IMD 1.17: 22/11/2008 11:31:29 AT&T UNIX PC 3.51 Fix Disk Ver 1.0 Disk 2 of 2    UQVQWFFloppy( "Aa^y    ha|hayes|hayes 1200:tr=\r:wp=\r:wk=K:wt=T:\ :ta=AT\r:tb=ATDT:\ :es=\r:\ :d1#1:d5#5:\ :pl=trwpd1tad1wpwpwkwptbphtrwpwpwttr: # new modem entries from ATT # Name=ATT4024 ATT4024|4024 :tr=\r:wp=\::\ :d2#2:\ :pl=trd2wpphtr: # Name=ATT2224 ATT2224|2224 :tr=\r:wp=\r:\ :tb=AT:wb=H:wc=e:wd=l:we=p:\ :d1#1:\ :pl=trwbwcwdwetbd1phtr: # Name=penril penril|penril 1200 :tr=\r:wp=\r:wk=K:wt=T:\ :ta=K:tb=ATDT:\ :wa NJ!B` 80V 6 ~ &b 0BXJB n/(N.Hj/.N/tPOJg(f"Sm lRr `.p /N HXO g*NA` p o.u/9 N0XOS gX.N !Jfp`p# `t`tp--@`nt gHH`p-@B p-gp+fBHSNXO$XJg g.r/9 N0XOJ g-|Bpf. g.r/9 N0XO-y p-@`2g$pg.r/9 N0XO-y `-y $g&-y f.r/9 N0XO`-y .NK>Jf&Jg B/.B`J./<bN 5XO`Jodemcap (/usr/lib/uucp/modemcap) has an entry for the AT&T 4024 modem. 0707070000020173061007550000000001440000010511310420437161000002100000000133modemcap/Installmv /usr/lib/uucp/modemcap /usr/lib/uucp/modemcap.ORIG mv ./modemcap /usr/lib/uucp/modemcap 0707070000020173010407550000000001440000020511270421111015600000400000000000ksh0707070000020172771007550000020000020000010511260420437162300001000000257750ksh/kshR!k" Qh .textQh .datag`BHTN XO`tp+fp`p./.p//.`pf -y `0 g$ -fp.HSNHXO$XJS -y `-y $p oJ.u/9 N0XO`2 n $f<,gp].HSN BPXO @ f l0pg.t/, N0XO.N 9` g.HSNXO/NpXO(@ f .ttHS`Lp l A.N.BNXO`JHnN ELXO. NK>p ./.N$XOp ./.N$XOp ./.N$XOp ./.N$XO`J (g, g .N =(` 9 ,# p./9 (N B8XON Jm g .N =(` 9 ,.N X@.bss  1L`J 0gzp# 4# 8 g.N =(# 4 9 4 0o# 0 4`> 9 4D# 4`,J 0g"p# 4# 8 g.N =(# 4 9 4 0o# 0 4` g-KfHH"|.1gp`pf X -fRX&R gfHH"|.1g .N =(`.{HSNXOS$p!nJl.tHSN0XO`Jg .N9` "| <.N.N( "| <# nJg .N9j`P.N8`D. NK>tp!n "| :g89 g.p/.HSN BPXO @ g. NK>p .HSNvXO y AZ.N ;-@. y HhVN 'dXO /f.HnN F` Hn/.NPO(@/.HSNXOG   .N +. y HhZN 'dXO./< cNXOJfX.N <`L g .N !`p$m 9 ̰l.s:/9 N0`& ѹ Е `p. g HSN =(XO`p/N >`B ` .~HSN XOXJS J+g&j g -gg(y `& g 9 Ѐ"瀐"| 4I`(| 4, HH@f.t/9 N0XO, HH.N MJg. NK> p?.HSN BPXO&@ gp, HH@g*. e, HH/N =XO/NKXO @-Hf-| P.NK>.HkNQXO Pg .N G( @H.HTHjNPO, g&pp-fp.N`pJfp-gp=.HSN BPXO @ fjpg$.N ; @ g .Nb`(R `BHTN XOJf .HSNQXOp ./<uNvXOR `-Tp-fT .̀&g?`" gpƀg` g` g` F&JgpJ n .̰g^.g-l nr0 0-@ n2(-A .İn& n0 ."nCJg.(. /HTN PO ."nC qrƒ R`. /HTN PO`S gX&R.HSNXO(@ fp# `RKf# g. NLB B , `\ 9 @H$ gP./. NlXO&pn 9 g . A"剑.N p Jg.N f nJ fB/9 $B/9 NO ` gA.HS`Dp-@BBBBBB N;(y  f.r/9 N0XO`.HSN rXO$f4R .CA2,H S B pfF`VgXJ-jf.s/9 N0XOgR gRgRXJ&j g -gh$.plT&j gLfHH"|.1f -gJfHH"|.1fJf>&jR.N =(& C# -f CA2,HSӐXJ`rp.B0,HS//*NEPO -@R CA2.H l.tt/*N0XO`NVH t nE`  "| RJHHJgNf. |.08g 9 Ѐ"Ё"0Ё# `./< N BPXO&@ f`  f L N^Nu.r/9 N0XO`NVH $n&n HnNJXO gHnHRNJVPO-K` g.NJ.HnHSN @POp.p /N XO-@9 fp fJ gNABNJp ./.N$XOL NXp=.HkN BPXO @ g@-K`2Jl Jg.0,Hr$pl$-BtJf"Jg0,HS`0,HU` .-@0,y =@n=|t`R C 12.Hm&Jfp`p& C 12,Hm.s:/9 N0XORpmJg( n -f .g.s:/9 N0XOp-@Jnp$ C&1pC 1lp-@Jg-y &| g`HnNNXO-@&| jR.NK> C 1r29 ЀC=qJfp . C/1NR`.Jg* nSm n"hRp `.p /N HXO.p/0.HЬ/N^NuNVH$n&nJg<(n JfB`L`` Rrgp `p .HRNvXOPK$S f y Sm y "hRp L N^Nu. p /N HXO`NVH &n B.t/N BlXOJfp`p-@X$S gXHHp-gp+fDp-fp`p@SRHHJf w `p-fJg XK9 g  Jg,pl .S.HS`. y HhN 2TXO .L N^NuR`./<DJPOJg9 g .N1LpC&1 C 1g CA".Ӑ`(p.B/N >POJf. PNK>&n f y A.N ;&@ f&|w. -gA-HBHnHSNPO.NOHnNM$XO-@HnN FXO.NAlp Jg././9 NIPO`xJ f.BN0`p.N G(9 fLp `@ g -f.HSNFXO$XJS p o.u/9 N0XO. NK>.HRN:` g.N 6H.N F`. NK>p.BN FXO-@ /N ;4XO&@. N FR0p .HSNvX N EpXO @ g.r n /(N0XOpcf.J.g(pn J fX# S `./< lN EpXO(@ g  l"| |&1`bpog.r n /(`BXKJf. N^YK``S.{/NXO&p&pag.r/N0XOJ.g g  ` F HHJg Jgpsf`NVH $| l&| `  l"| | 1 gRJJfB |  L N^NuNVH $nt&` .N P,Ԁ&Z f n" &B/9 N.XOS.//.NPO#  S# L N^NuNVH $n&J gO`v g -f.?HSNXO$&jgv g$.N !