parts from the old pieces and # add them to the new master file. for I in 1 2 do ## GET THE LIST OF MISSING DEVICE ENTRIES diff /tmp/mOLD$I /tmp/mNEW$I | getmissing - > /tmp/missing cp /tmp/missing /tmp/checklist while read NAME JUNK do if [ "$NAME" = "*" ] then grep -v "^$NAME" /tmp/missing > /tmp/tmplist mv /tmp/tmplist /tmp/missing continue fi if grep "^$NAME" /tmp/mNEW$I > /dev/null then grep -v "^$NAME" /tmp/missing > /tmp/tmplist mv /tmp /tmp/compare while read LINE do DEV=`getdevid "$LINE"` if [ ! "$DEV" ] then grep -v "$LINE" /tmp/missing > /tmp/lessline mv /tmp/lessline /tmp/missing continue fi if grep "$DEV" $OLDFILE > /dev/null then grep -v "$DEV" /tmp/missing > /tmp/lessline mv /tmp/lessline /tmp/missing fi done < /tmp/compare cat /tmp/missing >> $OLDFILE ln $OLDFILE $NEWFILE # Do listing update as necessary. if [ "$VERBOSE" ] then echo "new Release file updated with:" cat /tmp/missing echo fi # Clean up scr/tmplist /tmp/missing fi done < /tmp/checklist ## FOR EACH MISSING DEVICE, REMOVE ITS OLD /dev FILES, ## ADD THE ENTRY TO THE NEW MASTER FILE, THEN RECREATE ## ITS /dev FILES. while read NAME DEVMASK DEVTYPE HANDLER JUNK1 JUNK do ## CHECK THE MASTER VERSION vs 3.31 NEWMSTR=`expr "$HANDLER" : '[0-9]'` if [ "$NEWMSTR" = "1" ] then DEVTYPE="$HANDLER" HANDLER="$JUNK1" fi ## ADD THE DEVICE TO THE MASTER FILE ADD=`expanddesc $DEVMASK $DEVTYPE` if [ "$NAME" != "$HANDLER" ] tatch files created. rm -f /tmp/missing /tmp/compare 0707070000020273611007550000020000020000031640730000017757000003200000001335etc/convert/instuaconvert#sccs "@(#)fndetc/convert:instuaconvert 1.2" # # FILE: instuaconvert # # This program copies the User-Agent file in /u/install to # a new name in /usr/lib/ua. It then performs the uaconvert # on it and moves it back. # if [ $# -lt 2 ] then echo "usage: instuaconvert {oldfile} {newfile}" exit fi if [ $# -eq 3 ] then LISTING=$3 else LISTING="" fi hen ADD="-p $HANDLER $ADD" fi masterupd -a -m $NEWFILE $ADD $NAME ## GET THE OLD AND NEW DEVICE NUMBERS rm -f /tmp/charflag /tmp/blockflag echo "$ADD" | grep "char" > /tmp/charflag echo "$ADD" | grep "block" > /tmp/blockflag fBLOCK=false fCHAR=false OLDNUM="" if [ -s /tmp/charflag ] then fCHAR=true OLDNUM=`$SAVEDIR/masterupd -c -m $OLDFILE $NAME` NEWNUM=`masterupd -c -m $NEWFILE $NAME` rm -f /tmp/charflag elif [ -s /tmp/blockflag ] then fBLOCK=true OLDNUM=`$SAVEUA=/usr/lib/ua OLDFILE=$1 NEWFILE=$2 # The file resides in $CONVDIR somewhere. It needs to be # copied to $UA for the uaconvert. Then it must be movied # back to where it belongs. cp $NEWFILE $UA/InstNew$$ uaconvert $OLDFILE $UA/InstNew$$ $LISTING mv $UA/InstNew$$ $NEWFILE # Make sure files still have correct owner/group ids chown install $NEWFILE chgrp users $NEWFILE 0707070000020273641007550000020000020000031641030000017757000003200000005512etc/convert/masterconvert#sccs "@(#)fndetc/convert:mastercDIR/masterupd -b -m $OLDFILE $NAME` NEWNUM=`masterupd -b -m $NEWFILE $NAME` rm -f /tmp/blockflag fi ## BUILD LIST OF ASSOCIATED DEVICE FILES if [ "$OLDNUM" ] then find /dev/* -print | grep -v "/dev/console" | \ getdevices $OLDNUM > /tmp/devlist else > /tmp/devlist fi ## CONVERT DEVICE FILES FROM OLD TO NEW NUMBER while read FILE MINOR do rm -f $FILE if $fCHAR then mknod $FILE c $NEWNUM $MINOR elif $fBLOCK then mknod $FILE b $NEWNUM $MINOR fi done < /   tmp/devlist done < /tmp/missing # Do listing update as necessary. if [ "$VERBOSE" ] then echo "new master file updated with:" cat /tmp/missing echo fi done # Clean up scratch files created. rm -f /tmp/mOLD? /tmp/mNEW? rm -f /tmp/missing /tmp/checklist /tmp/tmplist /tmp/devlist 0707070000020273651007550000020000020000031641060000017757000003000000001664etc/convert/namesysconv#sccs "@(#)fndetc/convert:namesysconv 1.4" # # FILE: namesysconv # # This program truncates the Email name in /etfi OLDFILE=$1 NEWFILE=$2 # Copy the old version to the file -old. cp ${OLDFILE} ${NEWFILE}-old echo "$NEWFILE" >> $SAVELIST # Do listing update as necessary. if [ "$VERBOSE" ] then echo "old Release file moved to ${NEWFILE}-old." echo fi 0707070000020273741007550000020000020000031641250000017757000003000000004150etc/convert/splitmasterR  h .text .data h@.bss h hc/namesys to # eight (8) letters. The contents of the file are assumed # to be: "setuname -n NAME", or "COMMAND SWITCH NAME". # if [ $# -lt 2 ] then echo "usage: convbydiff {old file} {new file}" exit fi if [ $# -eq 3 ] then VERBOSE=$3 else VERBOSE="" fi OLDFILE=$1 NEWFILE=$2 # In the new release, the system Email name must be truncated # to eight (8) letters. That is all that uucp recognizes. BUF=`cat $OLDFILE` NAME=`echo $BUF | cut -d' ' -f3 | cut -c1-8` CMD=`echo $BUF | cut -d' ' -f1-2` LNAME=.lib  `expr "$NAME" : '.*'` MNAME=`expr "$NAME" : '[a-z,A-Z,0-9,_]\{1,8\}'` if [ "$MNAME" != "$LNAME" ] then NAME="UNIXPC" fi echo "$CMD $NAME" > /tmp/namesys mv /tmp/namesys $NEWFILE chmod +x $NEWFILE # Do listing update as necessary. if [ "$VERBOSE" ] then echo "new Release file updated with:" cat $NEWFILE echo fi 0707070000020273571007550000020000020000031640640000017757000002600000001250etc/convert/rcconvert#sccs "@(#)fndetc/convert:rcconvert 1.1" # Arg1 is the location of the saved file - full pa/< N1X OQ./HJf/H#0N/tmp/namecmd if [ -s /tmp/namecmd ] then mv /tmp/namecmd /etc/namesys chmod 755 /etc/namesys chgrp bin /etc/namesys chown bin /etc/namesys grep -v "setuname -n" /etc/rc >/tmp/rc mv /tmp/rc /etc/rc chmod 744 /etc/rc chgrp sys /etc/rc chow/< hN1PO# lJf .0N1xp-@`b./9 t/< 3/< xN1O . 8/< xN1RXO# |Jf .0N1xNN. |N1FRpl. t/< :/< xN1PO. >/< xN1RXO# |Jf@.0N1x`2. |/< hN1XO. xHx/< hN1PO# lJ lf. |N1FN^NuNV`2. |/< hN1XO. xHx/< hN1PO# lJ lg" 9* hg. @/< hN1XOJfN^NuNV# l`2. |/< hN1XO. xHx/< hN1PO# lJ lg 9* hg 9$ hgN^NuNqn root /etc/rc fi # the calling program worries about cleanup of $1 0707070000020273661007550000020000020000031641070000017757000002700000001111etc/convert/saveoldver#sccs "@(#)fndetc/convert:saveoldver 1.2" # # FILE: saveoldver # # This program copies the old version of a file to the name # of the new file appended by '-old'. # # ie: /etc/file --> /etc/file-old # if [ $# -lt 2 ] then echo "usage: saveoldver {old file} {new file}" exit fi if [ $# -eq 3 ] then VERBOSE=$3 else VERBOSE="" usage: splitmaster {masterfile} {split prefix}r%s%dw%s4w$$$ @(#) fndetc:fndetc.sl 1.159 0707070000020273601007550000020000020000031640700000017757000   002600000002755etc/convert/uaconvert#sccs "@(#)fndetc/convert:uaconvert 1.3" # uaconvert # This shell will merge a new release ua file (e.g., Office) # with an old file by keeping all of the new release file # and appending the objects (i.e., Name=) that were found # in the old file but are not in the new release file # # it requires 2 parameters, the oldfile and then the newfile names # # an optional third parameter forces "debug"mode which reports progress # to the standard output and does not erase thove those Rel 3.0 objects from the oldfile - now in $UA/$TNAME exec < /tmp/names while read NAME do uaupd -r "$NAME" $TNAME done # now add the unique Objects left in the oldfile to the newfile cat ${UA}/$TNAME >> ${UA}/$FNAME uaupd -r "Printer Queue" $FNAME if [ $# -eq 3 ]; then echo "new Release file updated with:" grep '^Name' $1 | cut -d= -f2 -s fi rm /tmp/names rm ${UA}/$TNAME 0707070000020273701007550000020000020000031641160000017757000003000000001776etc/convert/profconvert#sccs "@(#)fndetc/convee /tmp files # UA=/usr/lib/ua export UA if [ $# -lt 2 ] then echo "usage: uaconvert oldfile newfile"; exit 1; fi # uaupd takes only the relative path to /usr/lib/ua, therefore: FNAME=`basename $2` # TNAME is a temp name to move the old file to ua so uaupd can # operate on it. TNAME=UATMP.$$ export TNAME cp $1 ${UA}/$TNAME # get a list of "Name=" objects from newfile ... grep '^Name' $2 | cut -d= -f2 -s > /tmp/names # remove those objects from the old file - now in $UA/$TNAME ... while read NArt:profconvert 1.4" # # FILE: porfconvert # # PURPOSE: Convert 3.0 .profile files to 3.5 level, replacing # "exec /usr/bin/ua" with a conditional execution of # same. ## BUILD THE EDITING STREAM cat > /tmp/kshfile << -END- \\?SHFLAG?i\\ ENV=\$HOME/.kshrc\\ HISTFILE=\$HOME/.kshistory\\ HISTSIZE=128\\ export ENV HISTFILE HISTSIZE\\ -END- cat > /tmp/cnvfile << -END- \\?exec /usr/bin/ua?c\\ ENV=\$HOME/.kshrc\\ HISTFILE=\$HOME/.kshistory\\ HISTSIZE=128\\ export ENV HISTFILE HISTSIZE\ME do uaupd -r "$NAME" $TNAME done < /tmp/names # and remove any renamed objects from the old file. Allow the use # of comments by starting the line with a '#'. while read NAME do fCOMMENT=`expr "$NAME" : "#"` if [ "$fCOMMENT" = "0" ] then uaupd -r "$NAME" $TNAME fi done < RENAMED # now add the unique Objects left in the oldfile to the newfile cat ${UA}/$TNAME >> ${UA}/$FNAME if [ $# -eq 3 ] then echo "new Release file updated with:" grep '^Name' $1 | cut -d= -f2 -s fi rm -f /tmp/names r\ \\ if [ "\$SHFLAG" != "1" ]\\ then\\ exec /usr/bin/ua\\ fi -END- ## EDIT EACH .profile FILE FOUND for PROFILE in /u/*/.profile do ## LOOK FOR FILE ALREADY CONTAINING CONVERSION if grep "HISTFILE" $PROFILE > /dev/null then continue fi ## LOOK FOR FILE MISSING NEW HISTFILE if grep "SHFLAG" $PROFILE > /dev/null then sed -f /tmp/kshfile $PROFILE > /tmp/.profile else sed -f /tmp/cnvfile $PROFILE > /tmp/.profile fi mv /tmp/.profile $PROFILE done rm -f /tmp/???file 0707070000020273711007550m -f ${UA}/$TNAME 0707070000020273561007550000020000020000031640610000017757000002600000002421etc/convert/offupdate#sccs "@(#)fndetc/convert:offupdate 1.1" # uafix # This shell will merge a new Release 3.0 ua file (e.g., Office) # with an old file by keeping all of the new Release 3.0 file # and appending the objects (i.e., Name=) that were found # in the old file but are not in the new Release 3.0 file # # it requires 2 parameters, the oldfile and then the newfile names # # an optional third parameter f000020000020000031641170000017757000003000000001061etc/convert/pswdconvert#sccs "@(#)fndetc/convert:pswdconvert 1.1" # # FILE: pswdconvert # # This program changes any ksh entries in /etc/passwd to sh. # This is done because ksh goes away with the Development Set # during the conversion. # if [ $# -lt 2 ] then echo "usage: pswdconvert {old file} {new file}" exit fi if [ $# -eq 3 ] then VERBOSE=$3 else VERBOSE="" fi OLDFILE=$1 NEWFILE=$2 ed $OLDFILE > /dev/null 2>&1 << _END_ 1,\$s/\/bin\/ksh/\/bin\orces "debug"mode which reports progress # to the standard output and does not erase the /tmp files # UA=/usr/lib/ua export UA if [ $# -lt 2 ]; then echo "usage: uathree oldfile newfile"; exit 1; fi # uaupd takes only the relative path to /usr/lib/ua, therefore: FNAME=`basename $2` # TNAME is a temp name to move the old file to ua so uaupd can operate on it TNAME=UATMP.$$ cp $1 ${UA}/$TNAME # get a list of Release 3.0 "Name=" objects from newfile grep '^Name' $2 | cut -d= -f2 -s > /tmp/names # rem/sh/ w q _END_ cp $OLDFILE $NEWFILE if [ "$VERBOSE" ] then echo "New release file has /bin/sh in place of /bin/ksh" fi 0707070000020262411007550000020000020000031614610000017757000001200000004130etc/devnmR ! X .text .data X@.bss X X.lib X X    ;@.bss ; ;.lib /< XN1X OQ./HJf/H#0N. d/< ;N1RXO @# =fB`N/dev.Cannot open /dev devnm: /dev stat error %s %s @(#) fndcmd:fndcmd.sl 1.68 0707070000020306000400000000000000000000020103020404252657400001200000000000etc/fixes0707070000020274071006440000000000000000031642040000017757000002500000000546etc/fixes/.fixedlist#sccs "@(#)fndetc:.fixedlist 1._hJgBNyp.Nyph./9 N1XO.N1B @# =fN 9 Ѐ"Ё.N1B @# = fN. f n /(N1XOJf. . H/< /< B0y =/N1ON^NuNVNN^NuNVp# =. ./<  ."ЀЁ"| =,AHPN1POR .".Rg Rpnn .fpN^Nu nR n./NLXO"n")o Ir!A.N2p`NV nr fpN^Nu nR p`NV nJf pfpN^Nu nJf r nS nSp`NV.N,JfpN^Nu n./( n/NPOJfp`NV nJf pf nrfpN^Nu nS nJf.NR n./NJXO"n#@p`NV nJ fpN^Nu nS p`NV n ./( n Ѐ"Ё"| AHP n (Ѐ"Ё"| AHP/< "/.N1ON^NuNVBN1-@HnN1XO# =N^NuNVBN1-@p<ѮHnN1XO# =N^ =,0n/0n/p /NLO .".RgB`dN^NuNV=|=|*B`v ."| 3 ."| 3 ."| 3G ."| 3 .Rr.N1Jfn=|`nGRp*n ."| Bq ."| Bq=|=|B`T ."| ,3 ."| .3 ."| 035 ."| 23n5Rp n ."| 0Bq ."| 2Bq3 3 3 3Z 3 3] 3 3Z By By N^NuNVH-y p g p-@`f ."| NuNVN n"y =  n"y =!i  n"y =")l!A n"y =!iN^NuNV n./( n/NXBqRp2nR mLN^NuNVNN N hJ =gNNN^NuN|Nl. N . N x 9 =Ѐ"Ё"| A./< /< =,N1PO. =,p/p /p/NLO . =/< /< =,N1PO. =,p/Hxp/NLO B`Z ."| A./< /< =,N1PO. =,p/pG/ .N1XOr Ё/p/NLO RpnB`x ."| Jg` ../< /< =,N1PO. =, ."| 01HT/ ."| 01HT/p /NLO Rp*nNwfBNwNXNRRpnB` ."| # ."| #p5. .N1^$ ."| # ."| #R ."| # ."| #p5. .N1P$ ."| # ."| #RRp n0 ."| B ."| B# LN^NuNVB` ."| BRp*n. =p//9 =N PO-@. =/9 =NXO-@p-@` ."| #RR .".RmN^NuNV# = # = -y =-y =p-@`r ."ЀЁ"| B ."ЀЁ    "| BHnN XOJg0 ."ЀЁ"| # ."ЀЁ"| #Rp n-y =-y =p-@`r ."ЀЁ"| B ."ЀЁ"| BHnN XOJg0 ."ЀЁ"| # ."ЀЁ"| #SJlN^NuNVB ."nJ g@ ."n. ./1 ."n/1 ./1NO R`N^NuNVHB=|`R .-@ .rlJg S`B`JfF nf> .rm0pd. . N1$ .Ѐ"| >X3RpѮ`Jpd. . N1"| >XA".ҁA2.. vBBp/N14O pN^Nup`NV n-h .rb@0; NJ .`.HHN^Nu.`.`NVpf& 9N Jf`. /< JN1XO`tp. .N1"| .N1V-@Jf p-@p`pfp-@Jgp-@`BJg|J =gJm .ot.B`pnp mp fBp. .N1"| ./< HnN1PO .Pfp Ѯ`Jmp;m./<  | < HPN1POpfd. JN1V-@p./< FHnN1POB.HnN1VXO".lp.p` `oPpfѮ `Jnf =|RR .m\LN^NuNV ."| 1N^NuNV ."| =q ."| =qRnRn.04p/p/p/pF/?.Bg?.Bg?.Bg?.BgBBBB0y =/N1O4N^NuNVp# . =/9 =NlXOJfS p =f.. =N Jf. =p//N POJfS 9 N^NuNV.  0y =/N1XO 9 =Ѐ"Ё"| A./< /< =,N1PO. =,p/p/NPO. =/< /< =,N1PO. =,p-/p/NPO. /< =,N1XO. =,p/p/NPOBp-@p.p/N XON^Nup`NVJf. `Hpf:. BB/N14O p. . N1"| A# pN^Nu. /BBp`NVp./p/N@POBp/p/N0POp.p/p/NPOp.p//NPO nA ./< OHnN1POBHnHnN 8PO-@Ѐ"Ё"| A"y #HvHn/< T/< N1O Hn/< Y/< N1O n (NfB9 B9 y (!| v` nA./< ^HnN1POBHnHnN 8PO-@Ѐ"Ё"| A"y (#HvHn/< c/< N1O Hn/< h/< N1O n (Nf y >`b. `/< =,N1XO. =,p//.NPOR. /< =,N1XO. =,p//.NPORR . m. `/< =,N1XO. =,p//.NPO. p/p/NPOBp-@p-@`bp2l Tp-@ ."| Jg4 ../< "/< =,N1PO. =,/./.NPO^Rp*nNwfNR. =/9 =NXO-@ 9 =o# =. =N># = p./9 = NXON^NuNV-y =-y =HnN XOJgp.HnN6XO-y =-y =HnN XOJgp .HnNXON^NuNV n./N!| vpm.pw/pd/pn//.NpO-@Ѐ"Ё"| xA"y j#Hv nA./< m/< N1PO. N1 "| B1N^Nu y >!| v`|NV n.fpN^Nu n.fp` n.fp`p`NVH | < ./< pHnN1PO .CB1HnN1VXO$ ."| #Jf .ASLN^NuNV3 = H 9 = gn. gnD gfnr g g`^ g g gh`< g~n gh g g`J =f. = N# =. =//9 =NXO-@ n.p//N PO-@ n Ѐ"Ё"| A./< %/< =,N1PO. =,p5//. NPO n./< (/< =,N1PO. =,pE//. NPO. /< =,N1XOR . =,p5//. NPOp-@. +/< =,N1XO-n`>./< @ ."ЀЁ"| =,AHPN1POR .".Rg RpnR B9 =@. =,p5//. NPO .".RgB`jN^NuNVp-@p-@-n`TpoJg S^`J fB`p-@.N./< E/< =,N1PORR. =,/././.NO p f . PO# =. =NVPJfNyZN^NuN`NT` g. gF f. BBp/N14O `. = N# =N` g4nR gzn g< f2. tBBp`p.N "9 = _m$# = @_ = # = D. D`p.0y =/N1XO`# = @p`j g2 g* fNJg. =N `N`p.N "9 = f.. =N Jgb. =/9 =NXO# =`# = @S = # = D. D/9 @N4XO. = N# =`D gn g" gNxN^NuNV./. /< N0y =/N1O ././< W0y =/N1O N^NuNV 7f# <. 7/< j/< =`2 fDpB.pC/pD/pA//9 NO@. vf N N`Y N. P/< s/< ON1PO. ."n61 .01H2HЁ"9 ,l n pL N^Nu .R"nJqgR`Lp`NV3 = H 9 = g`n` g&n gHnrr g g2`J =|gp =|J =|lB =|NN>N^NuJ =|gS =|N`p.0y =/N1XO` g g\ g`p й =|rlR =|`p.0y =/N1XO` g n0 N ``p.0y =/N1XO`p =(nB/9 =(NNfXOp =(`p.0y =/N1XO` g\n gv gb f 9 =|Y-@r lJlBp й =|# =|NK`HB/9 =(NNfXOp# =(`p.Ny. 4/< +N1`` gR g f2. 4/< 0/< ,/< (0y =/N1TO9 3gN`p =(gp =(f NvJfB/9 =(NNfXOR =(NvJgR =(p./9 =(NNfXO`Tp =(oB/9 =(NNfXOp ѹ =(`p.0y =/N1XO`. `. =$NZN` gnL g4n g f. BBp/N14O ` 9 =$"ЀЁ"| TJg# =$ @B =$# =$ D. D/9 @NTXO`f. /< N1`T gV gN f(. =$NN Jg". =N `. =/9 =/9 =N PO# =$`J =$g. 9 =$"ЀЁ"| TJg# =$ @S =$`p.0y =/N1XO` gVn g fv 9 =|Y-@r N,XOJg@B/9 =(NNfXO# < =(p./9 =(NNfXO9 3fN`p.0y =/N1XO`NVJ =gp.0y =/N1XON^Nu0y =./< NQXO-@mrb@0; NJ D (6NS`NTJf`.NU<`. =NVP`. =NW `NSJgNK`vNV 9 =(jDDй =|# =NJN^Nu`NV 9 = g\nb g g gn g& f. =N JgNzN^Nu. =N `N` gB gD g g f6p.Ny. K/< BN1XO`NlbJlBp й =|# =|NN>`F 9 =$"ЀЁ"| TJg# =$ @p# =$# D./9 @NXO`p.Ny` g g f. 4/< 0/< ,/< (0y =/N1TO9 3f. Ё/p$/p /NLO RRp nNBBBHxHxBBBBBBpd//< >X0y =/N1O4N". =$N`NV=|]=|X0y =/N1O4. =(N`NV=| =|)B`hp f =|)=|E ."| 3 ."| 3 ."| 36 ."| 3nRpn ."| Bq ."| BqN^NuNVBB` ."| `B ."| dA".) ."| h#  ."| l#6R ."| `B ."| dA".) ."| h#E ."| l#6RRpn@ ."| hB ."| lJ =g.N<`.NR .r ҹ =|mRpn|N^NuNVHB`` ."| B .Ѐ"瀐r<Ё$ ."| # ."| #] ."| #Rp nB`j ."| # ."| #'pJ. .N1r]Ё$ ."| # ."| #RRpn ."| B ."| BLN^NuNVB` ."ЀЁ"| TBRpn. =/9 =/9 =N PO-@"ЀЁ"| L# = ."ЀЁ"| P# = ."ЀЁ"| T# =-y =-y BN^NuNVNvJg8 .j DD`g S# =(. /.NXOR. /.NXON^NuNVJ =g. /.NrXON^Nu ."| =q ."| =qRnRn.04p/p/p/Hx5?.Bg?.Bg?.Bg?.BgBBBB0y =/N1O4`NVB. 0y =/N1XO. /< =,N1XO. =/< =,N1 XO"| =,AHPN XO. =,p/p/NPO. /< =,N1XO. =,p/p/NPO. /< =,N1XO. =,p/p/NPO. /< =,N1XO. =,p/p/NPOB`2. B/< =,N1XO=-y =`dpobHnN @XOJgH ."ЀЁ"| L# ."ЀЁ"| P# ."ЀЁ"| T#R`N^NuNV ."| =q ."| =qTnRn.04p/p/p/pI/?.Bg?.Bg?.Bg?.BgBBBB0y =/N1O4N^NuNV ."| =q ."| =qRnRn.0Tp/p/p /pI/?.Bg?.Bg?.Bg?.BgBBBB0y =/N1O4N^NuNV. 0y =/N1XO. =/9 = 9 =Ѐ"Ё"| AHP/< /< =,N1O. =,p /p/NPOB` ."ЀЁ"| TJ. =,p/ .Z/NPORp n. /< =,N1XO. =,p/p/NPOHn/< =NkPONrNkXJg*. /< =,N1XO. =,pA/p/NPOp./9 =(N^XON^NuNV n"H!irvp./.N1.XO-@Jm`N1=@BBBB0@/N1Op./.N1.XO-@Jl4N1=@y =g 0.nf-|`N^Nu0.nfp f n-hv n-h .rg n6Jgrgrgrgrflp./.N1.XO .` g6 g g g f*p./.N1.XOp`X. E/< !| v y j!| xvNTJgpN^Nup.//< pcXg6.X/< !:Hn`N1POBHn`N1XO.N1BN`bp.N`V.\/< !CHn`N1POBHn`N1XO.N1BN` N10Jfpc.B`pc.p/NXO. !L/< ;N1RXO @# =fpN^Nup.B/9 =N1PO. =N1Jf. =/< N1XOp`N`NV.p//.N1PO# rf n rc n pN^NuBB/9 N1POp .Hn/9 N1,POJg@B.HnHnN1POB.HnN1VXO"n" nrcg`Bp //9 N1 n nf` .n,fHn,NXOJg`Rp ./< !/.N1POJf N-@. =pd/Hn,N1PO @ f`NVBB/9 =N1POJg. !BBp/N14O BN. =pd/HnN1PO @ f. !BBp/N14O BN. =N1# N^NuNVNrN^NuNVNf. =N1# . =pd/HnN1PO @ g .#gB/9 /9 =N1PON^NuNVN. =N1# . =pd/HnN1PO @ g .DoB/9 /9 =N1PON^NuNVB/9 /9 =N1PO. =pd//< lN1PO @ fpN^NuJ gPOp.p//9 N1POJf0 nrc Bp //9 N1POp.B/9 N1POHnHnN1POB.HnN1VXO"n " n rcg`Bp //9 N1POp.p//9 N1POJf0 n rc Bp //9 N1POp.B/9 N1POHn/< !O/.N1O ` nrc n p`~NVBB/9 =N1PO. =pd//< lN1PO. N1 ./< /< lN1POJfpN^Nup`NV. !RN1-@JfN10N10Jg. !Z`. !aHnN1XOHnN1$XO-@Jf(N10. !iHnN1XOHnN1$XO-@Jf(N10. !lHnN n9 lf n mfp f(9 tf n wfp f(9 mf~. | l HP n HPN1PO-@fp`zJlJ f n kgp`^J f2 nHH @dg @mg @wg @xf 9k lfp`&Jgp`. =N1# `NV n BN Hn/.N PO. =N1-@. =pd//< lN1PO @ g$ 9D lnHnHn/< lNrO JgpN^Nup.HnHnN1POJf. lN1 S-@"| l 1 f .B1. v/< !/. N1PO .`NV nA./< !/. N1POp././. N1PO    Jlh nHHrArbL@0; NJD Hp././. /.NL`p././. /.NBO JgpN^Nup`p././. /.N`NVJ9 Pg. Pp/Hxp/NLO . "HnN1XOJ9 g. HnN1XOHnHxp/p/NLON^NuNV. " HnN1XOJ9 Pg. PHnN1XOHnp3/p/NO . "HnN1XOJ9 g. HnN1XOHnp/p/NO N^NuNVB9 PB9 B`* ."| PB ."ЀЁ"| BRpn. P/.NXO# hN~NHn/.N PO|N1 XOCAHPN1XOB.RHn/././.N"hON^NuB`NV nr n r`p n n r% `S nRJfN^NuNVB ."ЀЁ"| A". A//9 =N1PO. =pd//< lN1PO.N 9Y ~fl|*. #%/.N1 XO"nAHPN1XO. .HH//< #< nHh N1O .N1 S"nB1N^Nu| `NVB/./< vN 8PO 9N zg" n|-B nHh/< zN 8PON^NuNV 9 =(jDD`й =|-@"ЀЁ"| -qfpN^Nuplp` 9 =(j DD`dBp/BHnNO Jf6B`(./< "HnN1POHn/.NPORpn|mBp/BHnNVO JfRBp/p/HnN:O Jf6B`(./< "$HnN1POHn/.NPORpn|wBp/BHnNO JfPBp//HnNO Jf6B`(./< ")HnN1POHn/.NPORpn|kB Bp/BHnNrO -@fBp/p/HnNTO -@ft# . v/< "./< N1PO. =N1# |nBpo>./< "1HnN1POHn/.N^POR`JlN` pfBp йg ."ЀЁ"| ` ."ЀЁ"| 1`NV 9 =(jDD`й =|"ЀЁ"|  fpN^Nup`NV. #B/.N1XOB/. /9 =N1PO. =pd//< lN1PO.N.N1 -@"n  9Y ~f n|*. /< # nHhN1PON^NuNVdHNdB`h ."| =# ."| Jg< .-ql-y =h-y =pHn|HnhNPO$ ."| =#Rp*nLN^NuNVB`tJg./< #NXO ."| = gBB ./1/9 =N1PO. =pd//< lN1 =|-@`( ."ЀЁ"| Jg n r N^NuRpo`NVH`. =N1# Bp/p //. NRO Jf0p. n Hh/< nN1POJn. lNJf ."ЀЁ"| R ."ЀЁ f ."ЀЁ"| `. ."ЀЁ"|  f ."ЀЁ"| # p =f$B 9N zgJB9 ~. |N1VJgRB9 |B9 x. vN1V$. zN1VѮS .Ю"| P#SJl`LN^NuNVp -@p,-@pq-@p%-@-y =|`"ЀЁ"|  g ."ЀЁ PO./< vN.XORp*nN^NuNV. #HnN1XO ."| = gB ./1/9 =N1PO. =pd//< lN1PO. v/< #HnN1POHnN1 XOS-@C 1 f .CB1. #HnN1XOB.Hnp /p/NO NN^NuNVNJ =g. = NN^Nup.NxN. = NN`NV. . "| 01Hr Ё/ . "| 01HZ/p /NLO N^NuNVpf. ;/< #HnN1POJ =fBB/9 N1POpc./< #`&J =f@Bp//9 N1POpc./< #HnN1fB ."ЀЁ"| /1/9 =N1PO./././.NjO pѮѮ ."ЀЁ"|  fB ."ЀЁ"| /1/9 =N1PO./././.NO `BHn/.N POHn/./.p /NLO ."ЀЁ"| JgD. "6/.p~Ю/p /NLO . "HpЮ/p~Ю/p /NLO pѮѮ ."9 =|ҁ JjDD`Sf-|Hp,-@-|p%-@` pѮѮR .r ҹ =|m4N^NuNV. =pd//< lN1POHnNXOHn/. /.p /NLO 9Y ~f . #/./.POp.Hn/9 N1POHnHnHnHnN&OJfFpcf>Jgf2Bp //9 N1POBB/9 N1POHnN1XOJgp./BNPOBN16N^NuNVB . =NNN-@gD . g< g< fJ f p =gB p =g2NN^NuN`J f p =gB N`NK`NVB NgN# =Hn/< =N PO./< %HnN1PO|dBp/BHnNhO Jf.HnNXO|mBp/BHnNhO Jf*Bp/p/HnNhO Jf.HnNXO|wBp/B0y =/NO . /< "[HnN1POHn/. p~Ю/p /NLON^NuNVB`B/.NXORpnN^NuNV .jDD`й =|-@BHn/N PO. "aHnN1 XOCAHPN1XO ."ЀЁ"|  1Jg$rgPrf .jzDD`r .j DD`g. "HnN1XO` .j DD`fHnB`2. "HnN1XO`lgp-@`BHn/./.NO `@ .j DD`g. "HnN1XO`. "HnN1XO.HnHnNbPOp fPp-@. #HnHnNhO Jf(Bp//HnNhO Jf.HnNXO|kBp/BHnNhO -@fRBp/p/HnNhO -@f*. =N1# |n.HnNXON^NuJl`pf`NVp.p/p //.NhO -@f@p. nHh/< nN1POJn. lNJf. N`pf 9n zg. z/< %HnN1PO. |/< %HnN1POHnN1VXO". fHnN1VXOJfHnN1VXO". lBp. nHh/< nN1POJn$. lNJf. N&`pf. =N1# `N^NuNVph.    9 N1"y =#R 9 "9 Sfjp2ѹ ph./9 N1XO./9 =N1NXO @# =fNX 9 Ѐ"Ё./9 = N1NXO @# = fNXN^NuNVHB`ph. .N1"y =.ph/ .N1XO"y =AHPNvXOph. .N1"y =A$H .Ѐ"Ё"y = # .Ѐ"Ё"y = B1 .Ѐ"Ё"y = #R . mV .Ѐ"Ё"y = B .Ѐ"Ё"y = B1 .Ѐ"Ё"y = BLN^NuNV. X nHHrЁЀ/A"nHP0y =/N1O4 n(HnR ."n1H=@fpN^NuNV. *HHxHxtp /NTO N^NuNVH$nBp/B*HH/*HH/*HHЮ /*HHЮ/BBpd//< >X*HH    SRЀ/Hj /.N1O4LN^NuNVBBBHxHxBBBBBBpd//< >X0y =/N1O4N^NuNV.0Tp/p/p/p5/HxHxHxHxBBBB0y =/N1O4N^NuNqNV./< +;/< N1POHnNXONLJf$. /< +>BBp/N14OpN^Nu. NN-@HnN0XO .`NV. N B NgNN`\p ./< HnN1POJm@. lNnJf0p ./< HnN1POJo 9n lf `V.N~V. =N1-@. =pd//< lN1PO @ g. Hn/< lNPOJg^` 9 N^NuNVH ,OHnN1POHnN1VXOS-@ nA./< ,THnN1POHnN1VXO-@.Hn/. NjPO././. N1POJmpN^NuHnN @XOJfp`NV./< ,YHnN1POHnN1VXO-@ nA./< ,^HnN1POHnN1VXOS-@ nA./< ,cHnN1POHnN1VXO-@ nA./< ,hHnN1POHnN1VXO-@././.N PO`. .g*HnN @XOJghRp. .N1-@`.Hn/. N,PO././. N1PO-@mpN^NuBpoHnN @XOJfp`R`NV./< ,mHnN1POHnB`p. +aph/ .N1XO"y =AHPN1XOBph/ .N1XO"y =/1/9 =N1PO. =pd//< lN1PO. n/< +HnN1POHnN1VXO-@. r/< +HnN1POHnN1VXOS-@. t/< +HnN1POHnN1VXO-@. m/< +HnN1POHnN1VXO-@Ѐ"Ё"| *PA./< +HnN1PO9 lHH @dg @mg @ng< @wfHn/< +ph/ .N1XO"y =AHPN1O `./. .Ѐ"Ё"| AHPHn/< +ph/ .N1XO"y =AHPN1O`Z. +ph/ .N1XON1VXO-@ nA./< ,rHnN1POHnN1VXOS-@ nA./< ,wHnN1POHnN1VXO-@./.NXOlHnN XOJfpN^Nu.Hn/. N$PO././. N1PO-@mp`./.NXOlHnN XOJf`NV./< ,|HnN1POHnN1VXO-@ nA./< ,HnN1POHnN1VXOS-@ nA./< ,HnN1POHnN1VXO-@.Hn/. NFPO././. N1PO-@nJfpfpN^NuR 3fp`NV n ./< ,/.N1PO n R./< , nHhN1"y =AHPN1XO`../< +ph/ .N1XO"y =AHPN1POph. .N1"y =A.N1 $ph. .N1"y =A ph. .N1"y =A.Nuph. .N1"y =A.N1 $ph. .N1"y =A . /< +ph/ .N1XO"y =A HPN1POph. .N1"y =A$H .Ѐ"Ё"y = # .Ѐ"Ё"y = B1 .Ѐ"Ё"y = #R .m .Ѐ"Ё"y = B .Ѐ"Ё"y = B1 .Ѐ"Ё"y = BLN^NuNV# , * *# = +# = + p./<PO n ./< , nHhN1PO nA ./< , nHhN1PON^NuNV. ,/< ;lN1RXO @-Hg$p.B/9 =N1PO. =N1JfpN^NuBB/.N1PO.p //.N1PO.N1F. ;lN1p`NVN .NN^NuNVN 4.NN^NuNV y = (l./< ,/.N1PO y = (R./< , nHhN1PO y =. /< , nHhN1PO y =./< , nHhN1PO y =./< , nHh N1PON^NuNVN. 0NJfNN^NuNV. ,/< 4Z/< ɸN1PO. 4]/< ;N1RXO @#  *N1.XO-@JlpN^NuN1=@. /< h/< B0@/N1Op./< *N1.XO-@Jl.N12.HgN129 =Hf0n.N1 . gn4 gD gV g4``p./< *N1.XOp`H g g" f.p./< *N1.XO .`. ,/< ,N1`p.0n/N1XO`NVHnNXOHnNXON^NuNVB.HnNXOJf:p-@p ./.HnN1POJo6B./< ,HnN1PO`B./< ,!HnN1PONgNN`. lNnJfp .HnHnzN1POJmJ.gp .HnHnz(fpN^NuBB/9 (N1PO. (pd/HnN1PO. ,N1 ./< ,HnN1POJf. (pd//< ɸN1PO 9Y ɸg 9N ɸf@M ɸB/< ,N1 XO//9 (N1PO. (pd//< ɹN1PO. (N1Fp`4NV. TN1n. 4_/< TN1RXO @# (f . 4aBBp/N14O BNyBB/9 (N1PO. (/< ,N1XO. (/< ɸN1XO. (N1F. ;N1. ;/< TN1XO. TN1N^NuNVN^B/< /9 =|N PO-@B9 Ѐ"Ё"| ,A"y 0@#Hv 9N ɼf B9 B` . ɽ/< 4~/<N1POJlnHnz/< ,'HnN1O 9n lfJHnHn/< ;l/< ,*HnN1OJg|J.fV. n w {    (/      . $ D( L v w            ( Z 1 j    <    ,  Create appointmentCreate 0s See Hour at a Time MORE than 2 appt. %c %s %s %s %slock%02d%02d  p appointmentsDelete appointmentModify appointmentEdit keywordEdit noteEdit CalendarMove cursor to desired editing function and press mouse B1 or ENTERNoneDailyWeeklyMonthlyRecur OptionsNoneWeeklyMonthlyYearlyRecur OptionsAMPMAM/PMSelect AM or PMAMPMAM/PMSelect AM or PMOffOnOff/OnSelect Off or OnTime Begin Enter appointment start hour (1 to 12 or 0 to 23 if 24 hour option set): Enter appointment start minute (from 0 to 59)AM/PMAM This field is ignored if 24 hour0  0 %b %c %Time Alarm Comment%02d%.2s%.2sCalendar of %s: of %d/%d/%dNo appointment to be modifiedNo appointment to be deletedMULTIDELETEYou can only modify one appointment at a timepcal.hlpSchedule Appt ' '%u option was setTime End Time End is optional (from 1 to 12 or 1 to 24 if 24 hour option was set): Time End is optionalAM/PM This field is ignored if 24 hour option was setAlarmOff Press Select or Cmd for ChoicesComment Recur PeriodNone Enter the recur period (Press Select or Cmd for Choices Keyword Enter keywordRecur PeriodNone Enter the recur period (Press Select or Cmd f l l 'D 'R &< 'h '~ ' ' ' ' & &Printer OptionSelect printer and touch EnterPrinter name: Touch CMD for choicesNumber of copies: Enter number of copies (1 - 99)PrintPrint fileNo printers are available.%dwCan't create temporary file for printing.pr -o5 -h ' ' %s | lp -c -d%s -n%sCan't print appointments. %d %sCanor Choices) Note Enter note for the date Note of the Daypcal.hlpSchedule Apptpcal.hlpCreate APPOINTMENT for 0000No appointment to be deletedGo to Hour at a Time to select appointment to deleteNo appointment to be modifiedGo to Hour at a Time to select appointment to modifyModify APPOINTMENT for %s %s %d, %dKEYWORD for NOTE for %s't print TO_DO List. %d %sua.hlpPrintPrinter not found.ua.hlpPrintNumber of copies out of range.pcal.hlpPrint CalendarAPPOINTMENTS OF Keyword: %s HOUR Time Alarm Comment %.2s Note: %s MY TO DO LIST ====================================================================== %s /usr/lib/wfont/PLAIN.R.E.11.A/usr/lib/wfont/PLAIN.R.E.12.A/usr/lib/wfont/PLAIN.R.E.18.A/usr/lib/wfont/FANCY.I.E.12.AmoreSunMon   TueWedThuFriSat + + +:Date Comment%sSorry, no active alarms yet for %s %.4s%.2s%.2s%.1s%s%.3s %.3s %02d, %d DailyWeekly %sMonthly %02d %sAlarmspcal.hlpSet Alarm%.12s%.12s%s%s %s /usr/bin/pcal -a %s%.12s%.4s%.2s%.2s%.4swCan't create temporary file.%.2s%.2s%.2spcal.hlpDefault Screenpcal.hlp24-Hour Formatpcal.hlpVisible Hourspcal.hlpVisible Hourspcal.hlpAuto-Deletepcal.hlpAuto-Deletepcal.hlpAuto-Deletepcal.hlpAuto-Deletepcal.hlpOverview%.1s%.1sStart hour is incorrect.%sStart hour is incorrect.%02d%.1sSince Auto delete appointments is optioned Yes, Auto delete appointment period must be between 1 and 99.%02d%.1sSince Auto delete alarms is optioned Yes, Auto delete alarm period must be betwee%.2s%.2s%.1s%.4s%.2s%.2s%.4s%.2s%.2s%04d%02d%02d%.4sr%04d%02d%02d%02d%02dcalpref MN07N01N01 0 0 0 0 0 , , 0 0 0 0 0 -v -v 1 1 1 1 1n 1 and 99%02d %s%.2s%.2s%04d%02d%02d%.4s%.12s%.12s 8B 8S 8c 8w 6 6 8  8 8 8 8 78 78 9< 9 9D 9U 7~ 7~ 9V 9WPrint TO_DO ListSave TO_DO  . . 1- 10 14 15 1< . . 1M 1] 1l 1z 1{ /J /J 1( 1 /r 1 2( 2( . 2- 2V( 2 2 2.< 2 , 2 3 ( 3$ - 3)ListTO_DO List CommandsMove cursor to desired editing function and press mouse B1 or ENTERFile name Enter the file nameSave TO_DO ListTo_Do Enter TO_DO item%3d. %sCalendar of %s: TO_DO ListNo TO_DO item to be modifiedNo TO_DO item to be deletedMULTIDELETETODOYou can only insert before one TO_DO item at a timeInsertCreateYou can only modify one TO_DO item at a timeModifypcal.hlpTo-Do ListFilecabinet/%s 3R( 3x 3| 3( 3 .0 3 3( 4 4 4E 4Q / /AMPMAM/PMSelect AM or PMNoYesNo/YesSelect No or YesNoYesNo/YesSelect No or YesNoYesNo/YesSelect No or YesMonth at a TimeWeek at a TimeDay at a TimeSelect Calendar display mode.Calendar default display modeMonth at a Time Select Month, Week or Day at a Time (touch CMD for choices)Calendar display in 24 hour format No Select No or Yes (touch CMD for choices)Start hoFile already exist. Overwrite?wFile can not be opened for write. TO_DO List saved in file %s._R/usr/spool/lp/pstatusr@(#) pcal:pcal.sl 1.30 .text<.data .bss ;XX1.filegmain.c.text<0.data  .bss ;.filegcalr.c.textl).dataur for Calendar screen displays Enter start hour (from 12AM to 2PM or 0 to 14 if 24 hour option is YES): 00 AM/PMAM This field is ignored if 24 hour option is YESAuto delete appointmentsNo Select No or Yes (touch CMD for choices)Auto delete appointment period (days) Select delete appointments period (from 1 to 99 days)Auto delete alarmsNo Select No or Yes (touch CMD for choices)Auto delete alarm period (days) Enter delete alarm period (from 1 to 99 days)PreferencesCalendar%sr .bss ;.filegdisr.c.text 7.data `.bss ;.file'gdbad.c.text"m.data d.bss ;.file/gminput.c.text),.data t.bss ;.file7   gwdis.c.text> P.data \.bss ;.file?gddis.c.textKt.data .bss ;.fileGgedit.c.textQ.data  f.bss ;.fileOgfiler.c.textZ .data 0A_s0:FPA_d0>_sibuf0`_sobuf0d_tbase1shlbat1shlbatid1access1 alarm1brk1ibrk1sbrk1$chdir1*chmod10chown16chroot1<close1Bcreat1Hdup1Nexecl1Texecv1Zexecle1`execve1fexeclp1lexecvp1rexit1x_exit1~fcntl1fork1.bss ;.fileWgthebell.c.textz.data #.bss ;.file_gthekey.c.textz.data $X.bss ;.filegghdis.c.textz H.data $X.bss ;.fileogprint.cgetpid1getpgrp1getppid1getuid1geteuid1getgid1getegid1gtty1ioctl1kill1link1locking1lseek1mknod1mount1msgctl1msgget1msgsnd1msgrcv1nice1open1openi1pause1pipe1profil1 ptrace1&read1,semctl12.text@.data &<.bss ;.filewgfont.c.text,&.data ).bss ;.filegalarm.c.text .data *Pl.bss ;.filegpref.c.text .data , D.bsssemget18semop1>setpgrp1Dsetuid1Jsetgid1Pshmctl1Vshmget1\shmat1bshmdt1hsignal1nstat1tstty1zfstat1stime1swrite1sync1syslocal1time1times1ulimit1umask1umount1uname1unlink1ustat1utime1wait1write1abort ;.filegtodo.c.text}.data 6(.bss ;.filegpstat.c.textH4.data :$.bss ;rp :poffset :.filegid.c.text|.data :.bss ;SCCS_ID :1abs1atof1clock1crypt1setkey1encrypt1ctermid1 ctime111gmtime1asctime1"tzset1(cuserid1.ecvt14fcvt1:gcvt1@fclose1Ffflush1Lfopen1Rfreopen1Xfdopen1^fread1dfwrite1jfrexp1pldexp1vmodf1|fseek1rewind1timezone0tzname0patblack0patwhite04patgray0T0t_iob00_ctype0 0_iob20 %0 _dbase0errno0environ0PC0BC0 UP0ospeed0LINES0COLS0wncur0 optind0"optarg0&opterr0*optopt0.sys_nerr02FPA_flag06FPftell1ftw1fgetc1getw1getcwd1getenv1getgrent1getgrgid1getgrnam1setgrent1endgrent1getlogin1getopt1getpass1getpw1getpwent1getpwuid1getpwnam1setpwent1endpwent1gets1getchar1 fgets1getutent1getutid1;1$E1*setutent10endute   nt16utmpname1<malloc1Bfree1Hrealloc1Ncalloc1Tcfree1Zmemccpy1`memchr1fmemcmp1lmemcpy1rmemset1xmktemp1~monitor1perror1popen1pclose1printf1fprintf1sprintf1fputc1putw1putpwent1puts1putchar1fputs1scanf1fscanf1sscanf1wuser1wprintf1printw1wputc1wputs1wrastop1wselect1wgetsel1wsetstat1wgetstat1setty1fixterm1physclr11setterm1getterm1baudrate11slkcol1setjmp1longjmp1afmulf1afdivf1afaddf1_cvfd1 _cvif1&fltused1,nlist12setbuf1sleep1ssignal1gsignal1strcat1strncat1strcmp1strncmp1strcpy1strncpy1strlen1 strchr1&strrchr1,strpbrk12strspn18strcspn1>strtok1Dstrtol1Jatol1Patoi1Vswab1\system1btmpfile1htmpnam1ntempnam1tttyname1zisatty1ttyslot1ungefmul18fdiv1>fadd1Dfsub1J_cvdf1P_cvdi1V_cvid1\_cvfi1bafadd1hafsub1nafsubf1tafmul1zexhelp1tolower1wicon1wicoff1toupper1l64a1a64l1_bufsync1setuname1auldiv1eprintf1dbsub__1dbadd__1dbdiv__1dbmul__1ltodb__1dbtol__tc1_filbuf1_flsbuf1lmul__1lmul1ldiv__1ldiv1lrem__1lrem1aldiv1almul1alrem1ulmul1uldiv__1uldiv1ulrem__1ulrem1qsort1l3tol1ltol31tgetflag1tgetent1 tgetstr1tgetnum1tgoto1tputs1"form1(menu1.message141dbtofl__1fltodb__1ltofl__1fltol__1ultodb__1ultofl__1aulmul1 afdiv1dbtst__1fltst__1plock1"dial1(callout1.undial14drand481:erand481@lrand481Fmrand481Lsrand481Rjrand481Xseed481^lcong481drand1jsrand1pftok1vputenv1|targets11setattr1:pb_open1@O1FY1Lpb_gets1Rpb_check1Xpb_weof1^pb_seek1dpb_puts1jpb_name1ppb_empty1vpb_gbuf1|c1wrefresh1track1wcreate1initscr1cbreak1attroff1nl1attron1flushinp1noecho1inch1getch1savetty1resetty1echo1no1w_target1_fpachk1_assert1bsearch1hcreate1hsearch1hdestroy1tsearch1tdelete1twalk1nrand481_startmain<_end  ;oscrmode ; ; ;l ; <4 < <termname =f1 =theappts = = ! cbreak1nonl1wdelete1wprexec1m1wgetc1kcodemap1keypad1 wsigintr1wind1w1winit1$wsetbuf1*iswind10wexit16endwin1<wgetpos1Bwgoto1Hwinstr1N1T1Z1`wnl1fwndelay1lwprompt1rwguser1xwcmd1~wslk1wlabel1, : =readonly =wn =wch =mboxnum = wboxnum =$dboxnum =(chbuf =,E =|o24hour =dmonth =menutype =um =armslk1 armslk2 hmonslk1 monslk2 monslk Xweekslk1 weekslk2 weekslk Hdayslk1 dayslk2 dayslk 8houslk1 houslk2 houslk (doslk1 x   doslk2 doslk rmonslk1 hrmonslk2 rmonslk rdayslk1 Xrdayslk2 rdayslk rhouslk1 Hrhouslk2 rhouslk rdoslk1 8rdoslk2 rdoslk Ogetdir_Z&calprefwcalexitygZr_h|X[ , `@sdayappt mx (my ,mb 0mr 4type 8boxnum <oldbox @newbox Dmpattrs/Xwnhrmenu H+VP7yZDN/homeck>Y0(g/r0}67$ Lwpattrs7swdaybox  JF<daddapptL|DMpdaysetupmoninput)1Vdayinput7=$6CT ^7k>wJKzcurtmptr =sfday lsmonth  incmonth SNfprintr@v =n  QdelapptTmodapptU<editnoteW rwlong \rwshort rwwkdays  busyhour P! gweekarg +E9GFBBTD _kbufkey Pl{JGXrdlong rdshort Bincweek incdate @inchour decmonth decweek decdate 4dechour    4   shourf 8shour "rmlong `rmshort rmwkdays  " =maparray >X- : nweeks I S sday ] smdaybox smrdhead  `gdayarg OVddapptp jthekey $XwiconbNd1dayboxrrddapptrkXbufnote buftodo   (  