-@l.s:/9 N0XO`Sp-@./N F0XO-@l.s:/9 N0XO f. NK>p ./.NRXO` g -f.HSNXO$.N &`p o.u/9 N0XONKzt -fnRK lfN`~fHH"|.1g .N =(`.{HSNXOS$Jmp m.r/9 N0XOXJS S gX&R.HSN PXOѹ `X&R ggF. HSNXO(@ g&gRp-f`p+fp`R ` .Ѐ.HSNXO(@Jg  gjSfbJ g f y r!A`B y f# `($y ` Rg$R f f L N^Nu$.N$S J`NVH . r ЁЮЮ .N$@&np%@$ # I# . C A(`./NXOR( . S JfB J LN^NuNVH$y  n B B .Nf J LN^NuNVB/9 NXO @# f# # N^NuNVp./9 N~XO @# f#  BNJJfN^NuNVH$y  gR J LN^NuNqNVH .X @A r$$y v*fB`$&R+g    e,A(# c p @$A L N^Nu&Jp$@b RJg.N`NVH $.J f. N;<# y gL y R B y A r$@ y G& # y " A"A # # y "҂"A # t` y A"y C(bJg.N;< y r "A y E y g*./NXO# # J# L N^Nu# `NVH $n c d Gp @&L N^NuNqNVHp .N$@p $%n B J LN^NuNVHJ (%L y g#  J g .fNA.NAlp R NBHSNXO&@ gp-@.BNDXO$@%Kp gp$`|p(# J. gB/*NXO%@J g .@$B(jJo.HRNXO)@ .r 㨁%n  `NV`BNoR Nr g 9 N^NuNVH $9  9 rg fJ fBB > f B@`8B`2BN: &fB` >fB`HH@# Njp.N$@ y A %H$g%y # NB/.N gJfN |`p .N$@$%n %n J LN^NuNVH $.vp-y . PNK>. N$@p f.g"p;# BNo` f .fN 9 r&gr;g> g^ fdC g y gC./NXO$@`N p ./NBXO&@ g&.HRp/NPO$@`p f ` .N `Jf J L N^NuNVH.NZ`D gD & fp`p$f | f"p.N*.HRJgp`p /NjPO$@` J LN^NuNVH $.-y R gN>`N < fp.N&@p&R Np.N0XO%@ J g  J L N^Nu n`NVNJgNPN^NuNVH $.  &g `  gNL N^NuNVH$.g"$|z6`PJJg *f. /` f. /<wB/<sN8XO9 f*. /<wNQXOp . y /(NRXOp`./<w6NvXX$@ gNp| fD$< n gBp.Nt.HxNXO.HR/N|PO/p/NPO$@ g'J K L N^Nu J`NVH$. N~ 9 fp LN^Nup .N$@B`Np./9 N XO y  $ p) g p| gNr)gp| gNp| gp p.BNXO%@ ; f .N0%@` .NB J`HNVH<J. gp.BNXO&@` 9  gLnJgr(gz gb fpp .N$@Nn y A %HN8.Nh  f <"` <(.Nx%@p$OJg.Np`p'. y Hh NvXO g g$|wTp .HRNvXONAp.N1LLN^NuNVH $nB*vA -HB.`^C`Vf "fC`BJ.f< *g ?g [f* nJf [gC` "fp.@C nRg.fHH"|.(1g $gx `fx`lJ fpƀJfL N^Nug* `gg|`I &L` "gfB`NVH . T.N$@X(J n&h`A $&S fB L LN^Nu  @ `Lp.Hx(N,`*p.N(@p.p)/NXO)@p(.BNXO$@` g g g4 0g 8fp.N$@  fp `p.N$@p$p.Hx$NXO%@p.HxN|XO%@$9  fp.HxN\XO` f# BN\ @`%H f@ J L<N^Nup $B N y A %HN  f>NBN %@ p gp; gN p fBNoN`p; fp# N.Np.  f <!` <(/NtXO%@`~p .N$@  fp`p$p.HxN>X ""@@@@@@@@@@@@@@@@@@@@@@@@@@00112233445566778899aAbBcCdDeEfFgGhHiIjJkKlLmMnNoOpPqQrRsStTuUvVwWxXyYzZNqNVH$n n X &P g.`HH \fJfRHH @fg0nd @0g2 @\g& @bg @cfrpLN^Nut`bt `\t\`VtIRdF 0m> 7n8HHr0` @ng @rg @tg @vft `t ` t `t `SKSm jR"`O%@p.Hx!N,XO%@`6 f`B-|BBp.N$@%KK`f(y B 9 g BHTNXO(-L `dB p.HTNXO,fp-@Jm" .RJf.|nHl NXO-@**L 9 @H-@# NpfJfp( fNp) fz# -y -y .0N$@p $B 0 fN y A %HN.Np.N9 gN;J g: y -P 0(H"y Щ"n"iA"n `p%@p.Hx(NXXO-@p.N(y L#. r/N HXORKJf n Jg"Sm jRr `.p /N HXO9 g.N1L`p`NVH $n&n . PNK> gp:`p .HRN8XO g> y Sm y "hRp `. p /N HXOp .HSNvXOp.N L N^NuNVHp $# gp./9 (N B8XOp @H g# BNLN^Nu f6NKz y  P. y /N @XONNBNSzp# 4# 8B NAp8 By 2# p./9 (N B8XO`pNVH $.&9 $y < gB PO`@ jR"`0. rB/.N EPO/NKXO @-HgR.Hn/N @PO.HRNXOBJfJ.g(K /f -LBB $Jf`l nJPgb (.f .fR. nHhNXO. nHhN /xXOJg. nHhHRNPORB nHhNPXO.p/p//.N =O rf 9 gl.NOJg<*y $# $Jg B`p.Hm NXOѮ*m f n/$n`HHr€gHH`p/f .`NVHN(@,G $n`pĀf/` HHJf$n `RKf$n g/RJf9 g"B.@/<Hl N6POJ/N HXO`p fp-@`Jf JgR nSm n"hR@H` .NTv&pgpnSm`~.NOJg.HRNXO7@NJ.g HnN FXOp`NVH$nBBHRN >POSm jR@H`.NTv@H g pLN^NuSm jR`.NTvp.BHRN >POp`NVH$nt& 09  gB/. HRN >PO`pl r„Ё$RSm jR@H`.NTv(pgHpf LN^NuJf @H f y ". ҂\!Atv`R`Bp/HRN >PO y r!Ap`g/.N2)y $# $LN^NuNVH $n$. `HH"|.(1g RJfL N^NuNVH $np..HRN EpXO&@B+. HRN8XO-y $` nA .N F n-hJfL N^NuNVH$n B $N(@./.NXO&@ g.HRNXO&@.N2BHTNXOLN^NuNqNVH $.pf9 L N^Nu.7/N CXOp f .Np`pfh9 gJ o9 g B/<rN0XO` p<.N B p ./<rjNvXONKz`h "| PO`fBH f p-@Sj`JJg f>oRj` fSj0*Hr29 ЀCA"0 R-@ RSm R"hR@H`.NTv$pgR .SJod`Bj 5@L N^NuNVH $n&y Sm jR<`.HxN HXOSmF jRr.N GTkSk0+Hr29 ЀC3L N^Nu.BN HXO`NVH $y  gl9 g`p &RBj p ke"tHp gf |.(0(f | "0(pn4 `(NVHt!.7p /N CXOp.N\`F | 0(HHr`€f2.N@Jf( | 0(g |7` |28./N CXO SJfLN^NuNVH &.p f.N.t/<tN0XO`0./N CXO @fp`p$f | 8 L N^NuNVH$. | 0(f .NtJf.7/N CXOLN^NuNVHt"`& "| <$q gJg.N$ | B0( SJfB9 LN^NuNVH$. "| 0( "| <$q g&-y BHRNXO# # `SfLN^NuNVH.N O$@ rfB/<rN0XOJ f# .A# "y cB/<rN0XOLN^NuNVH< BtJ g L< N^Nu y A.N ;(@ fVJ fJ9 g`8.N G(`,Hn y HhlN ;XO/NPO*@./<wNXOIB.`-J.N F-Bt./<w`NvXOpL N^Nu y $PB/.HRN >POSm jR@H`.NTv$`JgR gJSm jR@H`.NTv&pg$p f&Jg. /.NQ`Bp& f .`^ y Sm y "hR `. r/N HXO$R`fNVH $y =| f`TJoNR `L0*H-@Jl(p09 ܑpo-@ . n` . m`S . p09 ЀC01HЪ-@BnJmB/./N >PO-np-@&nJgn RSm R"hR@H`.NTv$pgBJg>Rp fRnJg    nHHf Jl-nHHfRK`Jf=n`.Jg JgpfL . fp.B/N >PO .L N^NuNVH $n&y vI f pL N^Nup09 ЀC01HЫ-@B//N >PO` gJm .f eB"`J  SSm S"hR@H`.NTv$g pgp f Rg Jm` g"*HHp fSJBp.B/N >PO `8NVH $nvJ f y 4 L N^Nup. y 0(HS//.NPO`>f |.(0(gp`p$gJg BS g v`Jf Jf-JRRJHHJfB n`NVHk.N@JgpBNT(@. N '@HnHTN @PO'y # N-@Jg`R n  g nR$H nBJ.g|'` nP  f:B./.N BlXOJgHBNo B./.NXO$n&.`  fJfv.HH.N:f.NL N^NuNVH $n&Jv` @H `&<HHJgp"g`B L N^NuNVH $n&n g f*pL N^Nu kR`.p/N HXOgSm`p`NVH$n`FBN.N G(. N F.N. N%@./*N =XO$j f$.&. ֮J ft`Jnf y 0(Hr29 ܐ(JlZSmp./BNPOր`t =@ .LN^Nup./BNPO(nR y 0(Hn` =@`NVH $nN&@R =f n Sm n "hR@H` . NTv$pg `.N2-@. N G(BN&@.HR/./.N`O @ gF.N P,A.N2|= y .HSNQXON>BHSNXOL N^Nu.sr/.N0XO`NqNVH. /.NXO$@.#  B  LN^NuNVH$y $Bp%@LN^NuNVHLN^NuNVH$n`.N%jB$j fLN^NuNVH $.&9 Ѐ"瀐"| 4E o S"| 01HfL N^Nu* HH@g .N G` 4fNp .B/N @PO&o Ѐ"瀐"| 4A 0E 9 "| A"0 9 R "| A"0`jNVH$. 9 S&` "| 81HJoF Ѐ"瀐"| AA" "| 0q. Ѐ"瀐"| 4AHPNXO`* "| 01HЀ"瀐"| 4A.N G(Slv# LN^NuNVH n( HHp.B/N EPOJlp&n$n (y (| %K K%H|P $p)@ fp`p* * HHrLN^NuNVH$n%y  B# LN^NuNVH $.$y J g@&R+ HHJfJopPgpg g.N# pL N^Nup`NVH$n y ԱgN"# . HRN @XOLN^NuNVH $y g&jc.N G gBL N^NuNVH$| 4NJg*p. D/* HH/N EPO.HRN @XOLN^NuNVH $.$n Jm8 Ѐ"瀐"| 4GB @ BHH @ag" @rg @wg& L N^Nu f pLN^Nup`NVH$n$9 * g * g* fJf0Np.Hn* HH/N EPO$JoS.` 9 g8g2 y f(J g g./** HH/NҔ`D9 gdg\ y fPJ g gD./** HH/NPO$%jSlPpf6 * g.* `&N./** HH/N E` BpLN^Nu jR@H`NVH $.&. Jm(.N Mh.B/N @POp.p//N @POL N^NuNqNVH . ` y R 9 0HH.NgJ `p.B/N EPO *+f + + K`NVHnN @(XOJm JmJlB/<sN0XO. $/.N2XO"n". &/.NXO"n#@N^NuNVH$nJg.N G(Jg .N G(LN^NuNVH $n. (BHRN EPO/NXO&@ f.tHRN0XO K L N^NuNVH $. v Ѐ"瀐"| 4Epo 9 fv n( HHgJfBp//N @PO&J* g.N".B n( HH/N @PO n( HHg&| *` n( g | -` | /&H.N G(./NXO$@ @ f. ` y f y BgNz L N^NuNVH . `ZHH @"g @$g @`g`>HH.N`0J 4g y 4R 4HH`Nr{fp}.NJ 4g y 4R 4HH`Ngf~gNL N^NuNVH`ܙB 9 R-@B.A-Hp{fp`p@g^J 4g y 4R 4HH`N&`6J 4g y 4R 4HH`N&p}fB.`R.f^ |.08HHrP€gH 9 Ȑ $@`4 y R "J 4g y 4R 4HH`N&f |.08HHrX€fp[f>J.g6J 4g y 4Rf* f. HRN @XO` n$ n%h n%hB/.N @XOJf pf.p//N @POL N^NuNVH$nt &| 9 gN M|.N".NR .  /9 N"XO/NXO.NN(@ f SJf g,.HSNXO.HSN`XO(@ f.sHSN0XO L LN^NuNVH. 1Hx/.N =PO/N`XO$@ J LN^NuNVH $n&n g&.N G(. 4p/HRN EPO/NXO&@ K L N^NuNVH$n.N.N G(BHRN @XOLN^NuNVH t &n g @H-@&.N- 4HH`N&f |.08gp n"B.J 4g y 4R 4HH`Nr]gp`p&gN J 4g y 4R 4HH`N&B`9 0HH-@ y R [J 4g y 4S 4` @# B9 0p].N 0 y R ]J 4g y 4R 4HH`N& y B "y A.N ' (@ "y A# .N ;&@-l Jf6,g. lr2(RD-A` lRPRg.N ;&@ gJ 4g y 4S 4` @# `fv |.08HHr €g` n"B.f |.0   8gp-@v1p0Jf y $` n "y q`p-@ @&H`dp$f&| L`Tp!f&| @`Fp#fJ.f. ` p?f. `N"` p-f N&@` J.gN J 4g y 4R 4HH`N&J.gfp}gN JfJg g6.N P,`.Jo&9 `"Jl lr2(R&` gp`p&.N"&@Bv}p:f2J.g,|J 4g y 4R 4HH`N&`B.f |.08f J.gN J.glp}g 9 Ȑ $@ g J.gJfp`p(f |.08gp`pg p}.N`p}.N, "y E # # 4L N^Nup`NVH $n 9 @H&-y 4# 8B 4HnNJXO.NJ.Hn/.N @POHnHRN @POJg . PNK>N`( y "hR`. p/N HXOp".N y ȱ g@B. N./9 NQXOJg. /9 NQXO# JgSmP jR`RBNJ# 4B 8.N GBBHRN >POBHRN @XOL N^Nu.p/N HXOJg8 y Sm`NVH $n .r#g$r%gP g g@ J L N^Nu&JRB. /.N /xXOJg &Jp#g`$J 4g y 4S 4` @# vp#gp%fdJgN N gNJgJpѹ ./9 N FXO.NHHfCRJ.HR/9 N PO&@gSJ# gJ.gJgp+g n *f9 0HH@ `p Jf0J9 0g( y R ` y R "9 0HHJfJgdR .