t  .RladdapptSYY)a6vDdfSUtabbox ,smmonbox stab g q8}2| ,graphitLLwfw,(linedraw4>L!W Nwputattr"hdxrecbuf <packrec^iRi hfrecbuf ltY@WXHYdYindexXghvarname delindex fcalup calfptr  fd1 ZZ]f gjfputrecd%0g^=j*OL[B"gettype$todoform 7r 7~keyform } Zinitrec` noteform *  packtime$  fielderr&t&apptform ()&  buftbmin  buftemin  xbufcom recdate htnruthebell #ttvyaindex hourmenu ${~}~V $f3  prt_stat T   ! lm_prt &<prt_fl &f_prt &fprt_chkgetpentendpentHdofo   rm + 7|str_val~ C  M  W  a  l  w     smarmbuf armfptrs armappts spday *Parmmenu *  B T ,  , N n X *mboxrdmonthsmallrdmdaykeywordtodofieldskrecurmenukeyfieldsnotefieldsarecurmenuapptfieldsoffonitemsgetapptautodelbufapptautodelckunpackrecgetrecurtypeunpackdateampm1itemsbuftbhourbuftehourarecuritemseditkeyworddmthekeyworddtodolistdmonthnextmwhereismousedmonthprevinboxcheckwwhereismouseweektoothersetupsweekdateswhourboxrpattrwdboxpattrwdboxdoeditmenupattraboxapptsinhourcksdhourboxdaytohoursetupadminmenudothemenugraphwargwbusyhourfillsweekdaterdweekglancefillwbusyhou 5( A$timeitoaXf4 ( O , ] @ l Tfprefbuf ɸ y    , , ,ampmmenu , -v - .oarmmenu .0o24items .o24menu . /J /r /prefform 0  fputpref2rdwbusyhourfillsdayapptdrawmorestringrpattrwhboxpattrwhboxgraphdargrdayglanceddkeynotepattheboxrddkeynoteadminitemskarecuritemsampm1menuampm2itemsampm2menuoffonmenudotheforminitformptrsdoapptformaddrectofilegettherecfptrdelrecfromfilemodtheapptgetkeywordcurkeyfptrdokeywordformedittodoitemgetnotestringdonoteformdotodoforminitapptfptrgetthe1streccurnotefptrdoreadcaldoreadwritecalgetcalsinfoinitcalfptrinitkeyfptrgetnextdelfptrgetnextarminittodofptrmassagektimeofrecnex n  ( 5 @ L V f 6 s 6  78 7dtodomenu 7 \  clrflgsR xgetpdestjsetpent*_etext|etext|_edata ;edata ;end  patltgray_bufendtabsys_errlist_buf2endtablocaltimegetutlinepututlineadftyeardaynextmonthdaynextweekdaygethourrecddoneapptsprinttimegetdboxrowcolrget1apptsprintapptdrawsmkeyfillhrfptrfillhritemsdohourmenugetthehourrecfilltheapptptrdeselitemsprtfnamebufprt_namesprt_itemsfcreateprtffcreatetodofont11ptrfont12ptrfont18ptrffont12ptrbase11linebase12linebase18linefbase12linereadthefontcurtimebuffillarmfptrgetnxtfcurminfillarmitemsdoarmmenugetthenextarmgetcurftimegetarmautodelbufarmautodelckmassagetimeofrecopensmfilenextdatedaysprintarmdatearm_gtxcdadf_gtwrdadf_gttokwpostwaitwsigcatchwreadmousewsetmousewgetmouseresettermparselinen_targetswtargetonsharedcalcalfnamebufarmfnamebufpreffnamebuflogdirbuflognamebufs2terminalapptitemstotalapptsinitcaldirbufremotesitestarthourmonthsetupopenpreffilegetcalprefcaldirfckerrmemoryopencalfilearmhandlerreadfontsupcurdatefillmboxesfillwboxesfilldboxesfillmongraphmargfillweekgraphwargfilldaygraphdargweeksetupweekinputhourinputweekwithhoursetupdmonthglancedaywithhoursetudeltimebufapptdeltimebuftempfnamebufbufstrhourbufdelapptbufdelarmbuf1calprefbuf2calprefampmitemsoapptitemsoapptmenuoarmitemsdmodeitemsdmodemenupreffieldsgetprefvaldoprefformgetscrmodeget24houroptgetstarthourdoprefhelpprefinputckpreffderrgetcurminusdaystodocmditemstodocmdmenusavetodofieldsf_savetodofilldofptrfilldoitemsdotodomenusavefiletodo0707070000020304401006440000020000020000030061620000017757000002300000052606etc/fixes/pcal.hlpWlabel = "Personal Calendar Help" Contenpdayofweekgettobegweekdweekglancehoursetupddayglancedhourglancewputstringremotecursorgettmpfnamesixrowcalcktdaysinmonleapyearcksprintdategetcurtimegetnxtcurminupasciidatesitohourfrsmmwkdaysmonthkfptrmonthdatetblendgraphmindexsmonthptrgraphmarggmonthargboxofmdayclrmaparraydmonthtabssetnumberofweeksfillmondatetblfillmontabtblrdmonthglancefillextramongraphmargdrawstringgetmkfptrdmkeywordsdprevnextmonwrastoscreenpattabboxpattrmboxdmonthsmallmdayofboxrdprevnextmonrpattrts = Using Help, Overview, View Calendar, Preferences, Move Cursor, Schedule Appt, Exit Calendar, Set Alarm, Keywords, Notes, Print Calendar, Modify Appt, Delete Appt, Mini-Calendar, Auto-Delete, 24-Hour Format, Visible Hours, To-Do List, Creating Items, Inserting Items, Modifying Items, Deleting Items, Display Mode Name = Using Help Llabel = " USING HELP" Slabel = " HELP" B   ranch = Overview Title = "Using Help" Text = Online help consists of descriptions displayed in \ windows. If a description does not fit in a window, the Up and \ Down arrow keys can be used to view a few more lines of the \ display. The Page key can be used to view the next full page \ of the description, and together with the Shift key, the Page \ key can be used to view the previous page of the description. Screen keys at the bottom of the display contain the names of \ other help displays. Press one y Week at a Time from the Month at a Time calendar: o\IND\Highlight one of the dates in the week you want to \ display, and press SHOW WEEK. To display Day at a Time: o\IND\Highlight the day in either Month at a Time or Week at \ a Time and press SHOW DAY. To display Hour at a Time: o\IND\Highlight the hour in Day at a Time and press SHOW HOUR. To display the previous or next month: o\IND\Either point to the appropriate miniature \ calendar to the right of Month at a Time, then \ press thof these keys to view a \ different help display. Press the TABLE OF CONTENTS screen key to see a listing of \ all available help displays. Select the help display and \ press Enter. Press Exit to leave the help system and return to your previous \ screen. \EOT\ Name = Overview Llabel = "OVERVIEW" Slabel = "OVERVIEW" Branch = Using Help, View Calendar, Preferences, Schedule Appt, Exit Calendar, Set Alarm, Keywords Title = "Main Topics" Text = The UNIX PC Personal Calendar lets you schedule appointe left mouse button, or o\IND\Press the PREV MONTH or NEXT MONTH screen keys. You can point to any of the calendar tabs at the bottom of \ Month at a Time and press the left mouse \ buttton to display Month at a Time for \ the month you selected. For previous week, day, or hour, press the appropriate screen \ key from Week, Day, or Hour at a Time. \EOT\ Name = Preferences Llabel = "PREFRNCS" Slabel = "PREFRNCS" Branch = Overview, Viments, \ set alarms, assign reminders in the form of keywords or notes, \ print a calendar for the day, and set up recurring appointments. The main topics available through Help are: \UL\Viewing the Calendar\US\ How to display the available \ calendar forms \UL\Selecting Preferences\US\ How to customize the calendar \ displays \UL\Moving the Cursor\US\ How to move the cursor in the \ different calendar forms \UL\Scheduling an Appointment\US\ How to set up an appointment \UL\Setting the Alarm\US\ How tew Calendar Title = "Selecting Calendar Preferences" Text = Calendar Preferences allow you to: o\IND\Choose the type of calendar initially displayed \ (monthly, weekly, or daily) o\IND\Customize appointment displays o\IND\Choose whether to delete appointments and alarms \ automatically. Selections are made using the Cmd or Mark keys. Custom items are typed \ in the fields provided. Here are the Preference selections: o\IND\Press the Mark or Cmd keys to select what's \ seen when Calendar o set the beep alarm \UL\Using Keywords\US\ How to assign a keyword to a date \UL\Creating a To-Do List\US\ How to create a list of \ things to do for a particular day, week, or month. Press the appropriate screen key for information on these \ topics. Other topics become available once you \ display one of the above main topics. For a complete \ list of available topics, press the TABLE OF CONTENTS \ screen key. \EOT\ Name = View Calendar Llabel = " VIEW CALENDAR" Slabel = "VIEW CAL" Branch = Overvis opened: Calendar default display mode Month at a Time Week at a Time Day at a Time o\IND\Press the Mark or Cmd keys to select a 12 \ or 24 hour time display: Calendar display in 24 hour format No Yes o\IND\Type in your preference for the start hour (default = 7 AM): Start hour for Calendar screen displays 1-24 o\IND\Press the Mark or Cmd keys to select if \ appointments are auto deleted: Auto delete appointments No Yes o\IND\Tiew, Preferences, Schedule Appt, Exit Calendar, Set Alarm, Keywords, Display Mode Title = "Viewing Calendar" Text = When you select Calendar from the Office, the current month \ appears on your screen. From there you can look at any month, \ week, day, or hour (current, previous, or future) by pressing \ successive screen keys. For example, you could press PREV \ MONTH to display the previous month. Pressing PREV MONTH again \ displays the month before the one currently displayed, and so on. To displaype in the number of days after which to delete appointments: Auto delete appointment period (days) 1-99 o\IND\Press the Mark or Cmd keys to select if \ alarms are auto deleted: Auto delete alarm No Yes o\IND\Type in the number of days after which to delete alarms: Auto delete alarm period (days) 1-99 \EOT\ Name = Move Cursor Llabel = " MOVE CURSOR " Slabel = " CURSOR " Branch = Overview, View Calendar, Schedule Appt, Exit Calendar, Mini-Calendar, Visible Hours   , Display Mode Title = "Moving the Cursor" Text = To move the cursor between dates (Month at a Time), days (Week \ at a Time), or hours (Day at a Time): o\IND\Press the arrow keys. To move the cursor to the first day or hour: o\IND\Press Beg. To move the cursor to the last day or hour: o\IND\Press End. To move the cursor to the current date (Month at a Time or \ Day at a Time): o\IND\Press Home. \EOT\ Name = Schedule ApINTMENT form by pressing CREATE \ APPT from the Day at a Time calendar. 2\IND\Complete the Time Begin and Time End fields as appropriate. 3\IND\Move to the alarm field and press Mark to change Off \ to On. 4\IND\Move to the Comment field and type an appointment or \ alarm reminder message. 5\IND\If you want a recur period, move to the Recur Period \ field and press Mark until your choice appears. 6\IND\Press Enter. \EOT\ Name = Keywords Llabel = "KEYWORDS" Slabel = "KEYWORDS" Brancpt Llabel = "SCHEDULE APPT " Slabel = "SCHEDULE" Branch = Overview, View Calendar, Move Cursor, Exit Calendar, Modify Appt, Delete Appt, Auto-Delete Title = "Scheduling an Appointment" Text = To schedule an appointment, you type the beginning time, \ ending time (optional), set an alarm if you want, enter \ comments about the appointment, and any recur period \ available using the Slect key. To display the form for scheduling an appointment: o\IND\Press CREATE APPT from Day at a Time or Hour at ah = Overview, Schedule Appt, Modify Appt, Delete Appt, Auto-Delete, 24-Hour Format, To-Do List Title = "Using Keywords" Text = You can use keywords to remind you of special events, times, \ meetings, or anything you want. A keyword is assigned to a \ day, not to a week or month. Keywords appear in the date blocks in Month at a Time, at the \ bottom of the day column in Week at a Time, and beside the key \ graphic in Day at a Time. You can set up a keyword to recur on the same day every week, \ or th \ Time; or, press Cmd from Day at a Time, select \BL\Create \ Appointment\BS\ from the menu, and press Enter. To move the cursor between fields in the Appointment form: o\IND\Press Return. To enter beginning or ending time: o\IND\Type the numbers. To change AM or PM: o\IND\Press Slect. To set the alarm: o\IND\Press Slect. To enter comments: o\IND\Type the comments in the \BL\Comment\BS\ field. To set the recur period (to have the appointment recur every \ day, week, or month): e same day of the month every month, or the same date \ every year. Only one keyword can be displayed per day. If \ you have two keywords set up for the same day, the order of \ display is: o\IND\One-time keyword o\IND\Keyword recurring yearly o\IND\Keyword recurring monthly o\IND\Keyword recurring weekly To assign a keyword: 1\IND\From Month at a Time, select the date block to which \ you want to assign a keyword, and press EDIT KEYWORD. \IND\From Day at a Time, press EDIT CAL, sele o\IND\Press Slect. When the fields are completed as you want them: o\IND\Press Enter. \EOT\ Name = Exit Calendar Llabel = " EXIT CALENDAR" Slabel = " EXIT " Branch = Using Help, Overview, View Calendar, Move Cursor, Schedule Appt, Print Calendar, Mini-Calendar Title = "Exiting the Calendar" Text = To exit the Calendar and return to the previous window: o\IND\Press Exit from Month, Week, or Day at a Time. \EOT\ Name = Set ct \BL\Edit \ note\BS\, and press Enter. 2\IND\Type your keyword (up to 10 characters) in the Keyword \ field of the KEYWORD form. 3\IND\Press Enter, or press Return to move to the Recur \ field. 4\IND\Press Mark until your choice (Weekly, Monthly, or \ Yearly) appears, and press Enter. To delete a keyword: 1\IND\Follow the procedures above to display the KEYWORD \ form for the correct date. 2\IND\Press Clear Line, then press Enter. The Recur field is cleared automatically when you Alarm Llabel = " ALARM" Slabel = " ALARM" Branch = Overview, Schedule Appt, Modify Appt, Delete Appt, Auto-Delete, 24-Hour Format, Visible Hours Title = "Using the Alarm" Text = You can set an alarm that beeps when the scheduled appointment \ time is reached. A calendar icon appears on the status line \ when the alarm sounds. You can either point to the icon and press \ the left mouse button, or press the Msg key to read \ the appointment message. To set an alarm: 1\IND\Display the Create APPOexit the \ form. Do not attempt to clear this field. To do so prohibits \ the keyword from being deleted. \EOT\ Name = Notes Llabel = " NOTES" Slabel = " NOTES" Branch = Overview, View Calendar, Move Cursor, Schedule Appt, Keywords, Print Calendar, To-Do List Title = "Using Notes" Text = You can use notes to remind you of special events, times, \ meetings, or anything you want. A note is assigned to a day, \ not to a week or month. Notes appear at the bottom of the Day at a Time calendar. To    enter a note: 1\IND\From Day at a Time, press EDIT CAL. 2\IND\Select \BL\Edit note\BS\ from the menu and press Enter. 3\IND\Type your note (up to 60 characters) and press Enter. To delete a note: 1\IND\Follow the procedures above to display the Note form \ for the correct date. 2\IND\Press Clear Line, then press Enter. \EOT\ Name = Print Calendar Llabel = " PRINT CALENDAR" Slabel = " PRINT" Branch = Overview, View Calendar, Schedule Appt, Exit Calendar, Set Alarm, Keywords, Notes Mini-Calendar Llabel = " MINI- CALENDAR" Slabel = "MINI-CAL" Branch = Overview, View Calendar, Move Cursor, Schedule Appt, Exit Calendar, Keywords, Notes Title = "Using the Mini-Calendar" Text = Mini-Calendars for the previous and next months are available \ in the Month at a Time calendar. Not only do they provide you \ with a view of these dates, but you can use them to display \ their own Month at a Time calendars. To do so: 1\IND\Point to the Mini-Calendar for either the previous or \ next montTitle = "Printing the Calendar" Text = The calendar prints the range of hours shown on the Day at \ Time calendar, or the range of hours that include all \ scheduled appointments, whichever is greater. Your Day at a \ Time calendar could take more than one page depending on the \ number of scheduled appointments. To print: 1\IND\Check to make sure your printer is set up (see the \ \BL\Managing the UNIX PC\BS\ section in the \UL\AT&T UNIX \ Owner's Manual\US\ to set up the printer). 2\IND\Displayh. 2\IND\Press the left mouse button. \EOT\ Name = Auto-Delete Llabel = " AUTO- DELETE " Slabel = "AUTO-DEL" Branch = Overview, Move Cursor, Schedule Appt, Set Alarm, Modify Appt, Delete Appt, 24-Hour Format Title = "Deleting Appts and Alarms Automatically" Text = You can have your appointments and alarms deleted automatically \ after a time period that you specify. You do this by setting \ fields in the Calendar Preferences form: 1\IND\Select \BL\Preferences\BS\ from the Office and press \ Day at a Time for the day you want to print. 3\IND\Press Print. 4\IND\Complete the Print form in the normal manner. 5\IND\Press Enter. \EOT\ Name = Modify Appt Llabel = " MODIFY APPT" Slabel = " MODIFY" Branch = Overview, View Calendar, Move Cursor, Schedule Appt, Delete Appt, Auto-Delete, Visible Hours Title = "Modifying Appts" Text = You can change appointment information using the Modify \ Appointment form. This form contains the same information \ you entered when you created the app Enter. 