䰮lTJo ."y &q`* lRP.N ;&@ f lRP .RJf g y R `Zt$`4 gbp?f.J # d N =# . tN E8N8~B BNNN-@.N &@ -f RK Jo. THSN BlXOJft./.NlXO# .A"9 S 剑# p o 9 @ f S X . tN B( y # $. LN M|/N"XO/Ns`/.N0XO`J 4gR y 4S 4`J 4g y 4R 4HH`N&f |.08HHr}€g`h @# `v. gn `fJ  Sm jR<`.HxN HXOp .BHSNPOSm jRr` .BN HXO/<wNpXO @"y "g.N y .N G(JgJf J gHn/9 NJVPO`<&y $# $9 g | 4` .NM$ @"y "# $S p BNN9 g y Sm$ y "hRp BN28L N^Nu. p /N HXO`NVH $. y $PJ* g* HHpPgJoXp./NUXO.N G(. \p/NKXO"y "$@. HRN @XOJf4B/< 4N @XO`".NT2Jg` | .HRN @XO9 gp gJf. HRN @XOJ g |w` |w. y HhNXO 9 gB/9 HRN >PO.NJ.v`HJ f BHRN @XO. HnN FXO. HRN @XOE.HnNJVXO# N$ g @# `Jf0Jf* kJf.N6(@`(|w.NM$$@`rR y g./.N XO&@HnNLXO# , (Ry 2HnBp /HSN$OBy 2$n.N G(HnHRN @PO.NJ..Nn. /.NXO# ` y R "9 0N$fJoB/9 XO y g.p y HHrr gpѹ y BJm.p.NJ . p.N8N;J g6 `, p p  Jf  &y . N B(JgJg.N G(L N^Nu# (p# # 0B B 8 g.NJ.* g`N@``J oBN B 9 g6 g2N@~ SSm S"hR `.p9 /N HXOp p p.p /N XO-@ gNAp-@Jf9 gp"nf./.N$XOBNnN# ` p @@@ Jgp . PNK>9 g y J f* f p    p.N & y A2.N ;(@ f y A~.N ;(@ g,HnN E8XO .萹 t m.N\# t gN@~ y A.N ;.Nf.N`J o . N B B9 N# * f * g9 g y J f* f* 9 g" y ( fp ./<tNv`VN Jl`HNVH$.f9 gF y J f:Jg | 4` y  PJn". PNK>. Jg y AD`LN^Nu y A$HPN ;XO/NQXO`NVH$nJg&J` ?g %f f(KRKJg :fB gPWD=`/bin/pwd` realusersys}}}~~w~ ~~~~"~(~.~6~=~E~L~P~Y~b~i~q~x~~~~ X~ 4~~~ ~~~~~~~~~~~~~~ (-7<EMS[fjwz  !"&+/BB $HnHRN EPOJmNJgHJgB .谹 tm6 .䰮n,J $fLp0. @f8. ^HRN7,XOJ $g` y $E # $`LLN^Nu-y 4# 4p . f |r`AHPNfXO/NvXO# 4` f2 g?$KJfBNn`NVH $nNKz. PNK>&J`p!f@RHHp!g.BJ g y 0(` Ry x09 xH/NRXOJg y Sm* y "hR `, y hBL N^Nu. r/N HXORKHHJg``NVHp/./.N EpXO$@ f n LN^NuA`Nq@(#)ksh/s!47=@$EJORXZ(\0e8l<qx&0?JOSW\`eim q v z  "    &.1h:msg.c 1.2 shell time out in 60 secondstimed out waiting for inputrecursive callno query processno history filebad option(s)you have mail in $_no spacesyntax error) expectedargument expected] missingbad numberparameter null or not setparameter not setbad substitutioncannot createrestrictedcannot fork: too many processesprocess already existscannot fork: no swap spacecannot make pipeUse 'exit' to logoutcannot open - core dumpedptrace: arg list too longtext busyt7>AFJLQV[ww]clr w|     !EGCDFHE   PATHPS1PS2> IFSMAILCHECKPWDHOMEMAILREPLYSHELL/bin/shEDITOR/bin/edRANDOMENVHISTFILEHISToo bigcannot execute not foundbad file unit numberbad directorybad trapcannot trap 11is read onlyinvalid identifiertestsetunknown test operator alias not found is a reserved word is a built-in command is an alias for is a function is an exported alias for is a tracked alias for is an exported function is onoffdivision by zerosubscript out of rangebad argument count { fc -e "${VISUAL:-${EDITOR:-vi}}" Done & |& | Running(coredump)You have stopSIZEFCEDIT/bin/edCDPATHMAILPATHPS3#? OLDPWDPPID_VISUALCOLUMNSTMOUTcat/bin/catchmod/bin/chmodcc/bin/cccp/bin/cpdate/bin/dateechoprint -ed/bin/edfalselet 0functionstypeset -fgrep/bin/grephashalias -thistoryfc -lintegertypeset -ilpr/usr/bin/lprls/bin/lsmake/bin/makemail/bin/mailmv/bin/mvnohupnohup pr/bin/prrfc -e -rm/bin/rmsed/bin/sedsh/bin/shtrue:typewhence -vvi/bin/viwho/bin/whoinesaccasefordoneifwhiledothenelseeliffiuntil{}fped jobs You have running jobs No such jobNo such processPermission deniedkill: Arguments should be jobs or process idsNo job controlrwxdcbfugkLpsnztCurrent option settings :/bin:/usr/bin/bin/ed: -end of file unexpected unmatchedarithmetic expression ending in single ')' at line /dev/null+ # $ .profile/etc/profile/.historyexportreadonlyuppercase lowercase leftjust rightjust zerofill tagged integer unsigned function long base unctionselecttimeHangupInterruptQuitIllegal instructionTrace/BPT trapabortEMT trapFloating exceptionKilledBus errorMemory faultBad system callBroken PipeAlarm callTerminatedSignal 16Signal 17Death of ChildPower failEXITHUPINTQUITILLTRAPIOTEMTFPEKILLBUSSEGVSYSPIPEALRMTERMUSR1USR2CLDPWRERRallexportbgniceerrexitemacsgmacsignoreeofinteractivekeywordmarkdirsmonitornoglobnoexecnounsetrestrictedtrackallverbosevivirawxtracecdreadset:trapwaiteval.   