2\IND\When the Preferences menu appears with Calendar \ highlighted, press Enter. 3\IND\To have your past appointments removed automatically, \ move to the Auto delete appointments field and press Mark. The \ No changes to Yes. 4\IND\Press Return and type the time period in number of \ days, a number from 1 to 99. 5\IND\To have the alarm message deleted automatically, move \ to the Auto delete alarm field and press Mark to enter Yes. 6\IND\Press Return and type the time period iointment. To modify an appointment: 1\IND\Highlight the appointment to be modified from either \ Hour or Day at a Time. 2\IND\Press EDIT CAL and select \BL\Modify appointment\BS\ \ from the Command menu using Day at a Time. \IND\Press MODIFY APPT from Hour at a Time. 3\IND\Type your changes over the existing text and press \ Enter. \EOT\ Name = Delete Appt Llabel = " DELETE APPT" Slabel = " DELETE" Branch = Overview, View Calendar, Move Cursor, Schedule Appt, Modify Appt, Auto-Delete,n number of \ days, a number from 1 to 99. 7\IND\When you have the settings as you want them, press Enter. \EOT\ Name = 24-Hour Format Llabel = " 24-HOUR FORMAT" Slabel = " FORMAT" Branch = Overview, View Calendar, Schedule Appt, Set Alarm, Print Calendar, Visible Hours, Display Mode Title = "Changing Visible Hours" Text = You can change the standard 12-hour calendar display to the \ 24-hour (hours 0:00 to 23:00) clock. To do so: 1\IND\Select \BL\Preferences\BS\ from the Office  Visible Hours Title = "Deleting Appts" Text = You can delete an appointment from your Calendar at any time. \ To delete an appointment: 1\IND\Highlight the appointment in either Hour or Day at a \ Time. 2\IND\Press DELETE APPT. To delete several appointments at once (from Hour at a Time \ only): 1\IND\Highlight the first appointment and press Mark. \ Continue with this procedure until you have marked all \ appointments on the form to be deleted. 2\IND\Press DELETE APPT. \EOT\ Name = and press \ Enter. 2\IND\When the Preferences menu appears with Calendar \ highlighted, press Enter. \IND\The cursor appears in the 24-hour format field in \ the Preferences form. 3\IND\Press Mark to enter Yes. \EOT\ Name = Visible Hours Llabel = " VISIBLE HOURS" Slabel = " FORMAT" Branch = Overview, View Calendar, Schedule Appt, Set Alarm, Print Calendar, 24-Hour Format, Display Mode Title = "Changing Visible Hours" Text = The Week and Day at a Time calendars display 10 consecutive \ hou   rs in a day. The range of hours displayed automatically \ when the form appears are set in the Calendar Preferences \ form. To change the range: 1\IND\Select \BL\Preferences\BS\ from the Office and press \ Enter. \IND\The Preferences menu appears with Calendar highlighted. 2\IND\Press Enter. 3\IND\In the Preferences form, move to the Start hour for \ Calendar screen displays field and type the hour. 4\IND\To change the AM/PM field, press Tab to move to the \ field; then press Mark. Deleting Items, Exit Calendar Title = "Creating To-Do List Items" Text = From within a To-Do List, you can create as many items as you want. \ Each To-Do List item can be up to 60 characters long. To create a To-Do List item: 1\IND\From the To-Do List window, press CREATE ITEM. 2\IND\Type your To-Do List item (up to 60 characters) in the To-Do \ item field. 3\IND\Press Enter. Repeat steps 1 through 3 for each item you want to create. \EOT\ Name = Inserting Items Llabel =  5\IND\Press Enter. When the Week or Day at a Time calendar is displayed on your \ screen, you can change the range of hours. When you exit the \ calendar, the range of hours defaults to the setting specified \ in Preferences. To change the range of hours currently displayed: 1\IND\Press Shift-Page or Shift-Up Arrow to display earlier \ hours. 2\IND\Press Page or Shift-Down Arrow to display later hours. \EOT\ Name = To-Do List Llabel = " TO_DO LIST" Slabel = " TO_DO" Branch = Overview, Using " INSERT ITEM" Slabel = " INSERT" Branch = Overview, Using Help, To-Do List, Creating Items, Modifying Items, Deleting Items, Exit Calendar Title = "Inserting To-Do List Items" Text = Once you create a To-Do List, you can insert a new item into it whenever \ you need to. You can insert a To-Do List item anywhere in a To-Do List. You can insert items into the To-Do List at any time. When you \ insert a new item, the entire To-Do List is renumbered. To \ insert a To-DoHelp, Creating Items, Inserting Items, Modifying Items, Deleting Items, Exit Calendar Title = "Making To-Do Lists" Text = You can create a list of things to do for a particular day, week, \ or month. To display the To-Do List from the Month, Week, or Day Calendar \ screen: o\IND\Press TO_DO LIST from the Month, Week, or Day Calendar \ screen. To-Do List items are set up in the order they are typed in. To create a To-Do List: 1\IND\From the To-Do List window, pr List item: 1\IND\From the To-Do List, point to the item below the spot \ where you want to make the insertion. 2\IND\Press INSERT ITEM. 3\IND\Type your new item. 4\IND\Press Enter. The list is renumbered. Repeat steps 1 through 4 for each item you want to insert. \EOT\ Name = Modifying Items Llabel = " MODIFY ITEM" Slabel = "MOD-ITEM" Branch = Overview, Using Help, Creating Items, Deleting Items, To-Do List, Exit Calendar Title = "Modifying To-Do List Items" Text = Yoess CREATE ITEM. 2\IND\Type your To-Do List item (up to 60 characters) in the To-Do \ item field. 3\IND\Press Enter. 4\IND\Continue typing and pressing Enter until your list is complete. To delete a To-Do List item: o\IND\From the To-Do List, point to the list item to be deleted \ and press DELETE ITEM. To delete several To-Do List items at once: o\IND\From the To-Do List, mark each item to be deleted; \ then press DELETE ITEM. To insert a To-Do List item: 1\IND\From the To-Do Liu can edit a To-Do List item anytime: 1\IND\From the To-Do List, point to the item to be modified. 2\IND\Press MODIFY ITEM. 3\IND\Modify the item. 4\IND\Press Enter. Repeat steps 1 through 4 for each item you want to modify. \EOT\ Name = Deleting Items Llabel = " DELETE ITEM" Slabel = "DEL-ITEM" Branch = Overview, Using Help, To-Do List, Creating Items, Inserting Items, Modifying Items, Exit Calendar Title = "Deleting To-Do List Items" Text = You can delete one or sst item, point to the item below the spot \ where you want to make the insertion. 2\IND\Press INSERT ITEM. 3\IND\Type in your new item. 4\IND\Press Enter. To modify a To-Do List item: 1\IND\From the To-Do List, point to the item to be modified. 2\IND\Press MODIFY ITEM. 3\IND\Modify the item. 4\IND\Press Enter. \EOT\ Name = Creating Items Llabel = " CREATE ITEM" Slabel = " CREATE" Branch = Overview, Using Help, To-Do List, Inserting Items, Modifying Items, everal \ items from the To-Do List at any time. To delete \ an item: 1\IND\From the To-Do List, point to the list item to be deleted. 2\IND\Press DELETE ITEM. 3\IND\Press Enter. To delete several items at once: 1\IND\From within the To-Do List, \ point to the first item to be deleted and press Mark. \ Point to and mark each item to be deleted. 2\IND\Press DELETE ITEM. 3\IND\Press Enter. \EOT\ Name = Display Mode Llabel = "DISPLAY MODE" Slabel = "DIS-MODE" Branch = Overview   , Using Help, View Calendar, 24-Hour Format, Move Cursor, Visible Hours, Exit Calendar Title = "Calendar Display Modes" Text = You can change the calendar display from the preset monthly display to a \ weekly or daily display. Use Preferences in your Office to set the \ display mode you want to use. To set the Calendar display mode: 1\IND\Select \BL\Preferences\BS\ from the Office and press \ Enter. \IND\The Preferences menu appears with Calendar highlighted. 2\ h`. "n q(HH.9 HH//< VNPORS "n q -gJ9 fg J9 dg9 HH./< eNXOJ9 fg J9 lg9 HH./< NXOJ9 dgJ9 egB9 dJ9 egR9 fJf6. /9 N1RXO$@ f. 9 HH//< NFPO.N,-@p. .ЮR/N1TXO @-HB`"n &q ."n#R .m.N1`Rp.HnN1 XOR/N1TXO @&H ."n#Hn .R"n/1N1PORp2.HnHRN+hPOrg .".Үm ."nB-n .Ѯ.N1F .IND\Press Enter. 3\IND\In the Preferences form, move to the Calendar default display \ mode field. 4\IND\Press Mark to display the calendar \ display mode you choose: Day at a time, Week at a Time, or Month at a \ Time. 5\IND\Press Enter. The new display mode is used the next time you open \ your calendar from the Office. \EOT\ 0707070000020262221007550000020000020000031553400000017757000001100000052754etc/fsckR  B| @ .textB|-@-@`SR` ~ f ~ f~p fr. N1B .".lJB`( .Ю"n &q .Ю#R .m .Ю"n B. NJ9 f NR9  .R"n .NSJo*B9 p#  ."n .N'Jf`BN1xL N^NuNV././. /.N1O N^NuNV././. /.NO p.N1xN^NuNVHp.N1$# 4 <"9 4Y# 4`  4  4e. 4N1$ @# tg  4d9 HH./< NPXOt`2p .data H@.bss @.lib $, $,g*pg$.Bd/N1nXO-@Jg ./N1nXORp mHnBN1POrf9 HH./< NXOp0. f3 LN^NuNVH y fJ9 jg(./< #N1XO. $/< #N1XO`B9 #.NJgJ9 jf . #9 HH//< (N1PO# #3 #`"N%$@ gp0g3 # #p0 gHp0 @g6p0 `g$p0 gp0 fp` L N^NuprfH 09 #./< #9 HH//< RN1O Jg . nN1. {`"R $B/< $,N1X OQ./HJf/H#0NR9 n`6R9 /9 t/< N7O B9 J g 9 r ./9 tN0XO-y ` n-P nJf 9 r . N1. N1"y tA-H` B( nr!A n"n n  n tdB9 pJ9 nfJ9 jf . #9 HH//< 'N1PO3 # | # # #R #p.BN%XOrb@0; NJ&d. #9 HH//< JNPO. uNz. N"Jg N!$@ f . NR `.. N<. N1. N"`Jf . NxBp/N$XONR9 J9 jf . #9 HH//<    N1PO3 #`p.BN$XOrf#; ##  =y #3 # #N $@ g8# $By #p.HRNXO3 # #gp.BN$8XOrg3 # #N/rf* | # # R ?#R #N3 #Ry #09 #y #c*J9 jf . #9 HH//< N1PO# #3 #`p.BN#XOrg$rgrfp./< !NXO`p.BN%XO$g 0@.N`j&| з `dZ0y #f|Np$@ g2Jg,N.$fB/<  NXOpf ./< NXO`p./< NXORy #09 #y #c0RKAdJg JgR`~J gAf@ .f:J+f4R09 #RgTp09 #./< #9 HH//< `pAfr .fj +.f`J+fXRJRg E eJ gpoxp09 #./< #9 HH//< >N1O ./< #9 HH//< fN1O N. /< #9 HH//< t`|Jgp09 #./< #9 HH//< N1O ./< #9 HH//< N1O NH. /< #9 HH//< N1O p`p`NVH$. $ m $$mr./< NnXOR #p #nFp09 # $r29 °g. #9 HH//< )N1POJ9 lfJ9 jf. QNrf09 #y $3  J9 lfJ9 jg . #9 HH//< UN1PO. /< N%fXOJ9 jf . #9 HH//< bN1POJ9 dfJ9 egN1Bp/N0XON^NuNVH Bp/NXON^$@ gnJ9 mgJ9 f p.HRNXO&y  y R /-y $# $pG`.Jg(Afp`p./ nNXO&gpf8XKAܷep-@po,Jg,././N*PO&gpg L N^Nup`XKR`NVH $. pf -|`4Jf&-y #. nN&f L N^Nu-| . $ m& $$lB.p-@.HnN8XO @ fp`SE`8Jg2Jo.//N\PO` B/ nNXO&g pfzXJAep`lNVH $.BB费 $ m $$l./< NXO @ f pL N^Nu$| `GB`Jp09 #./< #9 HH//< N1O `0 /g*JfJRgAgR.HRNXO# p  y B# $L N^NuNVH $. $ m $$m  $`0$| `./< NXO @ f < 鈑 $pL N^NuGI`#bHn y #NXO&g2./< NtXO @ gGI`$b `pƀg `Ep $ d J $nNJ $op`hp`bNVH./< #9 HH//< @N1O NtN $@ g|p0 gJp0 @g8p0 `g&p0 gp0 f . p0 @f | P` | THP/< INPOp   0 @fp lL.N-@f . Y`pg. gN1J9 ff. p`*. }N1`. N1J9 ff. N1pLN^Nu. N1`p0 fvJfn. N1J9 ff. `. N1`B. /< NXOJf8. N1J9 ff . `d. N1. N `R. `NVH 4. N $@ g20*Bf4N &fB/< NXOpf./< NXOL N^Nu09 #y #f y ` p0 @f | ` | ./< #9 HH//< N1O N0*H2H.J9 ifr./< #9 HH//< N1O . #9 HH//< BN1POpP./< #p/<0NPO$pf . XNJgHn/< #pN1tPOJmp0. fR9 q./< #pN1HXO# ,mB/< #pN1XO# (l6. #p/< #9 HH//< ZN"O N JpL N^Nu. N1. N1"nEB `B*p%@$ # Ed$y B`%@|./< (NXOR .찮mڑ# # |# xB # 9 $r JjDD`# $ .r JjDD`й $# $ # $ $`J9 pgZ .0j//< #9 HH//<  N1OJ9 jg JBl. )N1N. +N1J9 jf. 6N rf"j `NVHN $@ gFp fp0 fJ9 lgJ9 fgVp0 @f | H`LN^Nu | L././< #9 HH//< =N1ONp0 @fp lF.Nv-@f. Q`\pgZ. _N1J9 ff. h`(. uN1`0. wN1J9 ff. N1`. N1p0 f6Jf$. N1J9 ff. `. `. N1p0 f&J9 oL r ѹ p7 d# 9 4"9 剐& 9 r "y tA-HB # x n $# # |# #p`NVB/.N1XO# l&./< #9 HH//< pN^O `:p./.N1XO#  lp#  p./<  NDXO @ f N NpN^Nup`NVH 09 #y #c`# $$ `p09 #rЁ$J9 pg&y t m 9 й eZJ9 g" 9 r ./9 HS/< NO B9  9 r ./HS/< NfO Jgh#  r E`./< NTXO @ g($| p09 #ffJ9 lf . N1. `lp g,J9 jf. N rfJ9 jg . `8.N`vNVH$nS $# #BHRNXOp@.HRNXO LN^NuNVH$n (o <(` *-@p .Hj HnN1POG`Jg  $ m $$m ./< `./< N&XO @ f./< N1XOpLN^Nu(| `* ,.fJ,g ,.fJ,gJTf&pIJnXKJnnJnp`p`NVH Hn/< N1tPOJl. #9 HH//< NzPO3 $(Hn/.N1tPOJl ./< #9 HH/rЁrA L N^Nu`NVJ9 jg . N kB../< #9 HH//< N1O J9 ffJ  l. N1`vJ9 gg. N1`HJ.fXpP.Hn/<0NrPOrf . N~. N1 .yg .YfpN^Nu .ng .Nfp`. #9 HH//< N1POB.`xNVH $n .SG`pgN |0 0(fd  nSm n"hR@H` .N1$p fB L N^NuNVH v`p fR nSm n"hR@H` .N1$pf L N^NuNVH$nJ/< (`jB9 oB9 pp0. `f09 $(ngFHn0n/N1POJm6J9 ff(./< #9 HH//< G(y f.JgAf& Re0y #b3 #pLN^Nup`RK`NVH $nJRg pL N^Nu4 #49 #G`B#<%s> %c %c option? %c Incompatible options: -n and -s %c Incompatible options: -n and -q r%c Can't open checklist file: %s 512 byte blocks not supported %c Can't get memory %c Can't fstat standard input %c %s** Phase 1 - Check Blocks and Sizes %c %sUNKNOWN FILE TYPE I=%u (NOT EMPTY)CLEAR%c %sLINK COUNT TABLE OVERFLOWCONTINUE%c %sPARTIALLY ALLOCATED INODE I=%u (NOT EMPTY)CLEARINTERNAL ERROR: dups with -p%c %s** Phase 1b - Rescan For More DUPS %c %s** Phase 2 - Check Pathnames %c %sRAfAc p0r .N10HBBBHB `p `NVH$n *.f *.fJ*f4 #p LN^Nup`NVH N$@ g`p0 @fp`p$69 #p0 fJ9 lgJ9 fg:Jg | y` | }./< #9 HH//< jN1O Np0 @fp lh.N-@f(. N1J9 ff . ` . `fpgb. N1J9 ff. `(. N1`8. N1J9 ff. N1pL N^Nu. N1p0 f6Jf$. N1J9 ff. `. `. NOOT INODE UNALLOCATED. TERMINATING. ROOT INODE NOT DIRECTORYFIXDUPS/BAD IN ROOT INODE CONTINUE%c %s** Phase 3 - Check Connectivity ..%c %s** Phase 4 - Check Reference Counts UNREFUNREFUNREFUNREFBAD/DUP%c %sFREE INODE COUNT WRONG IN SUPERBLKFIX %c %sFIXED %c %s** Phase 5 - Check Free List (Ignored) %d BAD BLKS IN FREE LIST %c %s%d DUP BLKS IN FREE LIST %c %s%ld BLK(S) MISSING %c %sFREE BLK COUNT WRONG IN SUPERBLK %c %sFIXED FIX%c %sBAD FREE LIST %c %sSALVAGED SALVAGE%c %s**    Phase 6 - Salvage Free List %c %s%ld files %ld blocks %ld free %c %s***** FILE SYSTEM WAS MODIFIED ***** %c %s: %c %s: UNEXPECTED INCONSISTENCY; RUN fsck MANUALLY. %c %sNO VALID '.' in DIR I = %u %c %sNO VALID '..' in DIR I = %u %c %sMISSING '.' or '..' in DIR I = %u %c %sBLK %ld %c %sDIR=%s %c %sBAD DIR ENTRY I = %u %c %sBLK %ld %c %sDIR=%s BAD%c %sEXCESSIVE BAD BLKS I=%uCONTINUEDUP%c %sEXCESSIVE DUP BLKS I=%uCONTINUE%c %sDUP TABLE OVERFLOW.CONTINUEDUP%c %sDIR pathname too de 4 0 .text4 .data 0 @.bss 0 0.lib ep %c %sIncrease MAXPATH and recompile. %c %sDIR pathname is <%s> I OUT OF RANGEUNALLOCATEDDUP/BADBAD BLOCKS IN FREE LIST.%c %sEXCESSIVE BAD BLKS IN FREE LIST.CONTINUE%c %sEXCESSIVE DUP BLKS IN FREE LIST.CONTINUE%ld %s I=%u %c %s%s %s=%sDIRFILE (NOT EMPTY) (EMPTY) -- REMOVED (EMPTY) -- REMOVED (EMPTY) -- REMOVED NAME=%s (EMPTY) -- REMOVED (NOT EMPTY) REMOVEUNREFUNREF%c %sLINK COUNT %sDIRFILE %c %sCOUNT %d SHOULD BE %d ADJUSTED ADJUST%c %s%s %sDIRFILE/< N1X (NOT EMPTY) (EMPTY) -- REMOVED (EMPTY) -- REMOVED (EMPTY) -- REMOVED (NOT EMPTY) -- CLEARED CLEAR -- CLEARED chkempt: blk %d out of range chkempt: Can't find blk %d /%c %sCan't stat root %c %sCan't stat %s %c %s%s is a mounted file system, ignored %c %s%s is pipedev, ignored%c %s%s is not a block or character device %c %s NO WRITE ACCESS (NO WRITE) Size check: fsize %ld isize %d %c %sFile System: %.6s Volume: %.6s %c %sNEED SCRATCH FILE (%ld BLKS) %c %sENTER FIL OQ./HJf/H#0NJf8 n  n  n $n` Am Zn RJJfp`*NV L N^Nu J J`NVH t` "n BRm&n$KtJg>l8`RJRK  g  gJg" "n #`HnHRNxPO` L N^NuJg \g  g  f RJBR``NVH $n* HH.N1N$pgP* g&| `* g&| `* g &| ./N1^XO @ L N^Nu.N1B`NVHJ 8lHn/<  D J P W@ ] c i m q w {           @  @                     ! % )0 -ICANON ECHO ECHOE ECHOK TAB3 #\nWelcome to the AT\&T UNIX pc\n\nPlease login: #110 300# B300 CLOCAL BRKINT IGNPAR ISTRIP IXON IXOFF ECHO OPOST ONLCR # HUPCL BRKINT ISTRIP ICRNL IXON OPOST ONLCR B300 CS8 CREAD ISIG ICANON ECHO ECHOE ECHOK TAB3 #\nWelcome to the AT\&T UNIX pc\n\nPlease login: #300 600# B600 CLOCAL BRKINT IGNPAR ISTRIP IXON IXOFF ECHO OPOST ONLCR # HUPCL BRKINT ISTRIP ICRNL IXON OPOST ONLCR B600 CS8 CREAD ISIG ICANON ECHO ECHOE ECHOK TAB3 #\nWelcome to the AT\&T UNIX pc\n\nPlease login: #600@ 4 : A H N U Z a g l r x@           @;@           /etc/utmploginIGNBRKBRKINTIGNPARPARMRKINPCKISTRIPINLCR 1200# B1200 CLOCAL BRKINT IGNPAR ISTRIP IXON IXOFF ECHO OPOST ONLCR # HUPCL BRKINT ISTRIP ICRNL IXON OPOST ONLCR B1200 CS8 CREAD ISIG ICANON ECHO ECHOE ECHOK TAB3 #\nWelcome to the AT\&T UNIX pc\n\nPlease login: #1200 2400# B2400 CLOCAL BRKINT IGNPAR ISTRIP IXON IXOFF ECHO OPOST ONLCR # HUPCL BRKINT ISTRIP ICRNL IXON OPOST ONLCR B2400 CS8 CREAD ISIG ICANON ECHO ECHOE ECHOK TAB3 #\nWelcome to the AT\&T UNIX pc\n\nPlease login: #2400 4800# B4800 CLOCAL BRKINT IGNPAR ISTRIP IXON IXOFF ECHO OPOST ONLCR # HUIGNCRICRNLIUCLCIXONIXANYIXOFFOPOSTOLCUCONLCROCRNLONOCRONLRETOFILLOFDELNLDLYNL0NL1CRDLYCR0CR1CR2CR3TABDLYTAB0TAB1TAB2TAB3BSDLYBS0BS1VTDLYVT0VT1FFDLYFF0FF1B0B50B75B110B134B150B200B300B600B1200B1800B2400B4800B9600EXTAEXTBCS5CS6CS7CS8CSTOPBCREADPARENBPARODDHUPCLCLOCALISIGICANONXCASEECHOECHOEECHOKECHONLNOFLSHnonevt100hp45tektronixtekds40-1vt61tecLDISC0defaultLOGIN: default/dev/syscon/etc/issue/etc/gettydefs%d%dgetty: timeout PCL BRKINT ISTRIP ICRNL IXON OPOST ONLCR B4800 CS8 CREAD ISIG ICANON ECHO ECHOE ECHOK TAB3 #\nWelcome to the AT\&T UNIX pc\n\nPlease login: #4800 9600# B9600 CLOCAL BRKINT IGNPAR ISTRIP IXON IXOFF ECHO OPOST ONLCR # HUPCL BRKINT ISTRIP ICRNL IXON OPOST ONLCR B9600 CS8 CREAD ISIG ICANON ECHO ECHOE ECHOK TAB3 #\nWelcome to the AT\&T UNIX pc\n\nPlease login: #9600 19200# B19200 CLOCAL BRKINT IGNPAR ISTRIP IXON IXOFF ECHO OPOST ONLCR # HUPCL BRKINT ISTRIP ICRNL IXON OPOST ONLCR B19200 CS8 CREAD ISIG ICANON ECargument invalid. "%s" Check Mode Usage: getty -c gettydefs-like-file rCannot open %s getty: no terminal line specified. getty: unable to find %s in "%s". getty: %s is an undefined terminal type. getty: %s is an undefined line discipline. /dev%.9s r%slogin/bin/logingetty: pointer to next speed in entry %s is bad. getty: unable to find %s again. LOGIN/etc/wtmpr+wr+getty: cannot open "%s". errno: %d idinitial flagsfinal flagsmessagenext idrgetty: can't open "%s". Entry too loHO ECHOE ECHOK TAB3 #\nWelcome to the AT\&T UNIX pc\n\nPlease login: #19200 0707070000020274231006440000000000030000031642200000017757000001200000000273etc/grouproot:NONE:0:root other:NONE:1:daemon,lp bin:NONE:2:root,bin,daemon sys:NONE:3:root,bin,sys,adm adm:NONE:4:root,adm,daemon mail:NONE:6:root,uucp,nuucp,uucpadm users:NONE:100:tutor,install 0707070000020263001007550000000000020000031171230000017757000001400000004170etc/hfc_ctlR ( 0x .text0    .data x@.bss x x.lib x x/< xN1X OQ./HJf/H#0N ` %ld0707070000020262441007550000000000020000061615240000017757000001100000033070etc/initR  *l8D .text*l .data 80@.bss 8 8D/N1POJfpN^Nup`NVJg^ y |f #" |`&-y |`6 n h"f n"n!i"".N1HpN^Nu n-h"Jfp`NV-y |` nfpN^Nu n-h"Jfp`NqNVp&.p/N1TXO @-Hf N^Nu nB"J |f # |`(-y |` n-h" nJ"f n!n"R  n!y  n`.lib | |   /< |N1X OQ./HJf/H#0N*g .