breakcontinueshiftexitexectimesumaskulimitloginnewgrptest[returnfcprintlettypesetunsetaliasunaliaswhencejobskill=!=-gt-lt-eq-ne-ge-le-gt-o-a-ef-nt-otNVH &n n`&f ./.N BlXOJf +L N^NuPK$S fp`NVH $.$|{. NK>p ./<wNvXO`Vp&p ./NvXO.N P,r.p /NXO g p ./<u` p ./<uNvXOPJ&*fL N^NuNVH $n$. 9 g\B`T*gA .N6&@`G .HSN@XO$R9 g". PNK> p `p=-@ Sm lR.`.p./N HXOp g .HSNvXOp`(NV y X "n R  n(g n h"n"i0N^NuNVH $n.NK>N# -@B J g. /. /./<N 6O `./<N 5XO. /.N 2TXO`B/. nX/NNPO&@ gr+g\-k nr0 0-@ n2(-A .찮n: n0 ."nCJg .HSN0XOR`.HSNXO 9 S JfbL N^NuNVH $n. /* NXO&@=./. NXO&@A  .N @ L  gp `p .HSNvXO fL N^NuNVH $nHHf |.0(HHrP€f@.gf2 |.(0(HHr€g.t/.N0XO L N^NuRHHf |.0(HHrX€fp[f .N .EHHJgp=g.t/.N0XOB.g(p./9 /.N ,XPO&@ @g4`,.gp./9 $/.N ,XPO` .N ' &@ p=f, f9 gJ.s/.N0XO`6 y Af(.Nr-@pr./.N BPXO @ gB |.HSN 'XO . f .Hx/9 /<N 6O y Ag yN^NuNVH $n&y Jg@*gp ./<wNvXO*gp ./<wNvXO*g./<x,NQXO*gj*g ./<xR`*g./<x>NQXO*g./<xHNQ`./<x4NQXO j g|./<xX`V*g ./<w`*g./<xNQXO g<*g ./<x `*g<./<xNQXOp .0j/NRXOp ./* NvXOL N^Nu./<x"`NVH$y p# | g` p./NXOJf 9 |LN^NuNVR N^NuNVH $n*gpL N^Nu.N ;&@ g.HRNXO"y X Afx y Jfj.Nr$@. lHRN /xXOJg  . pHRN /xXOJg$ gf <` < K`NVH$nLN^NuNVH$n. Nj&@(jp g /g @H-@.N 9$` g.HSN BlXOJg .HRN 'XO.N ; @ LN^NuNV nJf. /N 'XON^NuNVH $np-@ .gp .gp'`p-@A-HJg2p?./N BPXO @-HgB.N ' &@Jg n?` y G 9 Ȑ @-H. vN ' .N ;-@Jf-| "`NVHB p.//9 $/< N 6O 9 X.N$@# p.//9 $/<N 6O y X B J LN^NuNVH.N# B//<x~NPO# $ y !| d y r*!A y 1| y r !AH y 1| X y r!A y 1| .N$@p.HR/<yNNRPO# p .N /,# LN^NuNV y r !Ah y 1| x y !|zN^NuNVH.N /,$@&n (n`P'T 'lBJg" .@-@Jg l /f&Bk.HSN 2XOPLGJf J LN^Nw y -PJ f.r/< zN0XO n "y gZ( f n Jf4 4 f. 4NT2Jf.N./. N @XO.NJ. NJ.`BJgJfJ.gJf< y ȱ c.p y HH./.N BPXO @ fR y B y .HSN 'XO y # 9 gJg .N ' @`&HJ.fp-@`B.wHSN 'XO9 gJg.N ' @` y R .N:HH./.N BPXOJgp`p-@fHH"|.(1gp`p@JgJgJfHH.uNVH$y $p.N /,# $ @ ./.NlXOLN^NuNVH$y $# $./<N 5 XO.NLN^NuNV`N y $JfN^NuNVH$np.N.NLN^NuNVH<$nK @f$*g&(U0,t4`& r.N 4.`L<N^Nu.N 9B`JmD SC&q g fKJg @f+g U P` U.N`.NB`NVH &n `BHS/.N ,XPO$@&S g g gJf L N^Nu J J`NVH $n&n JfS K L N^NuNVH $. `Jg. HRNQ/<wN BPXO @ g`x&H f, nʱ g p.NJ9 gNA p L N^NuNVHJg0.N P,R.N$@./.N XO J LN^Nu`NVH$nA-H9 g .N1L(y *fp f./<xHNQXO./* NQXO jJm*./<uNQXO. p/ j/NDJPO`"Sm lRr `.p /N HXO0*HRLN^Nu.N ;&@ gF./* NQXO*gZ*g.HnN FXOGSm lRr[`p`.p[/N HXOp]. n P?BgNRXOJ gXO.N +&.z6HRNXOJgJgl$|u`bJgR. HRN(XO&@ g>+f6.N ;$@ g(Jg.+g(|u``(|u>. HT`.|nHRN*XOJgJg$|u&`Jg8. HRNXO @-Hg"Jg(g |u` |uP$H`Jg* f&9 gp./9 HRN ,XPO&@ gT+g.N`.N ;$@ g.Nj$@JgL. /f |u|` |uHPNQXO`&.Nj$@ gBJg. /<uNQXOp .HRNvXOpѮ n$P f@L N^NuJg |tt` |w$H `NqNVH &y $y $ g6 -fRJp:.   HRNXOSm kRr `.p /N HXO$n`X  m ~o&Sm kRr^`.p^/N HXO @Sm kR`.p/N HXORJfJ gSm kR.L N^Nu.p./N HXO`NVH$.`Rp . N N$p lpo -n`t$n `.N P,o `.N P,$XJJf .VԀl. .N N-@ ."逐".o ` .S.N NR-@ .S.N NR-@. .N N".V-@t`& "n E R.N . /< 4N @XO.NM$"y "Bp//9 $/<N 6O Bp//9 /<N 6O Bp//9 /<N 6O .Np./< tN B8XOLN^NuNVH $n -y (B-y -y $-y -y 0-y 4-y 8-y -y -y -y <-y B 0 g(.N^# $B HnHRNPPO-@A# (HnN B(XO-@fL 9 R  op./9 (N B8`. g n P` nHPN$XOS # ( gg$. p/HRN EPO/NKXO&@ f.NOx&@ f.sHRN0XO gp.HSNMpXO n-h JfH .L N^NuNVHp/./.N EpXO @ g |w LN^Nu. N ;$@ f$|w.N @`NVH$n&n p/.HSN EpXO @ g9 g.sHSN0XO.HRNHXO$@.@/</9 N6PO$Jf&. B/9 N EPO/NKXO(@ f f L LN^NuNVH$n.Nr&@.N(@.HTNXO(@./9 N BlXOJf pLR$R f L N^NuNVH B9 fp`p-@J g y A6.N ; @`-H"f-|w9 g .N1LN&@E `  nRHHJg./.N EpXO @ gA f4Jf .L N^NuJ g./<wN EpXO @ fz`JfS.N2+JgBHk N3dXO$gծ`R'y $# $ y $`"NqNVH nA r$$y չ # 9 d .N;< J LN^NuNV 9 d .N;< y N^NuNVH $nB&y A r @# #N^Nu fp`NVH .Nr$@.N&@g.HSNXO&@.HSN^XO&@p./9 N E\XO$m .@/</9 N6POJgtJl fJl L N^Nu y `NVH$n&JN(@`Jg :fg/JgRJf SK`RK :gHHg K`$H&n Jf J LN^NuNVH$|w&n9 f#tt p./. NXOBNf# p/./N EpXO @ g*9 gn.N`h0@g0 9 ذ p.HSN E\XOJgnp`$p.HSN E\XOJgTp` .@`. /<`.``.`.HxHSN$PO`.Hx`.Hx`p`.Hx`.N$`Jfp`Jgp` g )fJ+fS Jfp``.}~HSNXO$-KfBN&@Jf.t/.N0XOg.N !-@.N !-@ rDgn2r gnrghrgxr gr grCgrGgnrEgrFgrHg g fS Jf B gp./9 NMpXO# B   Jf,p 8f. NRhp# 8`B N n# # B N99 gg.N A`&g p.p/N CXOp.p/N CXOg9 g p.N =0@@g  g4B n/NMpXO f n.N G(B/< 4N @XO gp. n/(NMpXO.NLg J f. 4N G(.wNM$p B/*NXO`F.HRNXOJnzp`0.HRNXOJmdp` .gRp` .f@p` .n0p` .m p` .lp` .np`p`NVHn/.N EPOJlpN^Nup0. fp`p`NVHn/.N EPOJlpN^NuJop`p`NVHn/.N EPOJlBHn/. N EPOJlB .N^NuNVHn/.N EPOJm.Hn/. N EPOJm0.nf0.nfpN^Nup`NqNVdH -y -n-np -@9 g .N. /*NXOBN28tHnNLXO&jJfHnHn/.HSNO$&j$k-n.N G(Ry 2JfJfpgJf.Hn/. HSN8O `DHnNLXO`4 B/*NXOJf. /*N` B/*NXOJf`.N ' &@BB J f y I-y N-@`.-y $B $. N-@.N`(@# $p f-L L./.N>XOR 0`Rt R 0`,./*N(XO$J 4lR 4gp`p# 8J 8f,pfp`p&B/*NXOJfp`pgJ 4oS1LJfp $n g PJ 8f Fp-@# ,B rb @0; NJ  \ . . T~$  |-y $-j-jg n(g r?$`t r -@Jg n-h`*B $.N-@.N`-@ @&P.N9 g .N1LJf g.|nHSNXO$Jo plp`p-@ n&h# $-j Jg JopnB/.NXOBJfJg9 fpg.N JgNKzJfJgJf-y (p-y lBhp g At# (HntN B(XOJf\p g Jfp`p. 4gp`p# 8S 0# ` B/*NXOJgJ g . /* `B `.N6&@`HnN ELXO-@B/*NHXOHnN ELXO-@ .. PNK>p ./<xnNvXOp ./.N$XOp ./<xtNvXO .-@ .Ѯp ./.N$XOp ./<xzNvXO .-@ .Ѯp ./.N$`f-j nf nHH"|.1HHrP€f.t/.N0XO p./9 /.N ,XPO&@Jg k.N`p.N'@ k!j k &By 2JfzJor  4g ./.N y A.N ; @-Hgl n-HJf./.N>XO`Lp# 8S 0B/.NJXO`4-R`n n(g nA .N_l(@` nI n(f.HSN /xXOJf.HSNXOJ   g./*NXO` n-PJf g$j g`t nRHH-@gp0op9lJg-n`.N =(S-@Jm .m-n ..HSN 'XOp gXL`(n./*N XOJ 4l R 4gp`p# 8`NVH $n&n g HHrHHgpL N^NuJfp`p`NV9 gR. PNK>. /<wNQXO. /.p/N/tPO y Sm y "hRp N^Nu. p /N HXO`NqNVH BB J f 9 gp`p@ N#  @E J gvB "p1L``9 gH9 g> y Sm y "hRp `. p /N HXON:N` Sn t L N^NuSm kR@H`.NTv$pg JfLJg. jX/NJVXOJft `( + f.J f BHSN @XOB/9 /< "N >PO` +P g`lNVH$.J gFJy lg>Jy lg@. HxT/NBPOrf(p g. /< N0XOLN^NuBy l`NVH$. y lg. PNK> y lg0. HxT/N MPOrg 9 f pLN^Nu | "| """"2y3  .p)/p(/HRNO $@|"BNB  )g" y A # .wtN N+S.N2pL N^NuB`" #f@N  gJfHH# BNHfHH"|.(1g` ~f-JJ fp`p@f^HH"|.(1HHr.€gBfHH"|.(1gBNfHH@#  g 3  dx`NVH. $y  _f B y "  mNp$pg J.g`B.9 )HHg&9 (HHgp l p gp fp~o&S n 9 nR n" 9 rB2`9 (HHft`69 )HHft`$9 *HHf 9 r9 ,HHft r"b^@0; NJ#NP:NtNNNJ"JJN:NFN.NB-y npc.HRHnN BPO9 ,HHB29 ,HH# n.rXHRN EXOp.Np.Np.Nъ# npc.HnHRN BPO`2HHrf`x q +`*x.Np&pf9 +HH ro  u +9 +HH̒# LN^NuNVH$n`.NHHJfLN^NuNVH $nBv`փ ր r0րp-@p.Np$p0mp9oJg.`-B rCgnr*g n>rgnr f q +`. r/< nHRNPOJl`r.grfnp.Nъ09 jH29 dHRL N^Nup.Nъ09 dH`rfgnr_g8rbgrdf$9 n`RJ2(g2(HH.NJg` 9 r n d q + 9 nA.HnN FXO-y 4` 9 nR n"HRR r nJfHn 9 nAHPN FPOp q +# n`VN̒.Nh`xٹ r&9 rm r.Nъp.N `&9 r` S8S nlp\f| 9 nR n"p`x. N P,* й rn q +&9 r` Ѓ8S nl-y ` 9 nR n" nRHHJfp.N 8.N P,# r`x`Jfx 9 n9 ,HHo 9 n9 ,HH( y AH-HSB SJgH 9 n9 ,HHo4S nS r nS"9 n&9 n R8gR`p.N  q +x`9 +HH ro  u +x9 +HH .N@`prhg rpgBrfL$9 n9 ,HHoS9 ,HHo@2(HH.NJg`*p.Nъp`|_ @B..NJg|B/9 HnN ,XPO(@ g`.N ;(@ gP&y t`  gR l Jg  fB  g  fHH.Nъp.Nъ`|.Nъp.Nъp\.Nъ `RJ2(g2(HH.NJfpfgjpCfp`  ngp.Nъ  n`p.NHp`S9 ,HHo S2HH.NnJfpbf # n`Jp.Nъ 9 n`PNVH $y y qpc.HRHnN BPO9 ,HHngx9 +HH no9 +HH n(p` 9 n9 +HH(p.`|Jfx q +-y SJgL 9 r9 ,HHo8 9 n rl* nR"S r&9 n R8gR` nB`Jfx SJg 9 r nopf* 9 n2HHpampznpր 9 n"R n`p.Np$&9 n J2gR n 9 n rmV9 ,HH# n 9 nlN2HHrg>R n`Jfx 9 n9 ,HHo 9 n9 ,HH( np.N `x9 f 9 r nfH 9 n9 ,HHTmS2HH 9 nSB2. HRN EXO9 ,HHT&`9 ,HHToSB28# np`rp.Nr`l9 (HHf p.NX`~p\f. R\B28# np.Np.Np$SB28 R"B28# np.Np.Np$g p gp g9 )HHfn`<.N P,$p np-@ 9 ,HHTg*9 ,HHTA./9 N FXO# `-y  . p/0y d//9 NEPO -@4.HJoB 3 d3 f0y f.0@/9 ,HH"nAHPNFPOL N^NuJl0p.NJ g y 0( H`p3 f3 j dpc.HnHRN BPO.H"9 nU 9 nU"`F 9 r"9 nRor 9 n2HH 9 n"R 9 nR"R np.