Ѐ"| qgBj` .Ѐ"| 5qJjf v`R`v. /. N1XO n G`:p f .\gBB`F n Aev` p\f .\ft @. RN1$Jgpfzpf8p-@%n Jjf5|Jjf5| n Af n B`BpfN .`NV. RN1FB RN^NuNVH .Sr bj@0; NJ "&*.26Z:BJRt`>t`:t`6t`2t`.t`*t `&t@`"$<`$<`$<` $<`t LN^NuNVH p tf4$| $`$0* HrCfp .?*BgN1XOE de$| $`V0* H@Hr fp0*.N  `*0* Hr r fBHRp/NPO* fBj E deLN^NuHnHnNPOrf$| $ dd* g.f&*.f*.f*.fpf `pgp 0g2 ng(. 0N62.H€fb* fX`NVH9  g  # 4. 0N=@`BNJg. N`0* Hrrf 0.H@g0.H 4rgj0.H 4g* f0.H2.Hgp.Ur bT@0; NJ  $(,0D48<@t0`*t1`&t2`"t3`t4`t5`t6`tS`ta` tb`tc`t?HHLN^NuNVH$.Bp/N1nXO`N1BBN,XO$@g.p/N1nXO f,p./N1XOp.Np ./N1XOBN1xLN^NuNVpH J 0m 9 0"| lAR# 0 p # 0p0# 4NN V` nf.$<vJo0.Hg "| -qS` nfHnNxXO$@ gBp/N1nXO&Jp .HSNXO$@g.p/N1nXO f|v-|0`.N1FRpmv-|0    `.N1FRpPmB/./< -/< &/9 ,N1TOp.N1x` .NrgBj HnHnNDPOrgJg .L N^NuBp/N1nXOp.BN,XO$@g.p/N1nXO fZ. 0/9 N1RXO @-Hg4Hn( HH/N1POrgHnt/9 N1tPOrg0.ngB/< 3N1XO-@rgp.HnNvXO. 8HnN1XOp.Hn/.N1,POrfNp.HnHnN1POHn/9 N1POJgHnHnN1tPOrg0.nf0.ng. D/.N1XO`Hn/< /.N1O .uNVH$n`RJ  g  g .gB /g< _g6 am zo* Am Zo 0m 9o |  LN^Nu&J` /fGRJ  g  g  gJf(| 8`۹ @deB | 8`NVH.0N1F.0N1F.0N1FBN1Bp.N1Bp.N1B. /9 N1RXO$@ fN|. /9 N1RXO$@.N.NBHRN1XOB/<0N1XOB/<0N1XOy . HxT* HH/N1POLN^NuNVH. /9 $N1RXO$@ fNLN^NuHnHnHnHnHnHnHnHnHnHnHnHnHn/< HRNN1L.N1FBN1x.Nrgp`RNVH.4p/N1nXO.4p/N1nXO.4p/N1nXO.4p/N1nXO.4p/N1nXO.4p/N1nXO.4p/N1nXO.4p/N1nXO.4p /N1nXO.4p /N1nXO.4p /N1nXO.4p /N1nXON.p/N1nXO.p/N1nXO.p/N1nXO.p/N1nXO.8p/N1nXOt`./N1nXORp oLN^NuNVHpf # 0 `# $| $` BBjE de  .4/.N1nXOLN^NuNV.1O<-@p fX3 3 3 3  B` .C1"| Rpn`p./< /< 8NPO.N1F`,NVH. N1. /9 N1XO.[N1. /9 $N1RXO$@p./< /< 8NPOp9 .p9 /p9 /p9 /p9 /p9 /p9 /p9 /9 HH/?9 Bg?9 Bg?9 Bg?9 Bg/< HRN1O8.N1FN1BN1LN^NuNVH Bp/N1nXO`p.Np.BNXO&@g.p/N1nXO fn. /9 N1p/N1nXOp# t.,N1N^NuNVHHnN1XO$$| $`F* g:p0*f0j 5n  .p/N1nXOLN^NuE dd`NV  .8p/N1nXON^NuNVHBp/N1nXOp.BNXO$@g.p/N1nXO fZp./9 N1XO-@rg\. 8HxT/N1POp.B/.N1PO# x.N1B.$p/N1nXO.$p/N1nXON6p./< /N1POp.N1B.`>.HH"| 1HH.N1x` .gp./< p/N1PO .gp./< p/N1PO` .RXO$@ f. /< NRXO`F. HxT* HH/N1POrg$y . HxT* HH/N1PO.N1F.[N1. /9 $N1RXO$@ f.0/9 $/< NPO`p9 .p9 /p9 /p9 /p9 /p9 /p9 /p9 /9 HH/?9 Bg?9 Bg?9 Bg?9 Bg/< 4HRN1O8.N1FN1BN1xL N^Nu.Nrf`NVHp  fnBp/N1nXO`p.Np.BN(XO$@g.p/N1nXO f@NHn/<0N1POBN1xLN^NuNHn/<0N1P g . fp.HnBN1,PO`. .Sg .sf|7 .0mx .7nn`J.N-@rgB  .LN^NuNV./.N1nXOp xgNNp# x.$/.N1nXON^NuNVH $n&| $`.0+ Hrrf+ gBHSp/N\POBk G deN1$pf8p.N1.p/N1nXO-@N1.p/N1nXO`Jg| fP$| $`EJj g de df&BNJg . AN | L N^NuBBjBB*B*B* 5@0.@5@ Bj`8N1#  .N1Dp-@`B/.NO`.Nrf`NVH $.HnN1XO "| Jg &1 "|  1".m "| #pL N^Nup`NVH.N`N1J tgLN^NuNV.N1B tN^NuNVH$n$. `B SJfLN^NuNVpfpѮ n PJ(g. \/<0N1XOB` n PHH @6g,nN @2gn$ @0g @1f\p`p-@`lp`p` @3g @4g @5f2p`p`p` @bgn" @Qg @Sg, @afp `p ` @cg @qg @sfBN1z-@ @Jf. z/<0N1XOp.N1x.NJg1nXORp l J`NVH$n* gN1* g pLN^Nup0*-@Bj .`NVH$n Gp.HSNJXOp .Hk N /dev/null 2>&1 vid:2:respawn:/etc/getty window 9600 :ph0:2:respawn:/etc/getty ph0 1200 :ph1:2:respawn:/etc/getty ph1 1200 :000:2:respawn:/etc/getty tty000 9600 0707070000020274251007550000020000020000030000xx   ( 5 A M _ g0 &+@             @000000017757000002100000000000etc/ioctl.syscon0707070000020044721007550000020000020000031555630000017757000000700000056660etc/ivR U ? 9 .text?  .data D@.bss  9.lib S S  /etc/utmp/etc/utmp/etc/wtmp/etc/inittab/dev/systty/dev/syscon/etc/ioctl.syscon/bin/su/bin/sh%s.lckw+Cannot create %s New run level: %c SINGLE USER MODE -execlp of %s failed; errno = %d Internal process table is full. PATH=/bin:/etc:/usr/binCommand is respawning too rapidly. Check for possible errors. id:%4s "%s" exec exec INITSH-cCommand "%s" failed to execute. errno = %d offrespawnondemandoncewaitbootbootwaitpowerfailpowerwaitinitdefaultsysinitrCannot open %s. errno: %d exec exec exec /dev/INITSH-cr+/dev/dev//dev/ Init: system console is remote. Type to regain control. Init: system console is remote: %s Type to regain control. ENTER RUN LEVEL (0-6,s, or S): ENTER RUN LEVEL (0-6,s, or S): Usage: 0123456sS Usage: 0123456sS Internal process table is full. run-level %c%.12ssystem bootfailed write of utmp entry: "%2.2s/< SN1X OQ./HJf/H#0NXO$ ."ЀЁ"| x#Hn/.NPO-@HnN XO$ ."ЀЁ"| |`. ."ЀЁ"| |Ar $ ."| hA. ."Ё"y CAHPN1XORpnN*`^NVHt` "| # BR m y  UQVQLN^NuNVp-@` ."| JgS Rpl9 g$p o. /<0N1XON &J gJp o. /<0N1XON &. d/9 N1XOJf y Bh`N^Nu. g/9 N1XOJg. j/9 N1XOJf y 1|`F. n/9 N1XOJf y 1|` . /< q/<0N1PON &B`" ."y 1"y CRpoJ fpo ."y "ЀЁ"| x# nJg HH./<  /<0N1PONnRpl. G/<0N1XONJ.HnN(XOJg.HnHnNPO-@. HnN1XOJf`# $B`JHnHnNPO-@. |HnN1XOJg6HnNXO$ ."| 4# nJgP.N1 r(o./< ~/<0N1PON ."Ё"| hA./.N XO-@ nJg./< /<0N1PON8Jf J 4g. /<0N1XONJo8 ."| 4$1 .S 1o. /<0N1XONRpn. 5/<0N1XON.CB1R`. NP"y 3@ y Jhg hc( y r2(./< /<0N1PON &. NP"y 3@ y h e h c( y r2( ./< /<0N1PON &. NP"y 3@ y Jh f. /<0N1XON & y "H0( 3@. NP"y @ y J(m (o* y (HH./< M/<0N1PON & y 1| y | y hfJ g4 y hg. /<0N1XON & y (J g\ y hg. /<0N1XON & y (f   . /<0N1XON & y J g y hf. //<0N1XON & y `NVp-@B y ( gJ f. ]/<0N1XON & y !n`Hn/9 NPO-@HnNPXO"y 3@d. /.N1XOJf  "`X nJgP./< /<0N1PO`J g. /<0N1XON &` y Bhd y B` y r2(dӮJ g!nZ. ' /9 NXO-@Hn/< ' N1tPOJg. ' /< :N TXON & .r JjDD`-@ nJgXHn/NPO-@HnN 1r®g pLN^Nup`NVH . &pr®"| +Á .L N^NuNVH<| y r2( . .N1& y r2(. .N1( y r2(. .N1*ʗ(| ' y Jhdf./< N1XON &Jf. /<0N1XON &PLt`JTfJlgp0f p0,glp0fp0,Ѐ"| 'KJlg 0-ld./< E/<0N1PO f p0,e0,jcp0,d$L`.L<|N^Nu f p0,b0,kd p0,c&LPLR m< y r2( . N1"y 2) HABAHASf.NPXO"y 3@^ y r2(^ .԰cD. c/<0N1XON &`( y 1n^` y r1A^ 0"y #@Z y r2(^ӮJ g.!nf. NP"y 3@j y r2(jӮ` y Bf y Bhj y Bl y BhpJ  g. 'L/9  NXO-@Hn/< 'LN1tPOJg. 'L/< N TXON & .r JjDD`-@JfL y Br y 1|vp./9 NXO".Բor. /<0N1XON &`T y !nr.NP"y 3@v y r2(vӮr2(v .԰b` y Br y BhvB/9 NXO".زoJfv(| 'PLt`^p0,fN y 2p0,Ҁ-Ap0,-@-B`89l 9l 9lRPLpnBTBlBlBl(| 'p-@`&p0,f9n`p0,cSlRPL m -@,prƒF"| +Q ' y r2(. .N1-@ y r2( .N1. y r2( / .N1XO/ y r2(/ .N1XO//< nN1O .N.N`&RPL m m./9 /<0N1PON & gN g*p0*"  '恰g./< /<0N1PO y '1j 9 ' '5@`$ g y '" . /<0N1XON &N^NuNVH# ' 'P 't` "| +BR mJ9 "gJ9 "g$| 't`BR m`lBHx/9 N1PO./< '/9 N1,PO(./< 'NXO& mpg"$| 't lBR`pLN^Nut`x y 'JPfJhf y 'Jhgb y 'r2(.N .NLJg ` ЂR.N6Jg ЂR.N"y '3@` R m y r2( S. y 'r2( y 0( H@B@H@/ N1XO/ y 'r2( y 0( H@B@H@/ N1XO/ y r2( / .N1XO/ y r2( / N1XO///9 N1OP '`,NV nJf. /<0N1XOp.N1x9 g 9 R ./< N1XON/J9 "f6J0g. /< N TXON^Nu. 2/<0N1XO`. B`"ЀЁ"| x f ."ЀЁ"| t-q`j 9 m ."ЀЁ"| t 1"y 2)HABAHA./N1XO-@ ."ЀЁ"| x 1"y 2) HABAHA./N1XOѮ ."ЀЁ"| | 1` ."ЀЁ"| t 1"y 2)HABAHA./N1XO-@ ."ЀЁ"| x 1"y 2) HABAHA./N1XOѮ ."ЀЁ"| |-qpm( y "H0( ".c Ir2( SӮ` N^Nu y r2(. .N1Ѯ y "H0(".c././< /<0N1O `./< WN1XO.NfR .HxG/9 N1POJl. /< LN TXON & y ( gN`p .Hn/.N1JPO-@ n :g. /<0N1XON &Rp .Hn/.N1JPO-@ nJg. /<0N1XON & .Ѐ-@ ."y C 1"y 2) HABAHA./N1XOѮ./< N1XO.N@`. i/<0N1XON & nX-PfN`NqNVH9 g4 y 0(H"| <. 9 R //< oN1POv`0(H @fN|`2$| ;BB y h bp-@z`NRpPm`p-@z`NRp2mz`B $l`NVH $nv$`֚R m L N^NuNVH $| '&J y JhdgB9 g 9 R ./< N1XOPKv`JSfJkgPKRpm` L N^Nu  'S&g  'S./9 N1XOB./< 'N.XORD$B y  (`r //9 N1PO./< '/9 N1PO$ l./9 /<0N1PO.G/9 N1XO$pf. N1N &. N1Bp./9 N1XO# p f. /< N TXON &`NVHJmD y "H0( ".b, .$ l "| +Rp mz`Rpmz`Rpmz`NRp2mx`z`BRp mz`Rpm   .SЀ"Ё"| AHz`NRpmz`BRp mz`Rpmz`BR m y h bz`NRp6m`z`NRpmR y r2( e*z`NR mB y r2( //N1POІ"y 2)HABAHA//N1PO"y 2) HABAHA//N1PO//9 N1PO  ;-@$| ;.. ;HxG/9 N1PO$g. N1p.N1xR y r2( e`(|`   $| ;BBB y  B$x`Bpl `p ЄR y r2( e lPR`B y r2( //N1POІ"y 2)HABAHA//N1PO"y 2) HABAHA//N1PO//9 N1PO  ;-@$| ;.. ;HxG/9 N1PO$g. N1p.N1xR y r2( eR y r2(enLN^NuNV y "H0( -@9 gp `p-@9 g 9 R ./< N1XOB`R .mR .mN^NuNVH y r2( p jDЮ-@` l .` <-@.Hn/.N1,POl. 4/<0N1XON &.Hn/9 N1PO l. /< /N TXON & .Jfl.N1BN^NuNVp.B/.N1PO-@B//.N1POJl. /< SN TXON &N^NuNVB/< 'LN1XO-@l. 'L/< oN TXON & y JrfN(g y  (` y 0("y 2) HABAHA./N1XO-@` y -hrB .r //9 N1PO`6.Hn/9 N1POJl. /< N TXON &.Hn/.D`,$| ; y r2( ./.N1XO$x`p. N1H"| $RmB r //9 N1PO y r2( p ./< ;/9 N1PO* y r2( p ᩺fB r //9 N1PO y r2( p ./< ;/9 N1,PO* y r2( p ᩺f6$| ;x`"p. N1H"|  1"fRmڸg y r2( ./.N1XO"y 2) HABAHAЁS$B r //9 N1PO./< ;/9 N1PO* l./< N1XO.Nv`.$| Cr2( ./.N1XOЃ$x`p. N1H"| $R eN1,POJn.N1BN^NuNqNVH $| # &| 'N/J9 "f$| Cx`,p. N1H"|  1"g ./< .`R eR y r2( dP`NVH y r2( p jDD`, y r2( ./.N1XO$B r //9 N1PO y r2( p ./< ;/9 N1,PO* y r2( p ᩺gv`r2( ./.N1XOЃ$B r //9 N1PO./< C/9 N1,PO* lH./. y rfH. N1*HHrrgrgrf. `. N1`. `*g. `*HH./< /N1XO*f . `N1t`Jg CJg.HRNXO.*g C 1` C01///< {N1O "ЁCJ1g$ "ЁCA./< N1XO` . N1RpmVt`& Ѐ"ЀЁCZJqg rb@0; NJ JRZ. `. N1 Ѐ"ЀЁCZ01r2. Ѐ"ЀЁCZ/1`b. `. `. N1 Ѐ"ЀЁCZJfB Ѐ"ЀЁCZ01r22(/ N1XO//< NN1O ./< oN1XO.NR y r2( SePLN^NuNVH BB/9 N1POJg. /< N TXON &./< # /9 N1,PO$ m( y  UQVQf./< # NXOrgB9 "pL N^Nu "p`NV9 g 9 R ./< N1XO y Bh y Bh y Bh y B./< # NXORD"y #@BB/9 N1POJl. /< N TXON &./< # /9 N1POJl. /<  N TXON &N^NuNV. ' N1 Jg9 g . .*g *` 0*//9 N1PO`8 Ѐ"ЀЁCZ01r2. Ѐ"ЀЁCZ/1/9 N1PORpmNJgPKt`JSfJkg9 gh0*HS.p0+2*H/N1XO/0+H2*H/N1XO/0+H2*H/N1XO/?Bg/< N1OPKRpmx` . `r  'S./9 N1XO`>NVH$| # N/J9 "f . /< ^/<0N1PON &. HxG/9 N1POJg. /< N TXON &. N1 y 0(HJ@g @g @f. `. `. N1 y A./< \N1N0. 'LN1 Jg9 g . N1NN^NuNVB/< ' N1XO-@l. ' /< N TXON &p.Hn/.N1,POJn. 4/<0N1XON & nPoR n lJp.p//.N1POJmp.Hn/.N1,POJn. 4/<0N1XON & nm n o . ' /< /<0N1PON &p.Hn/.N1,POJn. 4/<0N1XON & g ./< /<0N1PON &p.px//.N1POJl. 4/<0N1XON &B y  (Zr //9 N1POJl . /< (/<0N1PON & .N1XO y r2(./< N1XO y r2( ./< N1XO y r2( ./< N1XO y (HH./< N1XO y hf,(g. ` y (f$. N1` y (g. `. N1Jjdgp0*d./< N1XOJj^g . +N1Jjjgp0*j./< GN1XOJjpgp0*p./< QN1XOJjvgp0*v./< bN1XO. oN1NJgb-| 'Pp-@`D nJPfJhg> n"y 0"H2)HABAHAЁ./< rN1XOPRpn. vN1B`Jg .CJg*   g2 .C 1`6. N1. N1LN^Nu .C01./< yN1XO ."ЁCJ1g$ ."ЁCA./< |N1XO. N1Rpoh`6NVB` n./< N1XOB`* .Ю"n1@H./< N1XORpnB`N .Ю"n1HH-@pd d./< N1XO` . N1Rpn. N1pѮ . m8N^NuNq tests #  %d:Bad Block Table: Multiple use of alternate %d. iv: bootable program to large for area specified. ** Phase %d - Initializing Internal VHB. iv: disk must be formatted for surface test. iv: Invalid VHB, disk must be formatted. iv: doing ioctl GDGETA on %siv: start track for partition %d is past the end of the disk iv: section one of description file must be fully specified on format. iv: section one of description file may not be partially specified. HDSYHD2FDiv: unknown d iv: cannot stat %siv: %s is not slice 0 of a raw device iv: opening special file %sriv: opening description file %siv: cannot reformat Winchester disk. iv: cannot set % disk description. iv: cannot do a write test on hard disk. iv: cannot set % disk description. iv: dismounting %siv: reopening %s** Phase %d - Allocating download areas. iv: dismisk type in description file: %s iv: cylinder count out of range in description file: %d. iv: number of heads out of range in description file: %d iv: number of sectors per track must be greater than 0. iv: step rate out of bounds in description file: %d. iv: single density switch valid only on floppy disks. iv: mixed density switch valid only on floppy disks. iv: cannot combine mixed density and single density switches. iv: HiTech switch not valid on Floppy disks. iv: disks with odd sectors/track ounting %siv: character special file needed. iv: description file needed. word too long %s iv: Bad number conversion: %s $iv: Bad selector (%s) in input file iv: Repeated selector (%s) in input file. iv: error allocating new memory typenamecylindersheadssectorsstepratesingledensitymixeddensityhitechexchangeableprecomploaderbadblocktabledumpdownloadareaprogramsector$iv: excess at end of line in bad block table description: %s iv: too many bad block entries in description file. $must have bad block table specification. emptyiv: excess at end of line in bad block area description: %s iv: no bad block table specification allowed on disk with even sector/track. iv: doing stat on loader file name = %s:iv: area reserved for loader not large enough for file specified. iv: doing stat on bootable program name = %s:iv: reserved area specified larger than partition 0.  F z The Bad Block Table contains %d entries. %s:Bad Block Table Overflow when adding Sector %d. %s:Civ: automount pathname (%s) too long. iv: Excess at end of line in partition description. %s iv: Partition 0 must begin at block 0. iv: Partitions must be in increasing sequence. iv: Too many partition table entries. iv: Too many down load file entries. $iv: Down-load files not supported in this version. %s Device Type: %s Name: %s %s (hitech)Cylinders: %s Heads: %s Sectors: %s %d Partitions, %d Blocks for Loader, Bad Block Table Allocated, %d Block Dump Area, %d Block Download Areaan't Write the new Bad Block Table:Response = %x Added Bad Block: Cylinder %d, Track %d, Sector %d. Used Cylinder %d, Track %d, Sector %d as the Alternate. iv: warning bad block entry #%d out of range, sector %d. adding bad block %d from Spare Blocks. ** Phase %d - Writing out new BBT. iviv: reopening special file after writing BBT on %siv: bad block %d on device with no bad block table. iv: cannot use disk, cylinder 0 contains a bad block. BBT: incorrectly sorted for cylinder %d Cylinder %d Trac. usage: iv -key specialfile [args...] key is one of [iustd] optionally followed by [vmw] i initializes the volume given by specialfile requires a description file u updates volume home block of specialfile requires a description file s surface scan the specialfile t tell how the volume home block of specialfile is defined d print in description file format the volume home block v verbose mode m do multiple passes on surface tests w add write pass to surfacek %d Sector %d: Data lost due to alternate sector loss. BBT: cylinder %d not chained correctly iv: -b requires bad block args ** Phase %d - Updating BBT. iv: reading VHB of %sInvalid VHB Description. iv: doing ioctl GDGETA on %sBad Block handling not supported iv: specify slice as slice:blockiv: specify block as slice:block Adding user specified bad block %d mmmm   H R cHard DiskSecond hard diskFloppy Disk** Phase %d - F   ormatting %s. iviv** Phase %d - Performing Surface Check. adding bad block %d in format on write failure adding bad block on second write %d adding bad block on read %d adding bad block on compare %d bad block: cyl=%d trk=%d sec=%d adding bad block on read only test %d iv: seeking to volume home block on %s** Phase %d - Writing out new VHB. iv: seeking to volume home block on %siv: writing to volume home block on %s 8iv: unexpected EOF on loader file. Writing out new Loader. Loading Bootable Program Area. iv: opening loader file name = %siv: loader specified (%s) is not an executable file. iv: loader text must start at %xiv: %siv: writing loader to raw device %siv: doing block_align on %siv: opening bootable program, name = %siv: writing bootable program to raw device %s  starts at Block %d (size=%d Blocks). iv: reading VHB of %sInvalid VHB Description. iv: doing ioctl GDGETA on %sWinchester Second winchester Floppy Unknown (%d) disk Vol/< nbr?grXg rag4rbg:rdf ` `|#0& `n `b `Vrog"rqg:rsg rug$rvf2 `,-y0&8`" ` ` `N. /.1 H0 ~10>101|10101V01.filegfpainitrel.c.text.data .bss .file(gfpatrap.m4.texth3.data .bss _is_D_is_XD_is_P< /.N1PO&pf"9 g NBN1xp= fNj 90""n -q4J8f*.4Hn9 gHnNXOJm.N9 f .4N1p.N1xL N^NuNV. i/<0N1XO. /<0N1XO. /<0N1XO. /<0N1XO. 8/<A.HjHj HjHj HjHjHR/< HnN1O$$pmpf5|Jgp./.HRN1POJf<`(* g 0* nf&* g 0*nf.N1F J L N^NuNVH $nv.N,rgL9 g6. /<0N1XO` 9 g./< 2/<0N1POpL N^Nut`\Hn/HRNtO rf .fp./< MHnN1POJf&.J.gRHn/HRNtO RmJgp.p /N1XOgp`rp`lNV\H$n&n .N| @ g*9 g./< S/<0N1POp.N1x jPg0 jQg( jRg0N1XO. d/<0N1XO. /<0N1XOp.N1xN^NuNVH $nv.N,rgL9 g6. /<0N1XO` 9 g./< /<0N1POpL N^Nut`pHn/HRNtO rf .f2Jnf,Jg&pgpf Rr` Vr&֮J.gRHn/HRNtO Rm Vr `nNVH $n. /. N1RXO&@ f.9 g. /< /<0N1POpL N^Nu. )HSN1XO./*/< 3HSN1O . \HSN1XO. _HSN1XO. kHSN1XO. xHSN1XO. HSN1X p0*./< i/<0N1PON*g(9 g. w/<0N1XOp.N1x.N$l p.N1xHnp/HRNO rg.9 g.0/< /<0N1POp.N1xԮHnp/HRNO rg.9 g.0/< /<0N1POp.N1xԮHnp/HRNO rg.9 g.0/< /<0N1POp.N1xԮ-Bx=|=|=|Jkg=|+ g=k + g=kHnxp/p/N1O Jg 9 g . N1p.N1xp .HS/< N1PO3 9 g2p0..0n/0n//< O. HSN1XOp0*./< HSN1PO.N1Fp`JNVXH $n Bn`Bn^ nB n Bt`n0*HgNA. "ЁCAHPN1XO "| . "ЁCAHPN1XO` "ЁCB1Rp mJjg|t`n0*HgNA. "ЁCbAHPN1XO "| d. "ЁCbAHPN1XO` "ЁCbB1Rpm.N,rgL9 g6. /<0N1XO` 9 g./< &/<0N1POpL N^Nut`Hn//NtO rf .f ng* ng"J.gPRHn//.N/.