`x9 ,HH` y R " y B`2BB/9 nHSHRNOA-H.N P,.N P,A-Hf-KA".$ o09 H   й m 29 H⁐# 9 ,HHl 9 -fp` 9 ,HH#  9 9 ,HHm2J f*#  y Bp .N> p# 9 CG$y 49 H`>RKRJ`8 9 ./9  /NFPOHH.N# SJg"JfB+ JfB* f`09 Hй CA"ne$ 9 9 ,HHo|*`"|>` 9 9 ,HHo|<.9 gR 9 ./9 0y /N~PO.HH.N 09 HR"y A# A".𒈒 $ 9 ./9 /N P"y 1f$ S"y 1@H"|.(1f y 08f y r08 |.0HHpXf< S"y 1f* S"y 1@H"|.1HHrX€ff y 08fX y r08 |.0HHpXg8 S"y 1f$ S"y 1@H"H1HHrX€fS y 08f& y r08 |.(0g 09 Hl y 08fh y r08 |.0HHpXgF y 08f y r08 |.0HHpXgz09 HmlS`S y 08f y r08 |.0HHpXf6 y 08f y r08 |.(0O y A(#  `NVH $.&.oDJ g Ѐo` p.NtSn`&p .Ndv` R"n 1HH.NJnL N^NuNqNVHHA# pN./.NXO9 f.N8rgHnNN ELXO-@bB9 ./. /.N EPO&HnNN ELXO-@^brlp`p#  n tHJm9 *HHf&.Nh9 *HHfv LN^NuJfx` S n 08  fx  g9 *f S"n B1`Lx R"n B1`p rg4J f nf$p.NRN 9 zR.BNXON̒  f8p./<  y ( HH/N Q POR r y r i N`0.Nrf*.NhR r y r R r` 9 -f@B v y BN$ f 9 r"y 1g p.Nr`p.Nh`p.N^` y B. .N B(-@fg, y B.Nh .frgrfp`jBy 9 f 9XO$@ # rp`N.NrgDJfb y Bp.0y d//9 NFPO. N P,S# roDB n`Jp./<  y ( HH/N Q PO y f p.N`NV`p# n`NFp.N @`"p./<  y ( HH/N Q PO3 `NVH $.  v&gJo./9 v`jL N^Nu D&J9 -g2 9 v"y 萑9 ,HHЁ‶n` y R  SJf`N  "y 萑. I/N 8XO# v`NVH $. 9 n29 Hl,p./<  y ( HH/N Q POL N^NuJo 9 n"y ES nЂ r"y 1fp`p.NJy g8R r y r p./<  y ( HH/N Q PO.NhR rm 9 r`p`NVH 9 r29 bHlj 9 z29 bHlVp g 9 n rf*R r$9 r` S"y 1(S nnR n y n LN^NuNVH $. &9 n`pBf y 08f y r08 |.(0fB S"y 1f0 S"y 1@H"|.(1g09 HoS y 08f y r08 |.(0g|09 Hl`l y 08f y r08 |.(0f6 S ro 9 r n$ rJ f$2(vHB2(./9 N FXO (A(.HRN FXO`NVp rgJfN~B nBy p. 9 rR/NXOp.N jp# nB vP +# zp# r y !@ y B y B y B y !| y B y BN^NuNVH$.p ng.N&9 n.Nrf"./< N BPXO @ g pLN^Nu(9 np f@o<`So4 S"y 1f" S"y 1@H"|.(1fƸ rf@plg: S"y 1f( S"y 1@H"|.1HHrX€f./< N BPXO @ g   RfRo # n` (. /NpXOp`NVH $. &9 n`L y 08f y r08 |.(0f rnR y 08f" y r08 |.(0g ropEg y 08fd y r08 |.0HHpXgB y 08f y r08 |.0HHpXgr rnhR`R y 08f y r08 |.0HHpXf2 y 08f y r08 |.(0f ro09 HoS .SJf# nL N^NuR y 08f y r08 |.(0f rn`NVH $.&9 n SJguNVH< y (&9 nm@ y rg2f6 y 0 8e 0~8b y r nr~ l Bt&`.p-@ y $(&( y 0 8e 0~8cRR 9 rR"y B1.//9 n/9 /9 NO-@. N P,$SlB z`# zpӰg .䰄m29 H҄m*.N .29 H⁐(lx y # v y 踨fH ."Hm` 9 z29 H҄l y rp f09 HS3 HHL N^NuNVH$.3 pfT`p.Np&./N2XOp.N`.9 *HHfv`"9 )HHfv`9 (HHfv rg@nrgrg.rfp nfBy pشgN LN^Nu 9 n"y 1\fp.p/NXO.9 )`dpشf J nfBy p.p/NpXO`p.p/N^XO`D 9 n"y 1\f p.p/N8XO.9 (HH/` pشfp# np.p$/N `BN`r g$rgPrfpشf&p./<  y ( HH/N Q PO`N(p縀gpg$` 9 n2g( 9 nR"y 1 e 9 nR 1~cPp.p/N`XOp.HH/N8XOp f 9 n rlR np.NL N^Nu 9 n"y  9 v"y  y 8 y R p fR n y nR v` y R  y HH!A N̒`rNVH y f,p./<  y ( HH/N Q POLN^Nu. HnN FXO49 HNHn/9 N FPO# nHnN P,XOS# r y !|`NVH 9 n29 HR$o(. y HP/9 N BPO y B0(LN^NuNV 9 rR"y B9 Ho@S"y 1f0 9 nS"y 1@H"|.(1g p.p`>(9 npb.p/NXOp.  nR/N$XO` ./NXOp.Nz 9 r29 bHl 9 z29 bHm2 9 r"y 1\gR r I r\p.N(`p.Np&pfl`FNVH|$.z| rTgnr0g"n0rgrr gr$gr,g6`Px`8(9 r`.r;grBgrEgtrFg`9 HH @Fg @Tg @fg @tfp;`p,f~,9 rz`rrfgJnrWgr^g6rbgrref(9 n.0y /NFXO 9 nf`891. /9 N FXO3 p N^NuNVH. /g ?f^p.Np.HH/N(XOp.N3 p.NBy 9 rR"y B1 /fp`p# p nf pLN^NuJ ngHHrrNf p.N. y HhN FXO Nf 9 D&`&9 pf09 dy jm09 hR@3 d89 dH.p/0y d/ y HhNEPO -@3 dm y A./9 N FXOp`. 3 dp` NVHp ngnB y "Hfb 9 noT y (R$ (R&`> y 08xHp mp~o.p f&  H y 0Hfh y r0H |.(0gL rlBR`(9 n.0y /N`rhg:rlglrtgrwf(9 n.0y /N`XO nf`(9 n09 Ho09 H09 Hl89 H`(9 n rl09 H؀ ro(9 r`,9 rz  p.Np +(9 n69 H SJg2؅. N Mаn y 0H9 +f. N Mаo`(9 HHrrTf# npL|N^Nup`NVH$y ` y R JfLN^NuNVH $.&. ` R"y 1"y R  SJfL N^NPr$S`LN^Nut& ro`R nf8-B ."y 谑m09 HБ".m y Bp.N`RR`.NN̒ y !y v y !y n y "y p#@ `\NVH$.J g p"y rFgprTf y r;!A`tp`Np ng~09 pR@3 9 vR.NN̒`XBN`N rEg reftw`tWp./NXOrgppc g09 pR@3 ` t$`$J g y $(`p.Np.N$ y !Bpdf BN`\B/N:XOrf LN^Nu 9 n rl0R n`& y    Jgp ngS n y Jgps g pc gNpR fp`p-@ v` $y ` p./N"XOHHJfR09 Hm`pR gJNdp ng 9 nS n3 p`,J g y $(` p.Np$ y !BNB`tc`Np.0y /NXOJ gptp3 `p ngN 9 n"y 1tHf |.0(g p_gp Ђ`f |.0(g r $p./N&XO`r_gnrIgnhr*grAgrCgLrDg`p ngN"&9 rR r. r/< n/9 NPOJg6# rp.