|/.x/< N1OBHSN8XO(@ gHn T( HH/N1PO-nHnp/HTNO &gHn R( HH/N1PO .mHn/< >N1tPOJm .mxx.N,Jf>`f.N-@tHnb/HTNtO JgB. GHnbN1XOJfxJg .j29 Hf .|f .N(`.N(. OHnN1XO.HnN1XOHnHnxNPOJgHnxNXOp.N1x.HSHn/< VHnN1OHnN1bXOJgp`p&g<9 g.0//< q/<0N1O HnxN"XOp.N1x. N |  LN^NtO `6Hn/.NdPO&@v` "ЁCJ1g "|  12.Hf.N1 .HS "ЁCAHPN1POJfp稁n` r b@0; NJ ".8J\blv# L`h# H`\# D`P# @# 0`># <# ,`, n`# 8`# 4` n `# TRp mJjgv` "ЁCbJ1g "| h 12.Hfp.Hn "ЁCbAHPN1POJfp稁n^ rbn@0; NJ$.8BLV# X`D# \`:# ``0# d`&# h`#uNVH$n&n jPg9 gp0*./< `N.NnJg*9 g. /<0N1XOpLN^NuBN1$-@ n=h xt`Hn/HRNO rg9 g.0//< `Jgخ.N1$(@f,9 g .//< /<0N1O `pg.HRN8XOrg.9 g.0//< /<0N1O `.p//.HTN1dO rg49 gz./< /<0N1PO``v`BRmRpo-DHnHnHnHnHnHSHRNjOJg$9 g. */<0N1XOp`jHnH l`# p`# tRpm J.gRHn//.NtO R nmn0.`jg9 gF0j.0@//< @`$0.^jg09 g 0j.0@//< q/<0N1O p`Jjg n X` nB nB nB* g n <* g n ,p`NVH$n.p/p/N1PO$l$9 g.0/< /<0N1PO LN^NuNVH $| x. /9 N1RXO&@ f.9 g. /< /<0N1POp.N1x.pd/HnN1PO @ g. .$f,`$9 gHn/< /<0N1O ` .*g . gxp/N1O JgN9 g . DN1p`2NVH $nB/9 N1XO$mȗ`&J9 gp .HR/< N1POJf&|  fp ./< /N1,POr g.N1B f`p9 gd. PN1`T=y Hnp/p/N1O Jf* g 0.jf * g 0.j f K L N^Nu`NVHB/9 N1XO$l9 g . N1LN^Nu=nHnp/p/N1O Jg49 g8p0../< _/<0N1PO. kN1`HnHnN2POp .Hn/N1,POr f J.f`.N1B`hNVH$n J   9 f. zN1 ./0j /0j /0j/?*Bg/./< N1O*g | ` | .*g | HP/< N1POLN^Nu | `NVH $n.Hx/9 N1PO&m&t`J.g&Rp .Hn/N1,POr g` L N^Nup .HRHnN1PO|=j B "ЀЁ//N1POp .Hn/N1PO.N1B`NVH $np./9 N1XO&mTt`ZJ.gPp .HRHnN1POJf:B.B "ЀЁ//N1POp .Hn/N1PO`&L N^NuRp .Hn/N1,POr g.N1B`NV.N tJg n hefB (r in <%s> Driver <%s> not loaded UNBIND failedUNALLOC failedCannot open %s Driver <%s> n^p./< HnN1POJfB ./f:Hn/< HnN1O rf n ".R!A` n rD!A` n 1n n B n B n /(/N1POJfD n .p/p/HhN1dO rf" n N^NuB n /(/N1POJg n .N1F. N `NqNVHn?.Bg/.NO rf*Jg$B n (Ю//N1POJfpN^Nup`NVH.N trfJng|0."ni bl Ir2($Bp0.S"Ё"H")҂Ҁ//N1POJf. n.p/p(//.N1dO rf LN^Nup`NqNV.N trot allocated DRVSTAT errorCannot open %s Usage:lddrv [-m master][-adubsqv] [devname] lddrv -a[v] [-m master][-o dfile] devname - allocate & bind lddrv -d[v] [-m master] devname - un-bind & de-allocate lddrv -b[v] [-m master] devname - bind lddrv -u[v] [-m master] devname - un-bind lddrv -q[v] [-m master] devname - get stats of a particular driver lddrv -s[v] [-m master] print stats on all loaded drivers cmpb:ldtbseek failed cmpb:ldtbread failed:%d w+cannot open <%s> MEMORY { user_mem f0 nJg&B ("nЩ/ I/N1POJfpN^Nup`NVH.N trfvJ mn . "nn^Ѐ"Ё$B n ("HЩЂ/ I/N1POJf. n.p/p//.N1dO rf LN^Nup`NV.N trfB n.N1"n-@m$p. .N1Jfp. .N1N^Nup`NqNVH $n&n .N trg`4B/./N1PO` JfF 9  f 9 gJ g . N1H *Ѐ"ЁЪ-@.N1-@B *Ю//N1POJf~.p/p//< N1dO rf\. N1B @#: origin = %#x , length = %#x } SECTIONS { .text : {} .data : {} .bss : {} } DFLT_ID = %d; ioctlwritereadcloseopenpwrinitprintstrategyreleaseinfoopenclosereadwriteioctlinoutmdmintsetsw:ldtbseek failed setsw:ldtbread failed:%d Didn't find all entry points:found:%x needed:%x Didn't find all entry points for linesw: found %x needed %x could not de-allocate:%d rOpen error for file -- %s %8s%ho%ho%ho%4s%hd%hd%hd%s Device parameter count chksig:ldtbseek failed chksig:ldtb gD. 9 Y/p/HhN1dO "9 YfB/./N1POJf 9 S"y J1f# #  9 n L N^Nu y ./< N1XO @`p.HS/< N1POB9  | `NVJg^ y $f #" $`&-y $`6 n h"f n"n!i"".N1HpN^Nu n-h"Jfp`NV-y $` nfpN^Nu n-h"Jfp`NqNVp&.p/N1TXO @-Hf N^Nu nB"J $f # $`(-y $` n-h" nJ"f n!n"R ( n!y ( n`read failed:%d USIGN%s already allocated Bad magic:%o Driver must be relocatable ldshread failed:bss err:%d ldshread failed:text err:%d ldshread failed:data err:%d DRVALLOC failedallocated: %#x bytes starting at %#x for device %s, B:%d C:%d id:%d unix.symDFLT_IDifile.ld -N %s -o %s %s unix.symld failed:%x errno:%d Bad magic:%o unix.sym and currently running Unix signatures do not match ldshread failed:%d err:%d no mem for %d:%x ldsseek failed:%d err:%d bad read of %d cannot set devsw en   tries BIND failedDRVSTAT faileddrvid: %d: DRVSTAT failed DEVNAME ID BLK CHAR LINE SIZE ADDR FLAGS %8.8s%4d%5d%5d%5d%#8x%#10x %s%s ALLOC BOUND @(#) uts:uts.sl 1.221 ` %ldr! ` %ld0707070000020301001006440000020000020000031663450000017757000002100000044304etc/lddrv/lipc.oR > %L .text%L- .data ,=@.bss  #L N^NuNVH 9 S g . N$9 B`ѹpn# f. .NBy . /< Np/p09 //<NOt |#$H` A $E R mSLN^NuNVH< $y&.N @-Hg$./.NXOJfJlL< N^Nu-H*H n&hJ fB*K`BJ o * f**K-L`* +"* Dn g -o*K-L(K&S f g6 *2-Hl*f `r$*`4-Hp. X//*NPOJf `@# n2-h n"y1i n!y&p.HU/./.NO p./*HmNPOJfr nr2( H@Hg&$p.HUBBNLO `Jg. jHh0- H"9й/NPOJg`*g #`L n. nHhNXOJg ` n(g nr2( H@Hg$`NVH$yp.Hn/*NPOJgLN^Nu(.Nn&@ g.HSNXOJf$*m npo `+g H@Hr2+ g $`p0+Ђr2+c*f|.HS`NVH$n4.Jyg409RgjgJ09jgjgJp0r2*g pLN^Nu p`NVH $nJf$t` .E Rl*f`t`v*g^ * Jf.*fZ./<NXOJg`*Jgt й S"9./<NXO6fL*g  `9g `./<`p k(y#B)n 9@JgSC0H`p9@ Jgp.0H"9й/ jHhNPOJg ` H@Hr2+ g$$ kp.HTBBNtO ` Rk y7h'y"Jf 'L L'H` k 'L+gkA.NB`NVH$ypdSLN^NuR#X0*H"| fX . @H f L N^Nu . @Hr2*Fg  ` nB` f&J .E Rm.f ` f `$KR nr 0.@@5@%n 0945@095@5@ J`HNVH$.  l2 @."|E*g H@Hr2* g LN^Nu J`NVH $ypfp..Hn/*NPOJfT.Nb&@ gPB *JgLrghrf.HSNXOJfp../*HSNPOJgL N^Nu09SgkgNJf`09 qN`NVH<|4. (. 6.JBg0H n0H"9 Dl "`r 9rp.N"|(q f4(y g8#B 9rp.N"|#Ez,`|`HpL<|N^Nu0,Hl* *m f0*ClPJR` *f0*CgJfh0,H m `Jlf (#0,RlHCG` A Y KQKb%D5C0D@4`R0H n0H"9 Dl"R`*JRf\Sl0,HCG` A Y JPJeJlf, yf#`*y` Uf*`*U fBp`NVHSgkg NJg0.kc NJg67n0+@2.AA7@7n'y*`v`jp./+BHSNFO JfBkRk +g A.N+g.NBkS`NVH$n(n &n$.g. f%S`(Jf%LSj*gj.NgVJkg00+ HR.0+Hй S"9//<NPO&Jf .N#LN^NuNVH $yHnp.//9 /</*/NfO&@ gZJg0'H'HBk7y p7@ 7@'@&'@"'y* r..Nr2+ HABA$.  l8 @HЀ"逐"|E*g H@Hr2* g LN^Nu J`NVH$y.N|&@ g4B *r b@0; NJ $^zLN^Nu09Sgkg NJgp0+.B/N NPO4+(k`6p9@8JlgA.NBlJlgA.NBlPL0SBJ@f +R.p0+//<NPORk BkS`L09Sgkg NJg0p.Hn/* NPOJfT67n0.@@7@'y`.HSNXOJfp./* HSNPOJg   `.HSNXOJf *r2+d| *"k01`v.HSNXOJfj *r2+dD *"k01H#`@.HSNXOJf* *r2+d *"k01r2#`N ^Jg.N0&@ f`t `h.HSNXOJf(kt`0RBHЀ"|A"LPL0kep0+Ѐ./* /<NPOJg `.HSNXOJf\ *r2+d6 *"k01`2.HSNXOJf& *r2+e ` * b *"kI8gJlg(BlA.N`JlgBlA.N0*T*gp0./0*HD/NPO]J SJfL N^NuNVH` f#B&y` $B&R`$K&S gIt`PLRB` LN^Nukl` .mT .n0.lb0.le66`"0H(0HSCAC RCkmSk`Jkft`TNVBy dJy fgBy f. dNN^NuNVHt`3 ftp./< dNXOJy df3 d LN^NuNVH<$y./NXO&@ gl.HSNXOJfV* f.HSNXOJf: 9p "|It` JlgRPL m` L<N^Nu y9h./*/N"PO`NJg .N&@ g.HSNXOJgN`lp0+Ѐ./</* NPOJfNtkd*0RBHЀ"|01r2 c"`p0+.B/NPOt(kkd0RBHЀ"|8gJlg(BlA.N`JlgBlA.N LPL"y1i`NVH< 9rp.N"|$q gJjg4*`SL< N^Nu0SBJ@g0HC.Nv(@ g0HC01H"lK0HC01Hr2Ҁ&m n :JfJmgBmA.N0HCJqorJmg m `* g * @%H *@g ` +r & *(Hn//NzO $l D`z 9@ n( n * gp`p@ *@p0,r #Rk'y y7h.N+g*k +r $`0-@r2.NXMSlk`NVH$.  l> @*"|E*g"p0* f H@Hr2* g LN^Nu J`NVH $ypfp*.Hn/*NPOJflpfp` <./N@XO&@ gPB *JgLrgjBmA.N`VBj yf#`&y` Sf&`&S f$# 9rp.N"|B`NVH $yHnp//9 /</*/NfO&@ g$JgzJo * o`(L N^Nu./<NXO$fBkS` S"|A'H7j'yB`Jgp0+d ` r.Nr2+ HABA#``NVH. /< hp//9 /<NO# t` y"ҹ "A y#R 9 Sm yB# SLN^~rf.HSNXOJfp*./*HSNPOJgL N^Nu09Sgkg NJg'y&B Rk.Nv`09Sgkg NJg67n0.@2+AA7@'y&`z`nNVH<-y n @ff&y n r 4Ib*kb`:0-Bf.(B.Np-r*.N"|EBmB-`(M*U f fL<N^Nu.N%y"5kB`NVH yJbgn 9p "|Et`4Jjg*p*r*.N"|A.N BjBB*RPJ m yNuNVH<$y * cL<N^NuN0* HЀ"ЀЁ./</*NPOJfN.N(@ gt&|`B0+Hg <` <r2.HTNXOJf0le `r\K ReBJgVNP0* HЀ"ЀЁ./</*NPOJgN`"N.N @ f $`p-@t&|dp0"lKJko0+Hr2Ё n +gFp0./0k/NPOJg.J9f"Jg.///<NO `x0+UJmgdBmA.N`PJklp02+HDeJ+gp0./0k/BbSLN^NuNVH< n (hb gl .p "|E . p Gt`FJkg6$$YYp*r*.N"|ARP`SL<N^NuBjRPJPK m $ n"C!Ib*I` A**H(T fB`NVH$n gbSjfZ*gR *r $./*NXO *R.//<NPOBjSRj LN^NuNVH $yHnp*//9 /</*/NfO&@ g(Jg * m o`L N^Nu *r $ 9Ђ n'jNPOJf0+UJUf JmgBmA.N`Jg.///<NzO +fnRm.HmNXOJgV.N @ g0-Sm @bBmA`rJUgJg.///<N O +g  `ZRm.HmNXOJg.N @ g0-Sm @bBmA.N`R\K` t&|` K\Kr2 lA"y1i Re)yB`NVH$ypdSLN^NuR#X0*H"| X qN`NVH $n$. &.&n S@HЀ"ЀЁ`JCf09 @@@0<"yi@=@JCgp-@޶GlpLN^Nu6 y$hb fGmnn0HЂ2.Hn`p0*2He n"yCb `\Jg R8(`8.p*r*.N"| 1r <0*F:Jg EmV0HЂ2HlH n 0H`F0H4*4(F1X**,,G*1. : I "* ,: D: N: Z: j, p, . - 4 * * * 7 NF Z8 `* t* * + J * *  O O * * P = Q (L 2L :* @P J= RQ l2Hr҂m n 0HrЁr` $RnmZp`NqNV# NNNN^NuNV#Jg# N^Nu* O * K K $O 0O >* ~K K K O S * ** <* z* 6 8 8 VW ;+&*66N4t7(5*(((*:(j**(YY5*(>(\*jO88*(Y4&msginit:msgssz not power of 2Can't allocate message buffer. msgmap *semmapL "shmmap" @<YJOT*Y88**P=Q+vO88KKKLL* P=Q6*DOJSV)xO*WI*+V7*S="*6O<FOLWRB\^`LjLrO|LL 6@ h *!6#,!"**.*^***2*B*N+r*~*12** 48*^(t5**6*667*P8`8j+81.:;,, ,8,2*OL^L+*O*Y4$YJ(b*Y4**YO8*B*TY~88YGbYz*G8*Y*7*,*:*@+PJV*Z*hK K8@1F2R)v172=*11 ?1..@ - A 1&1, 81@:FBRCX,n1v+*(*P*tE***7F5*FF.N-V5d*v*G***G$*H(d(p*vPfgff**(*Xip*z7*kfi6*X*r4*(5** 674*D6n7|***qi *"70*B*P*VP`fhgqif   *+PfgPf:q@iN+hftuv; c + .* <f Bi N) jf rf |* c f v I u * x!c!(7!4*!D*!N+!j*!vi!=!*!*!*!+!*!*!" +":+"bq"hi"q"nrmsemsemmap(semtlocksemtmpsemget*iseminit*semopsemu isemsys semundot# dsemtwait fshmtotshmatshmconvshminfo shm_pte-#shmem9"HclearsegshmctlLshmdtshmfreeishmexec6D"lmul__i#2f#8|#N|#`f#j#tf#zv#B#+#*#f#*$*$@*$hq$ni%$%% %%%&%*%0+%8$%<%D*       X \ ` p t x | ~  H < _ \ T w o r  { y zishmforkshmget "vmemfreeshmmpteshmmapishmsys!vmemallQ!["ishminit#,maxmemmsglock msgBUFsemU*ifunc lipcinit$g% ipcfuncshminitmsginitseminits~ipcaccessmsegshiftsemtunlocksemtmlocklookforholesetshmhpteresetshmhpteisetupshmifreeshmseglipcrel.filegipc.c.text .data .bss .filegmsg.c.text ,w.data X.bss .filegsem.c.text \.data X.bss .file gshm.c.text t.dataeaseipcdefault0707070000020301011006440000020000020000031664230000017757000002100000050420etc/lddrv/nipc.oR CF ( .text(1 .data 0E@.bss   p.bss .file(gipcdata.c.text$P .data  .bss ipcgetfuipcbusymsgfpmsgmsgconvmsgctlmsginfo msgque(msgfreercopyincopyoutsusertimewakeupmsgget&msgmaprmfreeimsginitldiv__msgrcvpanicmsgbuf printfrminitmsghhmsgsnduseracccurprisleepimsgsys hrmallocsysinfosemunpsemfupsemaoe semconv seminfo procsem_undosemctl semaisemexitsemuNVH$n4.Jyg409RgjgJ09jgjgJp0r2*g pLN^Nu p`NVH $nJf$t` .E Rl*f`t`v*g^ * fX . @H f L N^Nu . @Hr2*Fg  ` nB` f&J .E Rm.f ` f `$KR nr 0.@@5@%n 0945@095@5@ J`HNV   H 0. y S@t409 v6p0L N^NuNVH $.l"` B.N L N^Nu r..N"|E r..N"|G`.HSNXOJf*g" r2* fv J`NVH$y.NH&@ gl r..N"|IB *JgJrghrf.HSNXOJf6p../*HSNPOJg`bLN^Nu09SgkgNJf`09Sgkg NJgp..Hn/*NPOJg `0.kc NJg67n0+@2.AA7@g09 й/NPOJ9gPp0R.?BgNXO//<NPO(Jf .N#B.N`zRkk y7h'y"B)n9Bp0Jgp0`p9@ Jf 'L L'H` k 'L+gkA.NB`pNVH$ypd `#X "| qNSLN^NuNqNVBy Jy gBy . NN^NuNVHt`3 t./< NXOJy f3 LN^NuNVH<|4. (. 6.JBg0H Fn0H"9 FDl "`r 97n'y*`f`Z.BHSN^POJfBk lBk `Rk +g A.N+g.NBkSB.N`NVH$n(n &n f%S`(Jf%LSj*gj.NJkg&0+ HR.0k/NXO//<NPO&Jf .N#LN^NuNVH $yHnp.//9 /</*/NfO&@ gZJg0'H'HBk7y p7@ 7@'@&'@"'y* r..Nr2+ HABAҀ#L N^NuNVH 9 r29 g . N 9 r29 g . (Nrp.N"|(q f4(y g8#B 9rp.N"|#Ez,`|`HpL<|N^Nu0,Hl* *m f0*ClPJR` *f0*CgJfh0,H :m `Jlf (#0,RlHCG` A Y KQKb%D5C0D@4`R0H Fn0H"9 FDl"R`*JRf\Sl0,HCG` A Y JPJeJlf, yf#`*y` Uf*`*U fBp`NVH$. Ѐ"逐"|E*g" r2* g LN^Nu J`N09  9 r29  g . XN 9 S g . pN# f. NBy . /< p/p09 //<NOt |#$H` A $E R mSLN^NuNVH<$yR.NV @-HgL .r..N"|A-H./.NXOJfJl`L<N^Nu-H*H nB.N.N @-Hf $` ng,$ r..N"|A-H`h n&hJ fB*K`BJ o * f**K-L`* +"* Dn g -o*K-L(K&S f g *VH$y`./< NXOJy f.Nr&@ g8&<x *rg0rg*rgr f(&* p0+ЀЃS(`LN^Nu&* pЃ`&<x9H`.Ne0`./< NXOJy f.N&@ gB *r b@0; NJ :x2n09Sgkg NJg:p0+.B/N PO4+(k`6p9@8JlgA.NBlJlgA.NBlPL0SBJ@f +R.?+Bg/<NPO lBk `Rk BkS`09Sgkg NJg~Nrp./<2-Hl*f `-j` 0-H-@p./*HmNPOJg `JgN jA#B9p./.p09 /0- H/NPOй/NPOJ9fZ# n2-h n"y1i n!y&././.NPO`*g# nB.N` n nB.N. nHhNXOJg`NVH< $yR.N&@ gn r..N"|K.HSNXOJf4* JmB * n6p.Hn/*NPOJg`|L< N^Nupo /* NPOJfbN,67y09@@7@'y`0.HSNXOJfNp./* HSNPOJg&`.HSNXOJf *r2+dV *"k01`v.HSNXOJf *r2+d *"k01H#`z.HSNXOJfd *r2+d *"k01r2#`8.HSNXOJf"N# BB94+(k0SBJ@g p.p// NPOJ9fPL`N`.HSNXOJf *r2+d6 *"k01`X.HSNXOJf *r2+e `^B.N.N @-Hf $` ng $`p0r2+Ёr2+cd*flB.N.HSNXOJg.N @-HgP nfk.N`Jf.*g  `B.N./<`(y#JBgp0.N./<NXO6f*g  `9Rg `(Jf .N#B.N./<NXOJgv.N @-Hg6 ng r..N"|K`JBg jA#B9SCB?B`l * Bb *"kI8gJlg(BlA.N`JlgBlA.N y9h./*/NPO`.HSNXOJfN# BB9Bp0+Ѐ//<NPONJ9ftkd*0RBHЀ"|01r2 Bc"`tp0+.B/N"A y#R 9 .Sm yB# JSLN^NuNVH<$yR`./< NXOJy f.N(@ g * 6cL<N^NuN#BB9B *Ѐ"ЀЁ//<NPON$J9ft&|`>0+Hg <` <.HTNXOJf0le `p\K ReBJg\.N @ f $`BN#BB9B *Ѐ"ЀЁ//<NPONnJ9fp-@t&|dJp0"lKN^Nu.N%y"5kB`NVH yJbgn 9p \"|Et`4Jjg*p*r*.N"|A.N BjBB*RPJ Zm yBbSLN^NuNVH< n (hb gl .p \"|E . p \Gt`FJkg6$$YYp*r*.N"|ARP`SL<N^NuBjRPJPK Zm $ n"C!Ib*I` A**H(T fB`NVH$n gbSjfZ*gR *r $./*NXO *R.//<NPOBjSJko0+Hr2Ё Bn +gFp0./0k/NzPOJg.J9f"Jg.///<NlO `p0+UJmgBmA.NJmgJUfBmA.N`Jklp02+HDeJ+gp0./0k/NPOJfl0+UJmgDJUf>BmA.N`*Jg.///<NO +fRm.HmNXOJg4`./< NXOJy f.N6 @ g0-Sm @bBmA`JUgJg.///<N$O +g  `Rm.HmNXOJg`./< NXOJy f.Rj LN^NuNVH $yHnp*//9 V/</*/NfO&@ g(Jg * Rm No`L N^Nu *r $ 9Ђ bn'j./<NXO=@J@gr0.HS"|A'HB/9//+NO kչBkp'@"'@'y&Bk y7h`2 BkS`0Jg +l ` r*.Nr2+ HABA#`NVH$ypdSLN^Nu#X0*H"| qN`NVH n$hb`.NH$R fSLN @ g0-Sm @bBmA.N`R\K`t&|` K\Kr2 lA"y1i Re)yB`\NVH$ypd `#X0*H"| qNSLN^NuNVH $n$. &.&n S@HЀ"ЀЁ`JCf09 `@@@0<"yi@=@JCgp-@޶GlpLN^Nu6 y$hb fGmt`TNVH<$y./NXO&@ gl.HSNXOJfV* f.HSNXOJf: 9p \"|It` JlgRPL Zm` L<N^Nu Zm `* g * @%H *@g ` +r & *(Hn//NzO $l D`z 9@ n( n * gp`p@ *@p0,r #Rk'y y7h.N+g*k +r $`0-@r2.NXMSlk`NVH$.  Vl> @*"|E*g"p0nn0HЂ2.Hn`p0*2He n"yCb `\Jg R8(`8.p*r*.N"| 1r <0*F:Jg EmV0HЂ2HlH n 0H`F0H2Hr҂m n 0HrЁr` $RnmZp`NqNV# fNNNN^NuNV#Jg# fN^Nu    0 6 B $; 4. V8 `9 f: . . 4 1 N . B C 0 0 0 6 0 6 . @ nO z6 . . . . .  /     6   "; * 4 fV rV . . W 9 X S hTmsginit:msgssz >= 65536msginit:msgmni >= 65536msginit:msgseg >= 65536msginit:msgmax >= 65536msginit:msgssz not power of 2Can't allocate message buffer. msgmapvseminit:semmni >= SEMMNI_MAXsemmap!#shmmap" @ 6@ Pv%!"J&%h%S . W 9 X .FVP.`RfRVV.RRRVZ|..;..:\L.Z`;h~..>66,^>_DCd/n.~>`?```@,= .,V,.,....^...2.B.N/r.~.446.7 89":6;t.89:.,=.> .0>H?V.j>@.66/6X6|BC00060.48.,...N .>,t,.V66.,(...4.F`LNX.r`V.`66..W"9*XJP;XV66RR"R:S@SF.LWV9^Xh/.VZ-4@&809B.\4d4n tFz44 F444 F44 FG1 H44 4BI"J(0>4F/`.fL~89:,.6. .89$:.-V._Q./^$@F.RZ\9n.VFVV_IdSSVSSVSdS /&.,L:@;H`Vj....`N.`,.&.6.<.=...4M&1.N6.@.V.f@pO.66;..L 8 9 $: 6, R4 f? t. . 6 . . 6 ; . B6 L0 ^. l6 x0 0 0 B Q . B B B 0 0 0 6 B.X`^Nj.|`V..`6666`;;8`P.h;~;6.`.@ . ...6.:.HT/RR.,,.Wjk j4j>.j..m.!   @.Bonjm..? ". H, ^= l. |. > @ . > @ .!.!&.!d7!jm!.!@!.!.!.!W!j!k"7" m"*j"2."</"hW"rj"zk"W"j"7"m"/"j#^w#jx#xy#~C#g#/#rmfreeimsginitPmsgrcvTpanicmsgbuf printfrminitmsghhmsgsndsysinfoulmuliomovecurpriimsgsys rmallocsemunpsemfupsemaoe Dsemconv6seminfo "procsem_undosemctlsemaisemexitfubytesemunrmsem.#j#m#-#j#j#.$ g$(j$:y$@Q$\x$r.$~{$g$@$.$.$/$.$m%9%.%&.%4.%:/%J.%N.%\ %/%/%7%m&h7&nm&j&&&j& &j&y'I' /'*.'Dj'X.'.'.'7'm((semmap(semtmpsemgetviseminitvsemopsemu JisemsyssemundobshmtotshmatshmconvVshminfo Nshm_pte#'shmem/%clearsegshmctlshmdt!shmfree#$ishmexec!:&Nishmfork"Jshmget#vmemfreeshmmpteshmmapishmsys%vmema(((((((/((((.               J fP jD ne rb v[ zz ~s u ~ | }.filegipc.c.text .data .bss .filegmsg5_3.cllG%hQ%ishminit&maxmemmsgBUFsemU*ifunc flipcinit(|](ipcfuncshminitmsginitseminititsemtmlocksemtunlockipcaccesslookforholesetshmhpteresetshmhpteisetupshmifreeshmseglipcreleaseipcdefault0707070000020300761007550000020000020000031662710000017757000002200000010370etc/lddrv/mkifileR S  .text D.data .bss .filegsem5_3.c.text .data 4.bss  semtwait  semtlock .file$gshm.c.text t.data .bss .file,gipcdata.c .text .data @.bss  .lib  .text(|P .data  .bss ipcgetfuipcbusymsgfpmsgbtoqmsgconvmsginfo msgctlhwakeuplmul__msgque(ldiv__msglock sleepmsgfreecopyoutsusercopyintimemsggetmsgmap/< N1X OQ./HJf/H#!   0N ` %ld0707070000020301031006440000020000020000031665630000017757000002300000051060etc/lddrv/unix.symUSIGN = 0x62c54; fault = 0xc0a; CDT = 0x1d374; tickint = 0xcae; perint = 0xcd2; Int8274A = 0xfe0; start = 0x974; vectors = 0x0; aldiv = 0x400; ulmul = 0xe5c; almul = 0x484; alrem = 0x4cc; auldiv = 0x54a; au./f:Hn/< HnN1O rf n ".R!A` n rD!A` n 1n n B n B n /(/N1POJfD n .p/p/HhN1dO rf" n N^NuB n /(/N1POJg n .N1F. N`NqNV.Nrf0 nJg&B ("nЩ/ I/N1POJfpN^Nup`NVH.NrfvJ mn . "nn^Ѐ"Ё$B n ("HЩЂ/ I/N1POJf. n.p/p//.N1dO rf LN^Nup`NVH $n&n .Nrg`4B/./N1PO` JfF 9 lmul = 0x5ba; aulrem = 0x5ee; bcopy = 0x65a; save = 0x6dc; resume = 0x6aa; setjmp = 0x6dc; longjmp = 0x6ec; pdelay = 0x70a; ldelay = 0x720; sdelay = 0x73a; ldiv = 0x766; ldiv__ = 0x746; lmul = 0x7f8; lmul__ = 0x7da; lrem = 0x85a; lrem__ = 0x83c; min = 0x8c8; max = 0x8da; imin = 0x8ec; imax = 0x8fe; mclear = 0x910; mcount = 0x958; cntbase = 0x204ac; top1 = 0x1d480; base2 = 0x1d484; top2 = 0x1d488; fhole = 0x1d474; fholesz = 0x1d47c; upg = 0x204ae; lbolt = 0x1d3f8; time = 0x1d3fc; main = 0x174c; vidinit = 0x1f 9 谪gJ g . N1H *Ѐ"ЁЪ-@.N1-@B *Ю//N1POJf~.p/p//< N1dO rf\. N1B @# gD. 9 Y/p/HhN1dO "9 YfB/./N1POJf 9 S"y J1f# # 9 n L N^Nu y ./< N1XO @`p.HS/< N1POB9  | `NVJg^ y f #" `&-y `6 n h"f n"n!i"".N1HpN^Nu n-h"Jfp`NV-y ` nfpN^Nu n-h"Jfp`NqN47ca; dbmain = 0x16c4; init_mac = 0x8342; init_mach = 0x8342; returnfr = 0xc00; returnfromint = 0xc00; trap = 0x1ff2; runrun = 0x204b0; qrunflag = 0x204b4; queuefla = 0x204b5; queueflag = 0x204b5; si_sched = 0x1d4fa; idleflag = 0x204b8; clock = 0x5d58; Drv_Int = 0x1da36; Stray_fm = 0x1e4d4; Stray_fmt = 0x1e4d4; eprintf = 0x14156; common = 0xd36; splhi = 0xd4c; spl7 = 0xd44; spl6 = 0xd4c; spl5 = 0xd58; spl4 = 0xd64; spl3 = 0xd70; spl2 = 0xd7c; spl1 = 0xd88; spl0 = 0xd94; splx = 0xd9c; eret = 0xf44; baduio = Vp&.p/N1TXO @-Hf N^Nu nB"J f # `(-y ` n-h" nJ"f n!n"R n!y  n`0xdb2; ffault = 0x1dfbc; uldiv = 0xdf0; uldiv__ = 0xdde; ulrem = 0xe9c; ulrem__ = 0xe8c; beginuio = 0xf00; enduio = 0xfba; fuword = 0xf00; fubyte = 0xf0a; suword = 0xf16; suiword = 0xf26; subyte = 0xf34; useracc = 0xf48; serrint = 0x15354; sertint = 0x159c0; serxint = 0x154fe; inptr = 0x1d90e; outptr = 0x1d912; serbufcn = 0x1d91a; serbufcnt = 0x1d91a; serinpro = 0x1d922; serinprogress = 0x1d922; serinxof = 0x1d926; serinxoff = 0x1d926; sertxblk = 0x1d928; sertxblkd = 0x1d928; serixon = 0x1d92e; sercd = 0x1d"   92a; sercts = 0x1d92c; serbpend = 0x1d932; bserbuf = 0x1d934; eserbuf = 0x1d938; serbuffu = 0x1d91e; serbufful = 0x1d91e; rx8274 = 0x111a; tx8274 = 0x1330; st8274 = 0x128e; sr8274 = 0x10e0; ser_addr = 0x1d8ce; revlev = 0x1e542; nulldev = 0xbe6a; tab8274A = 0xfba; p2lpint = 0xfda; tx8274a = 0x1012; st8274a = 0x101e; rx8274a = 0x1006; sr8274a = 0x106c; tx8274b = 0x1084; st8274b = 0x109c; rx8274b = 0x1078; sr8274b = 0x1090; PortBSta = 0xfde; PortBStatus = 0xfde; serixany = 0x1d930; unloadma = 0x137e; unloadmapgfpintr = 0x1859e; gfpstart = 0x18274; gdutab = 0x246dc; gdtab = 0x24760; gdreal = 0x2478c; gd_cnt = 0x1d7e8; gdourunf = 0x1d7ec; gdourunflg = 0x1d7ec; sertty0 = 0x1d7ee; sermod0 = 0x1d80e; ser_tty = 0x1d82e; pser_tty = 0x1d8ee; serbuf = 0x247cc; nttyhog = 0x1d916; serxoff = 0x1d924; ser_port = 0x1d93c; ser_ports = 0x1d93c; ser_cnt = 0x1d944; DTMFpad = 0x1d946; phndef = 0x1d95e; moddef = 0x1d9c2; dnwdef = 0x1d9ce; mdptr = 0x1d9d4; dnptr = 0x1d9d8; teleline = 0x1d9dc; fcallpro = 0x1d9de; fcallprog = 0x1d9de; = 0x137e; ptemutl = 0x204bc; currentu = 0x1ea6c; kv_pages = 0x1da74; kv_mpte = 0x204c0; cmap = 0x206c0; usrcore = 0x206c4; chunk1 = 0x206c6; prevtxtp = 0x1d498; prevtxtptr = 0x1d498; prevsize = 0x1d48c; prevssiz = 0x1d490; prevssize = 0x1d490; loadmap = 0x151e; mutl = 0x7a000; sl_mpte = 0x206c8; sl_tbase = 0x1e74c; upage = 0x70000; u = 0x70900; tmputl1 = 0x72000; tmputl2 = 0x73000; dmamutl = 0x6e000; sdmamutl = 0x6c000; mmvad = 0x6b000; swp1utl = 0x74000; swp2utl = 0x76000; forkputl = 0x78000; cleanutl = 0 telestat = 0x1d9e0; msgstat = 0x1d9e2; ldmisc = 0x1d9e4; kbinit = 0x19bf6; khigh = 0x19900; mscoord = 0x19c52; slots = 0x24aec; Drv_tbl = 0x24b0c; Drv_max = 0x1da34; dskdrv = 0x1ef68; kbddrv = 0x1f7c4; dlpool = 0x1da4e; maxdl = 0x1da52; pxmem = 0x1da54; pxmemsiz = 0x1da58; pxmemsize = 0x1da58; fontmem = 0x1da5c; fmemsize = 0x1da60; wtxt = 0x1da64; altvmem = 0x1da68; olheap = 0x1da6c; ol_cnt = 0x1da70; kv_swap = 0x24c40; nofile = 0x1da78; nofilmax = 0x1da7c; sock_wri = 0x1da80; sock_write = 0x1da80; nodev =x7c000; pgutl = 0x7e000; forkutl = 0x78900; umutl = 0x7a900; upgutl = 0x7e900; acctbuf = 0x208c8; acctp = 0x208e8; bfreelis = 0x208ec; bfreelist = 0x208ec; pfreelis = 0x20930; pfreelist = 0x20930; swbuf = 0x20938; swpf = 0x20c68; swsize = 0x20c98; nswbuf = 0x1d49c; bswlist = 0x20cb0; bclnlist = 0x20cf4; hbuf = 0x20cf8; flckinfo = 0x1d4a0; flox = 0x20db8; swapmap = 0x22e88; nswapmap = 0x1d4b0; mount = 0x230e0; errbuf = 0x23128; err_cnt = 0x1d4b4; sysinfo = 0x23528; syswait = 0x235d0; syserr = 0x235d8; ipcdef 0xbe5a; sock_rea = 0x1da84; sock_read = 0x1da84; sock_ioc = 0x1da88; sock_ioctl = 0x1da88; sock_clo = 0x1da8c; sock_close = 0x1da8c; sock_sem = 0x1da90; sock_sema = 0x1da90; nullsys = 0x28b2; softneti = 0x1da94; softnetint = 0x1da94; netbusy = 0x1da96; net_mbsi = 0x1da98; net_mbsize = 0x1da98; net_tcpd = 0x1da9c; net_tcpdebug = 0x1da9c; vt_defcn = 0x1daa0; vt_defcnt = 0x1daa0; bdevsw = 0x1daa4; gdopen = 0x17328; gdclose = 0x1765a; gdstrate = 0x17742; gdstrategy = 0x17742; cdevsw = 0x1daf4; seropen = 0x14bcau = 0x1d4b6; ipcdefault = 0x1d4b6; ipcnosys = 0xa9fc; ipcnull = 0xa9f2; ipcfunc = 0x1d4e2; d_strope = 0x16cc; d_stropen = 0x16cc; d_strclo = 0x16e0; d_strclose = 0x16e0; panic = 0xa22c; d_strrea = 0x16f4; d_strread = 0x16f4; d_strwri = 0x1708; d_strwrite = 0x1708; d_strioc = 0x171c; d_strioctl = 0x171c; d_strsch = 0x1730; d_strsched = 0x1730; si_open = 0x1d4e6; si_close = 0x1d4ea; si_read = 0x1d4ee; si_write = 0x1d4f2; si_ioctl = 0x1d4f6; si_trace = 0x1d4fe; tulo = 0x1d502; tuhi = 0x1d512; deftuhi = 0x1d522; serclose = 0x14d5c; serread = 0x14e0e; serwrite = 0x14e52; serioctl = 0x14ec6; conopen = 0x147f8; conclose = 0x148e4; conread = 0x14898; conwrite = 0x148be; conioctl = 0x14916; syopen = 0x16154; syread = 0x16198; sywrite = 0x161d6; syioctl = 0x16214; mmread = 0x15e30; mmwrite = 0x15fb8; gdread = 0x17d62; gdwrite = 0x17dca; gdioctl = 0x16a62; errread = 0x1403c; errwrite = 0x13f64; lpopen = 0x16394; lpclose = 0x1641c; lpwrite = 0x164ac; lpioctl = 0x16880; phopen = 0x1b2cc; phclose = 0x1b574; phread = 0x1b42; v = 0x1d532; init_tbl = 0x1d57e; slotinit = 0x6f72; inoinit = 0x77ea; cinit = 0x1ddc; binit = 0x1e26; setupclo = 0xd79c; setupclock = 0xd79c; clkstart = 0x7f86; gdinit = 0x16e6e; finit = 0x7670; iinit = 0x1b30; flckinit = 0x8b9c; bswinit = 0x1d26; lpinit = 0x162ba; wvinit = 0xe1ce; initkbd = 0x15c30; prfintr = 0x1744; prfstat = 0x235e8; gdhdbbq = 0x235ec; gdsybbq = 0x23b64; gdhdbb = 0x240dc; gdsybb = 0x243dc; gddefaul = 0x1d5ba; gddefault = 0x1d5ba; gdsw = 0x1d5cc; ghdintr = 0x18d36; ghdstart = 0x18b04; bc; phwrite = 0x1b518; phioctl = 0x1b5fa; bdevcnt = 0x1dd08; cdevcnt = 0x1dd0c; rootdev = 0x1dd10; pipedev = 0x1dd12; swapdev = 0x1dd14; swdevt = 0x1dd16; swplo = 0x1dd22; nswap = 0x1dd26; linesw = 0x1dd6c; ttopen = 0x12340; ttclose = 0x123a4; ttread = 0x123e0; ttwrite = 0x124f6; ttioctl = 0x13098; ttin = 0x12698; ttout = 0x12e22; linecnt = 0x1de8c; avefree = 0x24c44; avefree3 = 0x24c48; avefree30 = 0x24c48; deficit = 0x24c4c; nscan = 0x24c50; desscan = 0x24c54; rootdir = 0x24c58; maxmem = 0x24c5c; physmem "   = 0x24c60; sbuf = 0x24c64; etcinit = 0x1de90; preinit = 0x1de94; iinitdon = 0x1de98; iinitdone = 0x1de98; printf = 0xa074; chipinit = 0x819c; mcr_save = 0x24c68; startup = 0x7ef0; proc = 0x24c6c; shminit = 0xa9d0; msginit = 0xa9a6; seminit = 0xa9b2; iget = 0x76c0; mpid = 0x24c70; newproc = 0xb7fa; pageout = 0xfd92; sleep = 0xb280; szicode = 0x1ebf8; expand = 0xd456; swpexpan = 0xc928; swpexpand = 0xc928; icode = 0x1eaa4; copyout = 0xbfd0; sched = 0xd816; dgetchar = 0x1478a; geteblk = 0x118e0; readi = 0xa320xit = 0xa9b8; shmexit = 0xa9c4; acct = 0x54d4; vrelu = 0x10eaa; multprog = 0x1e7f4; noproc = 0x24cd8; setrun = 0xb538; freeproc = 0x3580; fsig = 0xace4; vsexpand = 0xc9ae; rdwr = 0x383c; getf = 0x70a4; reclock = 0x91f8; prele = 0xa040; writei = 0xa5c0; copen = 0x3af0; maknode = 0x7cb8; falloc = 0x75fa; itrunc = 0x7b52; openi = 0x72f0; ffreelis = 0x24cdc; ffreelist = 0x24cdc; suser = 0x7580; iupdat = 0x799a; wdir = 0x7d22; vrdwr = 0x404e; stat1 = 0x4112; bread = 0x11370; ufalloc = 0x75a6; rlfcntl = 0x43b8; c; clkset = 0x8188; cfreelis = 0x24c74; cfreelist = 0x24c74; nswdev = 0x24c80; swfree = 0x16950; cfree = 0x24c84; buf = 0x24c88; buffers = 0x24c8c; brelse = 0x115f8; pbuf = 0x24c90; validadd = 0x1f3c; validaddr = 0x1f3c; sl_lsize = 0x24c94; sl_text = 0x24c98; nosys = 0x2898; showbus = 0x28ba; swkill = 0x122ea; pagein = 0xf672; vtopte = 0xe030; vmsetval = 0xf5d0; vmsetvalprot = 0xf5d0; vtohpte = 0x10940; sizeofsy = 0x1e438; sizeofsysent = 0x1e438; sysent = 0x1e234; stereint = 0x4a54; stereintr = 0x4a54; psignopyin = 0xbf98; getmdev = 0x49da; xumount = 0xc52a; update = 0x5c12; inode = 0x24ce0; binval = 0x1225e; sterenxi = 0x4a64; sterenxio = 0x4a64; xrele = 0xc57a; chdirec = 0x4e38; owner = 0x750e; compress = 0x5630; alloc = 0x567c; free = 0x57d4; getfs = 0x5b90; badblock = 0x58bc; wakeup = 0xb456; prdev = 0xa2b8; delay = 0x640e; getblk = 0x11720; clrbuf = 0x11ab4; bwrite = 0x11510; ialloc = 0x5900; ifree = 0x5b32; bflush = 0x11f46; pulse_ar = 0x1e498; pulse_ary = 0x1e498; scan_ary = 0x1e4a8; avenrun = 0x24ce4; al = 0xaa50; issig = 0xaaa8; kpflg = 0x1e618; psig = 0xabea; setrq = 0xb4dc; swtch = 0xb6a8; addupc = 0x80fe; curpri = 0x24cd0; rexit = 0x3268; fork = 0x361c; read = 0x3810; write = 0x3826; open = 0x3a9c; close = 0x3cd6; wait = 0x34cc; creat = 0x3ac8; link = 0x3dca; unlink = 0x4cee; exec = 0x29ec; chdir = 0x4e0a; gtime = 0x4a74; mknod = 0x3ee0; chmod = 0x4ec0; chown = 0x4f42; sbreak = 0x3742; stat = 0x40ce; seek = 0x3d14; getpid = 0x4c0e; smount = 0x45aa; sumount = 0x48a0; setuid = 0x4ae6; getuid = 0x4b72; clocknes = 0x1e4b8; clocknesting = 0x1e4b8; pgilast = 0x24ce8; pgolast = 0x24cec; pgirate = 0x24cf0; pgorate = 0x24cf4; timeid = 0x24cf8; timeout = 0x6268; panicstr = 0x24cfc; callout = 0x24d00; timein = 0x637c; setpri = 0xb634; dbctlb = 0x1ee18; ser_scan = 0x24d04; fserscan = 0x24d06; serscan = 0x15914; runin = 0x24d07; vmpago = 0xdea8; vmmeter = 0xddb8; untimeou = 0x631a; untimeout = 0x631a; add_hi_s = 0x644c; add_hi_scan = 0x644c; rm_hi_sc = 0x64a4; rm_hi_scan = 0x64a4; add_lo_s = 0x6502; add_lo_scan = 0stime = 0x4abc; ptrace = 0xaede; alarm = 0x5212; fstat = 0x4088; pause = 0x5240; utime = 0x528e; stty = 0x4552; gtty = 0x457e; saccess = 0x3f98; nice = 0x4c88; sync = 0x4c7a; kill = 0x5054; setpgrp = 0x4c34; dup = 0x41f2; pipe = 0x9ddc; times = 0x518a; profil = 0x51da; lock = 0x7d70; setgid = 0x4b96; getgid = 0x4bea; ssig = 0x4f90; msgsys = 0xa9a0; sysacct = 0x53f0; shmsys = 0xa9be; semsys = 0xa9ac; ioctl = 0x446c; utssys = 0xbe74; exece = 0x2a02; umask = 0x5258; chroot = 0x4e1c; fcntl = 0x4238; ulimit = 0xx6502; rm_lo_sc = 0x655a; rm_lo_scan = 0x655a; k_mpte = 0x24d08; drvalloc = 0x65b8; drvbind = 0x693e; set_int = 0x6e96; ecmap = 0x24d88; mapin = 0x7020; clearseg = 0xc05c; clr_int = 0x6f02; getslot = 0x6fbe; cleanloc = 0x9572; cleanlocks = 0x9572; closep = 0x9f4a; openp = 0x9e94; hinode = 0x24d8c; ifreelis = 0x24f8c; ifreelist = 0x24f8c; iread = 0x7832; bdwrite = 0x1159c; tloop = 0x7c06; textlock = 0x7e2a; datalock = 0x7e7c; proclock = 0x7e9e; dunlock = 0x7e8e; tunlock = 0x7e4e; nofault = 0x24f90; mcr2_sav 5352; locking = 0x95ba; locsys = 0x966c; ino_open = 0x406e; gethead = 0x2c42; vmemall = 0xe55c; vadalloc = 0xf406; getxfile = 0x2e94; setregs = 0x3190; vadfree = 0xf4c4; umapin = 0x706c; vmemfree = 0xe626; iput = 0x78e6; uchar = 0x9da2; namei = 0x99d0; access = 0x743c; shload = 0xc6c0; file = 0x24cd4; chksize = 0xd76a; shmexec = 0xa9c4; punlock = 0x7eb0; vrelvm = 0xd30e; vgetvm = 0xd27c; xalloc = 0xc178; vinifod = 0xe0fa; shlink = 0xc88e; closef = 0x70e8; exit = 0x3292; signal = 0xaa08; plock = 0xa004; seme= 0x24f94; mcr2_save = 0x24f94; fmodem = 0x1e540; freemem = 0x24f98; expect0 = 0x1e544; ptedmamu = 0x24f9c; ptedmamutl = 0x24f9c; ptesdmam = 0x24fa0; ptesdmamutl = 0x24fa0; mmpte = 0x24fa4; upte = 0x24fa8; ptetmp1 = 0x24fac; ptetmp2 = 0x24fb0; pteswp1 = 0x24fb4; pteswp2 = 0x24fb8; ptefork = 0x24fbc; pteclean = 0x24fc0; ptecleanutl = 0x24fc0; ptepgutl = 0x24fc4; text = 0x24fc8; utsname = 0x203e8; meminit = 0xedd6; sendsig = 0x7fb2; ourgcr = 0x24fcc; idle = 0x8090; init8274 = 0x866c; initphsc = 0x1d316; initp#   hscan = 0x1d316; writedia = 0x1c568; writedialer = 0x1c568; pgtocm = 0x858a; tblalloc = 0x86d6; ncmap = 0x24fd0; cmtopg = 0x85d4; validpg = 0x861a; frlock = 0x24fd4; sleeplck = 0x24fd8; sleeplcks = 0x24fd8; insflck = 0x8c5e; delflck = 0x8d18; regflck = 0x8dca; flckadj = 0x8e9e; blocked = 0x9112; convoff = 0x9466; deadflck = 0x9500; reboot = 0x98e8; rtc_read = 0x9926; gdquiet = 0x180bc; schar = 0x9d86; bmap = 0xba94; printn = 0xa12e; putchar = 0x142a0; dsabldbg = 0x1ee10; errdump = 0x140f6; breada = 0x113e6; = 0x12a3c; putc = 0x13cd6; putcb = 0x13f10; ttyflush = 0x13940; tttimeo = 0x13016; sputc = 0x13d6a; partab = 0x1ee60; ttrstrt = 0x13c1c; ttlowat = 0x1ed3c; gettty = 0x13258; ttnulq = 0x25238; ttywait = 0x138e0; ttcchar = 0x1ed7c; canonb = 0x25244; maptab = 0x1ed84; ttiocom = 0x13304; ttinit = 0x1389c; break_va = 0x25344; break_val = 0x25344; err_put = 0x1ee04; err_get = 0x1ee06; eputchar = 0x14288; dbkbuf = 0x25348; dbkput = 0x1ee0c; dbkget = 0x1ee0e; dbrunnin = 0x1ee12; dbrunning = 0x1ee12; dbuse = 0x1ee1 iomove = 0xa8e0; bawrite = 0x115ca; shmfork = 0xa9ca; setupshm = 0xa9d6; freeshms = 0xa9dc; freeshmseg = 0xa9dc; ipcbusy = 0x1e6cc; ipc = 0x24fdc; stop = 0xab72; procxmt = 0xafe8; core = 0xad1a; ipcreg = 0x1e6d0; sizeofip = 0x1e6e2; sizeofipcreg = 0x1e6e2; slpque = 0x24fec; runout = 0x250ec; runq = 0x250f0; curmappr = 0x250f4; curmapproc = 0x250f4; unsleep = 0xb402; remrq = 0xb5e8; wantin = 0x250f8; desfree = 0x1e7ec; getconte = 0x105a0; getcontext = 0x105a0; procdup = 0xd536; cpass = 0xbe0c; copyseg = 0xc4; conuse = 0x1ee16; conx = 0x1ee1a; conlines = 0x1ee1c; conscrol = 0x145be; conscroll = 0x145be; wsysfont = 0x203d8; rastop = 0x19c84; getchar = 0x14724; contty = 0x25368; cononce = 0x1ee1e; conproc = 0x1493a; conmisc = 0x14a92; conresto = 0x14adc; conrestore = 0x14adc; conout = 0x149d2; conansi = 0x14a34; consv = 0x253b8; cgettty = 0x14b02; kwakefla = 0x1f826; kwakeflag = 0x1f826; serspdtb = 0x1ee2c; serspdtbl = 0x1ee2c; fserlock = 0x253f8; csizeval = 0x1ee58; ser_work = 0x253fc; pprog853 = 0x25408; pprog00a; xfree = 0xc088; xlock = 0xc356; xunlink = 0xc65c; vsxfree = 0xcc2a; xccdec = 0xc3be; xwait = 0xc332; xlink = 0xc626; vsxalloc = 0xcb72; xunlock = 0xc390; vsswap = 0xccb8; swap = 0x11ad8; xuntext = 0xc5ba; vinitpt = 0x109de; sl_dsize = 0x250fc; updatept = 0x1067c; updatepte = 0x1067c; rmalloc = 0x111bc; rmfree = 0x11224; vschunk = 0xce84; xptohpte = 0x108a4; mwait = 0xef8a; vstodb = 0xd034; vtod = 0xd15a; pinfork = 0x1e7c8; wantfork = 0x1e7cc; wantforkutl = 0x1e7cc; pteexpan = 0x10f5a; pteexpand = 0x10f8530 = 0x25408; pexpclks = 0x2540c; pexpclksel = 0x2540c; pexpsave = 0x25410; pexpsaveisr = 0x25410; pexpunsa = 0x25414; pexpunsaveisr = 0x25414; pexpsert = 0x25418; pexpsertbl = 0x25418; vectabsa = 0x2541c; vectabsave = 0x2541c; serstatu = 0x14b14; serstatus = 0x14b14; sergetc = 0x14b5e; serproc = 0x155d8; serparam = 0x1508e; sermodem = 0x1588e; setrts = 0x15028; serwakeu = 0x15ace; serwakeup = 0x15ace; clksel = 0x15dde; sersend = 0x15bc6; serxsend = 0x15b7c; sendhup = 0x15b1e; setisrra = 0x15c64; setisrra5a; zfodprot = 0x25100; zfodproto = 0x25100; vmdup = 0xd6a6; vgetu = 0x10cd4; munlock = 0xeff2; maxslp = 0x1e7dc; saferss = 0x1e7e0; maxpgio = 0x1e7e4; minfree = 0x1e7e8; lotsfree = 0x1e7f0; nbig = 0x1e7f8; bigp = 0x25104; bplist = 0x2517c; swapout = 0xe2ea; swapin = 0xe234; uaccess = 0xdf08; ptetov = 0xdf5c; vadinit = 0xf4e8; xswapwan = 0x1e828; xswapwant = 0x1e828; xswaploc = 0x1e82c; xswaplock = 0x1e82c; memall = 0xe80c; vrelswu = 0x10e4c; map = 0x11128; vgetswu = 0x10e78; totfree = 0x25188; needumem = 0w = 0x15c64; resetisr = 0x15d42; resetisrraw = 0x15d42; sycheck = 0x16262; lp_addr = 0x1eee0; lp_dt = 0x2543c; lpdrv = 0x1eee8; lpintr = 0x166de; splp = 0x25460; lpstart = 0x162a0; lppush = 0x166f4; lpreleas = 0x1632c; lprelease = 0x1632c; lpcheck = 0x167ba; lpoutput = 0x16510; lpflush = 0x16460; lplastin = 0x25464; lplastintr = 0x25464; swstrate = 0x16920; swstrategy = 0x16920; swread = 0x16938; swwrite = 0x16940; vswapon = 0x16948; ftintexp = 0x25468; gdopflg = 0x2546c; gdmflg = 0x25474; dcr_save = 0x2547x2518c; munlink = 0xe738; distpte = 0x10c34; memfree = 0xec06; hand = 0x25190; mlock = 0xefa2; vsmap = 0xf04e; vsunmap = 0xf0ec; vsfree = 0xf1c0; gdsetmap = 0xf230; vadmap = 0x25194; rminit = 0x1116c; gethpte = 0x10994; incore = 0x116b0; cleanup = 0x102d2; resetpte = 0x10838; vusize = 0x10c8e; iowait = 0x119be; iodone = 0x11a20; physio = 0x11fec; physck = 0x121e2; baddr = 0x122b6; canon = 0x13a34; getcb = 0x13ec2; putcf = 0x13e6e; getc = 0x13c44; hfc_dev = 0x25234; tthiwat = 0x1ecfc; getcf = 0x13e22; ttxputa; dma_flag = 0x2547c; dmacnt = 0x25480; rq = 0x25484; gdtim = 0x1ef5c; gdqrdblk = 0x16988; gdrdblk = 0x169e4; gdcsum = 0x17008; gdformat = 0x16a1a; gdspec = 0x16a3e; gdreadvh = 0x17098; gdreadvhb = 0x17098; dfdesele = 0x18a58; dfdeselect = 0x18a58; gdbiurst = 0x180da; gfpchk = 0x188ba; gdnsec = 0x17036; dfselect = 0x18a3e; gfpwrite = 0x18962; gfpread = 0x189f0; gdwrprot = 0x2548c; gdldbbtb = 0x173fe; gdldbbtbl = 0x173fe; gdtimer = 0x17e2e; gdfprmvd = 0x176f4; gddoxfr = 0x17a78; dfmtron = 0x18a72; gdstart =#    0x17b60; lpdummy = 0x1ef60; gdlpintr = 0x17bf8; gdintr = 0x17c42; killdma = 0x181f8; gdendit = 0x17f28; dfmtroff = 0x18a8c; dsethead = 0x1928c; setdma = 0x18108; dfreset = 0x18aa6; dhreset = 0x192e2; chkdma = 0x18232; fpstat = 0x2548e; fponce = 0x1f114; gdfpdoxf = 0x18366; gdfpdoxfr = 0x18366; gdhddoxf = 0x19016; gdhddoxfr = 0x19016; gdhdsele = 0x18f1a; gdhdselect = 0x18f1a; dhdesele = 0x19260; dhdeselect = 0x19260; dhselect = 0x191f6; keymap = 0x1f3b0; kprefix = 0x1f7b0; klow = 0x19334; msinfo = 0x1f7cc; e = 0x1c692; enableset = 0x1c692; switchco = 0x1fa98; switchcond = 0x1fa98; setchang = 0x1bedc; setchange = 0x1bedc; prefline = 0x1fab0; SCM4W = 0x1fab2; SCM5W = 0x1fab4; setchip = 0x1d148; freemode = 0x1cbb8; freemodem = 0x1cbb8; extpulse = 0x1fa78; callprog = 0x2549c; pcall = 0x1fa7a; msgdetc = 0x1fa7e; mdcharsz = 0x1fa88; offcond = 0x1fa8c; oncond = 0x1fa92; holdcond = 0x1fa94; fpulse = 0x1faa0; beepcnt = 0x1faa2; cmsgwait = 0x1faa6; fsetpaus = 0x1faa8; fsetpause = 0x1faa8; foffhook = 0x1faaa; foffhooksckstate = 0x1f7d6; keyold = 0x1f7d8; keynew = 0x1f7f8; knumlock = 0x1f818; kcaplock = 0x1f81a; kshift = 0x1f81c; kctrl = 0x1f81e; kreptsta = 0x1f820; kreptstate = 0x1f820; kreptkbd = 0x25490; kreptcod = 0x25492; kreptcode = 0x25492; ktime = 0x25494; scrticks = 0x25498; scrsav = 0x1f822; mscan = 0x1940a; kscan = 0x1950c; killrept = 0x198cc; kupdn = 0x1961e; kxlat = 0x19744; kout = 0x19ba8; krept = 0x19868; kplunk = 0x19aa0; kwakeup = 0x19b4e; syspat = 0x1f844; patwhite = 0x1f874; patblack = 0x1f854; patgray =an = 0x1faaa; fonhooks = 0x1faac; fonhookscan = 0x1faac; fbeepaga = 0x1faae; fbeepagain = 0x1faae; pulseph = 0x254ac; beep = 0x1bc94; beepon = 0x1bcb6; beepoff = 0x1bcd4; sendsigo = 0x1bd04; sendsigonhook = 0x1bd04; offhooks = 0x1bd48; offhookscan = 0x1bd48; onhooksc = 0x1bde4; onhookscan = 0x1bde4; setstat = 0x1be68; checklin = 0x1bf6e; checkline = 0x1bf6e; checkpro = 0x1bf96; checkprog = 0x1bf96; linering = 0x1ca94; pulse = 0x1c4c4; swpulse = 0x1d336; setconne = 0x1c658; setconnect = 0x1c658; freedial = 0 0x1f894; FSrcSrc = 0x19f9a; FPatSrc = 0x19ffc; FAndSrc = 0x1a05c; FOrSrc = 0x1a0d8; FXorSrc = 0x1a154; FSrcAnd = 0x1a1d0; FPatAnd = 0x1a232; FAndAnd = 0x1a282; FOrAnd = 0x1a2fe; FXorAnd = 0x1a37a; FSrcOr = 0x1a3f6; FPatOr = 0x1a458; FAndOr = 0x1a4a8; FOrOr = 0x1a524; FXorOr = 0x1a5a0; FSrcXor = 0x1a61c; FPatXor = 0x1a66e; FAndXor = 0x1a6ae; FOrXor = 0x1a71a; FXorXor = 0x1a786; FSrcCand = 0x1a7f2; FPatCand = 0x1a848; FAndCand = 0x1a88c; FOrCand = 0x1a8fc; FXorCand = 0x1a96c; BSrcSrc = 0x1a9dc; BAndSrc = 0x1x1cbe6; freedialer = 0x1cbe6; setbaud = 0x1cf92; icallpro = 0x1c850; icallprog = 0x1c850; msgwait = 0x1c912; ring = 0x1ca36; datainco = 0x1cc24; dataincoming = 0x1cc24; voiceinc = 0x1cc66; voiceincoming = 0x1cc66; modemsca = 0x1cd9a; modemscan = 0x1cd9a; discmode = 0x1cd4a; discmodem = 0x1cd4a; chkpulse = 0x1d24c; chkscan = 0x1d284; sysfont = 0x1fab8; 0707070000020300561006440000020000020000031654230000017757000002100000136630etc/lddrv/wind.oR  g<, .textaa42; BOrSrc = 0x1aac2; BXorSrc = 0x1ab42; BSrcAnd = 0x1abc2; BAndAnd = 0x1ac28; BOrAnd = 0x1aca8; BXorAnd = 0x1ad28; BSrcOr = 0x1ada8; BAndOr = 0x1ae0e; BOrOr = 0x1ae8e; BXorOr = 0x1af0e; BSrcXor = 0x1af8e; BAndXor = 0x1afe0; BOrXor = 0x1b04c; BXorXor = 0x1b0b8; BSrcCand = 0x1b124; BAndCand = 0x1b17a; BOrCand = 0x1b1ea; BXorCand = 0x1b25a; ForwardM = 0x1fa34; ForwardMask = 0x1fa34; FFast = 0x19f06; BFast = 0x19f4e; FZerSrc = 0x19eca; getmodem = 0x1c054; modparam = 0x1d0d6; freeresr = 0x1cb80; freeresrc = 0g<tu .data lz@.bss  ,x1cb80; phinit = 0x1c022; setcharb = 0x1d038; setcharbit = 0x1d038; hangup = 0x1c290; fmsgwait = 0x1faa4; getresrc = 0x1bbde; pmsgwait = 0x1fa84; startcal = 0x1c1de; startcall = 0x1c1de; waitdial = 0x1c896; waitdialtone = 0x1c896; pulsedig = 0x1c472; pulsedigit = 0x1c472; soundDTM = 0x1c5a0; soundDTMF = 0x1c5a0; hookflas = 0x1c60c; hookflash = 0x1c60c; waitring = 0x1c818; waitringback = 0x1c818; connectm = 0x1c6ee; connectmodem = 0x1c6ee; holdline = 0x1c15c; unholdli = 0x1c0e0; unholdline = 0x1c0e0; enablesNVhH 0. @40H o`(JBg60HS..N"|E$   *(fL N^Nut$|`RBE.0H l*(f0H l|( 9"y-q n-hJy f n3" vAt"| (00gRC`0H-@RB B m0RCCtA2H 00Hr .N00RCCtAtB00SBAt#B/<NXO @-HfB*(`.N n!n n.N0H"Ё"|A-H%H .N n1|&6 n1|8 n1|;< n1|H: n? n!| . nB(B. n(BHH"| qN n"y1i@09 y4f 0R@y4t`$0B.BH逐#`././. HSNO `J$gp.Hj$NXO`HnHRN`POp`NVH $n . rbp@0; NJ ,&`j>`0*"j$Bj"j>0*>H@f(t` "Ё"|AgR m` L N^Nu l.. N"|G.N%F`>`j>j>`*?gj>>`NVH`#$ B > BfB >B$&j IJgJlf.+BHH"| qNg2Jg. f dN$.HRN:XO.N`A$.N$y B >ffLN^NuNVNJRN&POJf0HC0BRB BmJ0f%|0B9.N+%y t`x Bg Bf| o`B.o. .N"yA2QA&H0HC#0HC-qpv` npRpoRC CQmRB BmB*Bj*`gNJ9 .Hn/.NPOJf0n.HnHRN&POL N^Nup>.HPON^NuJ9fR9 9mR 4. 4N`NV### ### #$$#((#,,#<<#-#-0#%#% #.#% ##N$##(#2,#(r<# 6.N. Bp/Hx\HxBBBBpZ//9 //9 NO0N,\N`-|`. I f!|N4&NFBN^Nu 9"瀐"|A"nb`NVN^NuNV0<9 HAS@33,9 HHrЁn/.NPOJf0n.HRN* XO`.HRN)XOJg`v*(f. FHRNXOJgN".N`pT.Hn/.NPOJf,4.HplrpQ. C/1HnNPO f8N".HRNdXO`p.Hn/.NPOJf4.HplpQ.Hn C/1NPOpT`6*@=j=j0*n=@0*n=@Bp./.HnNPO`p.Hn/.NPOJf4N"BN2.@Jg.Hj/.NPOJfV*H*H n@**n6**n,*HH*HHDm*HЀ3p.B/<NPON^NuNqNVH<$n0.HC-qBn=|-y-y*(gJ0f&|`L<N^Nu j0&P0.Hrb@0; NJ 8$.=|8`=|,9 `=|D`r=|P`h*+f0@ =@p+HHJjDD`j=@0*n@=@J@oR*J f-y-y nRgfJng^@  mHHHr C I,Hnn( , n Jlg&H=@.HHgR n`PJno.Bp/p /0n/0n/0n/BBpZ//9 BBHUBNP O8`z n.H*HHDl N"`.HHr €g$5n5n0.n5@0.n5@N.N"`*(f. FHRNXOJgrp.Hn/.NPOJf.NHnHRN`@`6JmBpo:0.H"| #`Jmpo0.H"| $q f ` j 0(@H`` y7h@A@#009 n 34`$y f`$y $ g ..NR#`l``*(gp`p#Jg (`<*(`2p<. 9N#JlJm 9F#` ."Bp/p /,HH/0n/0n/BBpZ//9 BBHUBNP O8Bp/B,HH/0n/0.H+HHЁ,HHЁ/0.H,HHЁ/BBpZ//9 0HrЁЀ/AHPHUBNP O8,Hn,Hn`lNVH $n&n t +c +b +gHJg@+f+fB0+/0+"SAHPNPOJf`|BJgB+ fh+ f^p.0+ /0+ "kAHPNPOJf`.BJ+g6Jg0+fBp //+NPOJfL N^NuJgN 0* j60*j 80+Cb0+Dc$   `gd& 7|Z0+ Cdp0+ r2+Ёr2b0+Dd~p0+r2+Ёr2c`d0*k 0* kgp'y 7|Z 0+Cd4p0+r2+Ёr2b0+Ddp0+r2+Ёr2cJgN |`0*k0* k.p+/p+/?+Bg?+Bg?+Bg?+Bg?+Bg?+ Bg?+ Bg/+?+Bg/g J`HPg J`HPNP O8JgnN `fNVH $n&n Sb k b+ gBnBnBnBn`=|=|=|=|0=@knn=@0+=@knn=@JkgJkg kbEm60H2Hl$Fm 0H2Hlgp`p`0V@@EmH0H2Hl60Hr2*Ve&0Hr2*dgp`hp`bEm:0H2Hl(Fm$0H2Hlgp`*p`$0Hr~r2c=EE*SFEm:0H2Hl(Fm$0H2Hlgp`p`E*Em:0H2Hl(Fm$0H2Hlgp`p`:.RF0HrTr2*cSEFEm:0H2Hl(Fm$0H2Hlgp`0p`*FEm40H2Hl"Fm0H2Hl g p`p k,c`t. hHnN[XOJg\0.H$p0.2.HЁr2.쒂 b20.H&p0.2.HЁr2. bN RBn=n*(gJgn.NU=R=jBBBp0*2.H/p0*2.H/0n/0n/0n/0n/pZ//<B//9 NO0=j0* n=@=j 0*n=@.NV*(0+@5@*HnHRNWPOJf> fB $fB $N `pL N^Nu0.n5@0.n5@ 0.n5@ 0.n5@(.N"Jnf.NHr g.N` .Nf.NBn`0`p`NVH$n4.6.8.:.0*D80*E:Rj0B<0C>SDSE.Bp//0F/0C/0B/BBpZ//9 BBNO0.Bp/0G//0C/0B/BBpZ//9 BBNO0.Bp//0F/0E/0B/BBpZ//9 BBNO0.Bp/0G//0C/0D/BBpZ//9 BBNO0LN^NuNVH$n4.6. n(HRjBp/B n(HH/0D/0H"n)HHЁ/0H)HHЁ/BBpZ//9 0HrЁЀ/ nHh NO0LN^NuNVHN$`p./< \NXOJy \f yn.HRNXORn nmJngBBBp0*r2* /0n/NPO/p0* r2*/0n/NPO/?* Bg?*Bg0n/0n/pZ//9 //<BNO0p0* r*,.p0*z2.Hr2*Ё/NXO5@zp0*r*-.p0*|2.Hr2* Ё/NXO5@|N >J9 fg B9 fN Zp`lNVH $n&n 67j0* j7@0*j 7@*(f p7@7@j, j- j. 0*zj7@0*|j 7@7j*Jf fL N^NuNVH $n gJ g*p. y /( NXO. N. N3 \N ` bgBN2J9 ^gBN.NLN^NuNVJy \f . pNJg" 9oJ9fNJ` B gNJ9 bg p.N2J9 dg B9 dNBy \. \NN^NuNVH$n y g.zXHR/9 NPO# LN^NuNVJg.J9f& 9oR 4. 4NN^NuNV. 9 ^gV.p/p/0y/0y/0y/0y/BBpZ//9 //9 NO0 ^N^NuNVH$y g3z3|B@*,3B@*-309H29X# $# j (?gN .N0.NU.N^t` .HRNXORpmL N^NuNVH$n j 4(@ yhgp.0B/NXOLN^NuNVH $n*+f<0*R40* j6.p/p/?Bg?Bg?*Bg?BgBBpZ//9 BBHRBNP O80*j6.p/p/?Bg?Bg?*Bg?BgBBpZ//9 BBHRBNP O80*j 60*R4.p/p/?Bg?Bg?* Bg?BgBBpZ//9 BBHRBNP O80*j 4.p/p/?Bg?Bg?* Bg?* BgBBpZ//9 BBHRBNP O8L N^NuNVH$n8*HЁr2* e0y309H29HЁr2*e0y3JygJyg*xfp.NLN^NuNVHtN-@Jy \fJ9 ^g.BNt.N.B/<$NPOLN^NuN`NVH$nN$ j (>f.N.NLN^NuNVH$nJ$fDJ >g y >!J$# >%| >$ > Bf# BR 4. 4NLN^NuNV3 \3 \BN2BNN^NuNV3 \N^NuNV  B*SC. `0C/0B/HRN:O B*. 0RC0@/0B/HRNO 4g@ CTo:CSB. 0C/0B/HRNO C. 0C/0B/HRNO LN^NuNVH$n4.6.8**fp0Z@:0*V@<0* j>0*j =@Em<0H2Hl*Fm&0H2HlfpLN^Nu0.@@/NPO-@ @#.N.zX/<BNXON^NuNV.BNJ9gJ-y#p./.NXOp./.NXOp./<NXOB9N^NuNqNVH$nJmpn ` .C0Jg .C0 q-P`BJ gHn/. NxPO(@ g&|` Jko0+lf +gG 9 "|Ae.HRNXO&|` JkgDG 9 "|Ae.N`. ."|GJkf8`.HTNXOJf.NpLN^Nu7l'n.N .C0g8.HRNXO %   .C0#RkJg n~f%S~.NFp`NVH . "|EJ m . m `8Jf> jf. BNbXO` jo `pLN^NuHn/.NPO(@ g&|`8Jko.0+lf$ +f.Ngv`G 9 "|Ae jm . BNXO.HTNXOJf .N`^5l%nJjf5|.Np`:NVB`J ."nC0-qg" nJhg .ЀCA"n0` .ЀCBqRpnp./. HnNPON^NuNVH . "|EJ m0 0n/0n/N`D9.g.9@J.g(Jf.HH./././.NO `h.g.HH.HHgp`v.g<.HH9HHg$p`NNVH<. 9 `gfJ9 g^$y*Hy 4*Hy 6*H*HBnBnJBl.*H@l*HBJDo 0D@=@t`$LPOp;.p./HRN*POpM.p./HRNPO.NLN^NuNVH$nBnp . . N00.RnCp . . N-@ J fSnAHH.HRNXOJnf.HH.HRNXOLN^NuNVH t&0n.0n//.NPOSrb@0; NJ,$Lx8B 2`4<m`4<W`x 0`lv4<K`bv4<L`Xv.g4<T`F.g4<V`8.g04<9`*v.g4<S`.g4<U` .g4n,n-n.L N^NuNVH. /< /9/9/<NO$|`BjE 9 "|AeLN^NuNVH#B/<NXO$@ f `H.N`>.HRNXOJfp0* fJf.N9 LN^Nu./<HRNPOp0*rЁ.0j /NXO-@ @-hp0*rЁrѮ n "n 8.N J`NVJ g$ y ((gp. y /( NXON^NuNVJ g y h N^Nu`NVH. @ <2. HAH-@poV ."|<0JBg*N-@HH.0B/ y4NXO.NJ9 0fJ9 2g 3  3  0.R3 0.j3 By 3 `H3  3  0. -qgB n-h .HH"| $q`HH./.NXOJf.NLN^NuNVBB.HnHnHn y8NO B9 < bN-@JlB` o-|JlB` [o-|[J g y ((g y Jfr2( .e> y r2( d. y r2( .찁er2( .찁d -y ` y r2 .eBr2( .d4 y r2( .찁e r2( .찁d-y |`-y`|` n-hJg nr2 .er2( .d nr2( .찁er2( .찁d nrj j3 0.jj 3 3~ 3< y" y( . Nb 9.gf.f\. N:N"BN,. HRNXON"p  2 0.NL N^Nu0.y 40.y 6y l49 `$0H29 HЁ m0<Аy S@4y l69 `"0H29 HЁ ,m 0<,y 6J9 2g*y f y gN. NF3 3 `(y f y g$. N3 3 . N`NVH< n0t40(v6 nr2(҂p"Ҁ(r2(҃p(Ҁ*p. ///NfO p.2( .er2( .d nr2( .찁epr2( .찁d`Jg"J.f n(g nA#` #  3 3 # .9gN ,mBJ.gJ9f./.NXO.HnHn y8NPO.NN^NuJ.g4J9f, n g "f-y Jg.N` n fJ g y h0."ni=@0.i =@J.f.HHr €g0."y ie*"y id0.ie0."y idp`p@Jg.g y (p`J.f4.g, y (p..HH/ / W//NLO ].p/ V//N0O ].p/ V/ W/NO LBBp/p*-/0D/?*|Bg0B/BBpZ//9 BBHRBNP O8JEfp`FBBB+HH/0E/p0*|r*.Ё+HHЁ/0H+HHЁ/BBpZ//9 HHrЁЀ/AHPHRBNP O8p`NVH|$n4.6.8.gD:*0* E<JDl>0D@80H2H2Ho0B80D=@=B0D=@`2L|N^Nu0H2H2Ho0B8=B0D=@=B0H2H2HlPBBB0H2H2H/0F/0n/0E/0n/0E/pZ//9 //9 HRHRNP O8BBp/0D/0F/0@Hr@"jt qN`NVH$n. g*x.@H"|  qNLN^NuNVH$nB*PLN^NuNVH$n . ЀCT41HJg . *RHHm pLN^Nu `NVH$n. HRNXOSLN^NuNVH$n*QR*QH*RH@l0HЀCT01HLN^NuJBfp`p`NVH<$n*-BB6*|8*z0.D:*ygHBp/B0B/0HS/0C/0HR/0C/0D/pZ//9 //9 HRHRNP O8p*. =@J@f=|*ygJ.p/p/0n/0E/0Hr*.Ё/0D/BBpZ//9 BBHRBNPn/0E/BBpZ//9 //9 HRBNP O8`,NVH$nB*PB*yB*x5jz5j | j0%P~LN^NuNVH<$n4* BHRNXOr*,./NXO68*z0C:BlPBBBp*-/0H2H/?*|Bg0E/?*|Bg0D/pZ//9 //9 HRHRNP O8`0D6JCoBBBp/p*-/0C/?*|Bg0D/BBpZ//9 //9 HRBNP O8L.p/p/0B/0E/0C/0D/BBpZ//9 BBHRBNP O8*yg>.p/p/0B/0E/0C/0D/BBpZ//9 BBHRBNP O8LO=B4+0.Bd.AC =B././+ HnHRNO=B4+0.Bc.AC =B././+ HnHRNO=B.HSHn` .HS/. HR nNO L N^NuNVH<$np0**@H$Jg.N#&j`L(j`>*l lf0.HTN0XO.HjNuNV.Nf./<NJXON^NuNVH$n$. 0*R=@0*j=@p0=@JgBBB0n/0n/B0@`Bp/B0n/0n/B0n/?*Bg?Bg0j//*pZ//9 NO0Bp/B0n/0n/?*Bg?BgB0n/pZ//9 0j//*NO0Bp/B0n/0n/B0n/?*Bg?Bg0j//*pZ//9 NO0LN^NuNVH$n0*R=@0*j=@p0=@BBB0n/0n/?*Bg?BgB0@/pZ//9 0j//*NO0LN^NuNVH$n(n &n0,T=@0,l=@p0="XO.HkNZXOJf.N% (M f&k f.Nf.N&y`:(k`,0ld 0*ld0jd0,jd)J(l f&kfL<N^NuNVH<$n.N#.Np.HRN HXOB-j` n&h`(k kf*y`(0Sf0-kf0-kf 0-kg*m f f8. nHhNXO./<N6XO'n nJf.N% `'m n(&L fl n-hJfN&y` (k .N./<NXO.Nf&L f.NNaL<N^NuNVH<$n&n p0(p0+r2+r2+./NXO& @p0=@BBB0n/0n/B0@/p0,r2*/p0r22.HЁ/0k//+0j//*NO0LN^NuNVH . /< 7/9 9Rr//<NOB$y`./<NXOEp. 9N"yAeL N^NuNVH $n46*Jg . =N . "|.Bp/p0*2H/p0*2H/0C/0B/0C/0B/pZ//9 //9 NO0L N^NuNqNVH$y`r*(f`b.HTHSNPO(&j`>(k `0 kf".HSN.XOJg.HS/9N2POJf(l f&k fzXo&<zX./<NXO$f pL<N^Nu.//<NPO.N#$$YYB(y`d*l`T-m 0mdB0+md80kd00-kd&.HSHUHUNO Jg.HlNrXO.NJ*n f(l f%y(y`./<[HTHRNO (l f%y.N$.N**gj*` BHRNXOp`NVH$n&nA"n n 0"nidx0("nidh I0"n idX0("n idH n=P0.nd,AC =n./.HnHRNnO =n n=h0.nc,AC =n./.HnHRN.O*($j fLN^NuNVH<$n &n n(h`,(ft*l`fg*0Uf$0*mf0*mf0*mf$M Bg*0Uf$0+mf0+mf0+mf&M B*m gJBf Bg` (l fn f` .HSHRNPOpL<N^NuJBf.HRHTN$POJfp`NVH $n&n 0Sf.0*kf$0*kf pL N^Nu0*kf0p`0*kf"0*kf0*Sfp`0kfp`p`NVH <$n&n p0=@p0=@Bn=n0*R40+S60*j80+k:A 0E.HRNXOSrb,&   @0; NJ =k=DHnNXOBBB0D/0B/0n/0n/Bp0/0n//.0j//*NO0BBB0E/0C/0n/0n/Bp0/0n//.0k//+NO0.NA$$$$$$4E. nHhN\bXO.N^BL D`~s &2Dlt|8> >  ,spurious wunlockfontmap OCODOEOFOGOHOIOJOPOpOQOqOZ |???8pcdefghijM>>>>>>AB ARARARA4DDj>M>M>>>>>>>>>>>>>>>>ARArXn~rr "2<jprr "V\r,J`p >>>>>>>BV>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>HBBC C8>>>Ch>KL|JxJ>>I>>KK`>>>>>>>>>>>>C >>>BCh>>>>>>C>>>>>>>>>>>>>>>>>>>>M|>>>>PT  : J ` p v     r         * 2 H ` |  s  , < Br N     >>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>M>>>>>>>>>ML>>>>>>>out of dlsolalloc: no olpxmaplpaint: coveredmergeol: ols not adjacent olalloc: %x requested no pixel map spacepxgc: addr = %x ol not foundc# @s??s        $ < B P X ^ h r z                     ( . > B P \ h p       '            <BNV^hntz %%%%% %% %%% % %%%&& & &&( &.&8 &F&T &l&v&& & & &&& &&''Tw'|x'w'w'x'w'''w(( (w(x((() &*04:>DHNRX^ds&.4FRXh}px"u0luzuxPw)&)4)Bx)Jw)|)**2w*Fx*~*y**+$y+*+:+B+H+P+X+`+f+x+y+,hz,n,t,z,y,,w,x,w,,,,,-$-,-@-F-N-j- -}-}-}-!-uuP Z8u>n}}~~ }u:J R }}}}(0}:}D}H~N}`n(u6Jruu}-}.@v.b.z!.#..../%/%/,%/H%/X%/z%/%/%/%/-0&0%0&0%0%0%0*0.0*1*11$14*1@}1Lv1^1l}1v}1}1}1}1}2 }2*}2V*2h*2*23%3 &3%3$u(Dt  u   u  ! u!*!4!Vu!`!u!""( "."6 ">"F "L"R "V "`"f "v" " """""""u" "" " " # #%3u444,%40&4D}4T!4b!4p!4#455:!5T!5556J6`6n6t6|666%6777@%7R7^7f7l7%7&7%7%7%7'777'7'7'7'8'8'8'8$'8,'80'# u#2u#8#@u#T#\#d#j#p#x#~## ######u#u## $}$$$$$0$6$>$T$Z$`$h$~$$$$$ $ $$ $% %8%\%d%n%t%|%86'8:'8L'8^'8f'8n'8v'8~'8'8%8*8'88'888%888*89 '9'9 '9('94'9J'9T'9\'9h'9~'99'9'9'9'9'9'9'9'9'9'9'::u:u:;6-;L-;p-=u'   =,W>-?u?u??@0u@>@P@u@@@u@@AuA"B0^EpEFuFG uG.HuHuH(HTuH\uHfHaIuI$uI.IjuIruI|IaJuJuJJTuJ\uJfJaJaK8aKaL@uLHuLRM + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +  + + + + +  + $+ (+ ,+ 0+ 4+ 8+ <+ @+ D+ H+ L+ P+  uM(uM2NObcPnPKPKPKPGQeQPGQ^eQuQR uS8SbKShfSpISvS|KSKSgSKTKV  VVZVzjV VViW iWjiWWiWiWtX6aXR{XXXt{XzX XXiX-YiY-Y SY:T+ X+ \+ `+ d+ h+ l+ p+ t+ x+ |+ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +  + + + + +  i[pi[i\-]j].-]:-]B-]L-]Rj]Zj]xj]j]j]j]-]-]h]h]U]]{^a^"^L|^Vh^u^_(u_8_vu_|_u_``|`U`}`~`{``h`ahaaa"aTUaZafaua+ $+ (+ ,+ 0+ 4+ 8+ <+ @+ D+ H+ L+ P+ T+ X+ \+ `+ d+ h+ l+ p+ t+ x+ |+ + + + + + + + + + + + + + + + + + + + + + + + + + + + uaa-b$-ddeme(sel]ere{ee{ee]ee]ef>afN{fTfxf~ff{ff]ff]ffag B               + + + + ++ + + + + + + +  + + + +.file gwd.c.textd.data \.bss wmajor .filegwdsub.c.textd.data \(.bss .filegwfont.c.text&@.data  + + 8 + + + + + + + + + + + + + + + + +  + + + + +  + $+ (+ ,+ 0+ 4+ 8+ <+ @+ D+ H+ L+ P+ T+ X+ \+ `+ d+ h+ l+ p+ t+ x+ |+ + +.bss .file!gwdkbd.c.text- .data p.bss .file)gwdmouse.c.text. `.data .bss  .fileEgansi.c.text::.data t.bss .textM