&J %ft.Nv(@ g&$,9 g D$. /N MXO&` vp# Jl. PNK>. /<vNQXO %f8-|v`6.N =($f 0g.v/< N0XO`-|vp:.HSNvXOp f-|vp ./.NvXOv L N^NuNVH$.$y (`*p* r(r gp* f J LN^Nu$R fґ`NVH $y (&y t f6 L N^Nup* r(r gR.HR/NPOJg`$R fԕ J`NVH $n JgRJoLB/*/.N >PO&n`B nSm n"hR@H` .NTv$HHg pL /<  y ( HH/N Q POp.Np`S nS r y !|`BNJ9 f3 0y .HnNGXO$@v p./NXOHHJfp`H# r nNp rAfT`J09 H# nNp rIftP `p ng 9 nS n3 N`t$`xrPgrRgnrSgrXfth`rpgn\ragfrcgrdg@rigt`XJ g y $(`p.Np.N*$ y !Bpcf`rrgrsgJrxgr~ghp`(tl`NVH$y (t9 f LN^Nu9 :R9 :Jf(J (g J9 g.N^NuRKJfp`NVH $y (t` &R.N$K fB (By "By ` | ,B0(SlL N^NuNVH.N($@ g.* * @HLN^Nup`NVH$y ((y Jg` *g * (f&J$R f$y $ g# $` p&.N$@ fB/<rN0XORy Ry " g $&k `$ (N@ # (%n| %y ( g$0,HSr29 ЀC01HЬ`p%@Bj y "m BBNNXO J LN^Nu`NVH$.f LN^Nu$y (` *g$R f J`NVH<$.BBp-@ܕʴ /<vhNQXOp`p`NVH$n. . N$@ g p* -@$y (`(R* f. g * gp* -@p ./.NXOt * "y () ft+`L< N^Nup* ft-B y Sm y "hR `. r/N HXO y Sm y "hRp `. p /N HXOB. gp* .gLJgHJ g.N$@p f gB `.Nn$@J g g:* f0p* -@J f9 g g.NNKz` J g`9 .N$@f9 g .@H.HRNXO gdSy  f B B g 9 f4.N @-Hg&Jgf9 g.N n$(`fp(9 g.N .&@'j(p@&BBN 10XO-@'@ n!J7j$K-j nRP0r2-A nr2( .谁c./N 10XO-@%@ ."nC-qg.g p.N0 ."nC#LN^NuI$T`(`NVH  n$E f*g$Rg gJLN^NuNVH $nG*gf*g.HRN )XO&@*g&S*g. S hNL N^NuJf p.N& S Jjf5y `p ./. N ;4XO.HRN 'XO`NqNVH $nHHp e>p~b8f |.(08HHr€f$`:f |.08HHrX€f pL N^Nu B@H@rh"ҁ$RHHJf `NVH&n$K(J` /f `RJ /gRLf$KJgl /f .fIR /fRJ`6 .f(R /gJfBp/.HSN EpXO(@ f(K`JfBJg.HlN FXO$L`$K`RJJf "/fBJf/B+LN^NuNVHg.`&R g.N.NL N^NuNqNVH $n&n `*fHH"|.1g  `RJRKJfBL N^NuNqNV# T# X. /.NXOp# X# TN^NuNVH 9 T@&t` "HC$q`  Xfr*gT&j gVp0-@p-@6 .r2+b>6 .CJg. nNp0-@R`pfJg. nN$j fzR n 0(HmVL N^NuNqNVH$n `./.N 5 XO$R fLN^NuNVH$n `./.HR/.N 4O $R fLN^NuNqNVHB$n g   ` .HH0-@f .LN^NuNqNVH .N P,$ nE(`SJg " g g. o2 nB0(&n KA( $H n b`L N^Nu . "nGBJfc< ` JSJ SJf nf nHH"|.1f| c.`NVH $n ~g L N^NuHHJg`p/gXp-gp+fX*HHJgp/fF +f y AZ.N ; @` y AV.N ; @-Hf y Al`p/.HRN EpXO&@ gB.N$@ g/ J`TNVH &nBp-@.N P,rlL. \HSN BlXOJf | p m 9 (N M09# (H@H@HN^NuNVH $n* HHJg* g .N* %n f pld * l "| , q%HA`` "| , q%HA&H* HHr"| #%jBL N^Nu * l. "| A%HA&H* HH"| P#` "| A%HA&H* HHr"| #` * l* HH"| P`* HHr"| A"jC .N MJg< `2NVp.N BN^NuNq0<'N@Nu0<N@Nu0<N@dN Q4BNuNq o HBNu o /fpL.NuNq o"/g JL N^Nu.  B/< N EPO/NKXO$@ f`HnHRN @PO`p:fJf&| pSm jR@H`.NTv$pgXp gPp:fSfSm jR@H`.NTv$pgp:gp g  e`VB./< \N FXO-| p`6Sm jR@H`.NTv$pgp f&npfBHRN @XO.N G( n`Sm jR@H`.NTv$pgp:gHHf`NVH$nG*g$(S TgNp0C 1r @G g(*g&S*gB*gHJgD.N`:LN^NuBT`.NfB @Nu NuNq o"ofBNuJgg H!HAHNuHHDNu o"o / o2SWg g `BQg g` / @Nu0<;N@N Q40<N@dN Q4JAgBNuNqNVH$. Smp op#  | LN^Nu "| P-q  gJ f". /NpXO-@ "| P# `2 "| P#  Ѐ"ЀЁ"| CA./N,XO-@ g JgJl-n n`^0<0N@dN Q4NuNqN$NNNN NNNNN N N N N NNNNNNRT0lc.NBB`*fJfB*fBj`NqNVH $n&n `0f$HH"|.1g _g  `RJRKJfBL N^NuNVHJm .` .D$. /NXO$@Jl<- J LN^NuNVH $. &.$| pmpDbB`". N F@Ѐ"|/(1. N PH& cJfJf<0p gD<#p . N N4Ѐ"|/(1p . N N$gp . N N4Ѐ"|/(1 J L N^NuNVH$nG*gV Sr2-A jr2( .c.u/N"XO/N0XO ."SC(q gP r @GNNNNNNNNN|NvNpNjNd N^!NX"NR#NL$NF%N@&N:'N4(N.)N(*N"+N,N-N.N /N0H o<0H/ | P PNXLXDNuNq0< N@dN Q4NuNq0<+N@dN Q4Nu0<!N@dN Q4NuNqNVH $n.f&JJf K L N^NuNq0<N@dN Q4NuNq0<N@dN Q4NuNq0<N@dN Q4NuNq0<N@dN Q4BNu o"oJWfSWf / @NuNq o"opWf / @NuNq0<?N@dN Q4NuNV//$".`NV// .$*gJg&S*g*g S LN^Nu*g S PN-@`Jf` S-P @ g0j./.N ;4`0j./.N :XO @`0< N@dN Q4BNu0<N@dN Q4BNu0<)N@dN Q4NuNq0<N@ NuNqNVH $nt&HH @ gR @ gJ @+g$ @-g` Ѐ"ЁHHЁr0$`RRJ 0m 9oJg DL N^NuRJ` `Nq0<N@ NuNq0< N@dN Q4BNu0<N@dN Q4NuNq0<"N@dN Q4NuNqNVH $nJ oJn pL N^Nu. .N M$Jn0.NTvrf Ю S. N PH". `SRd `". f lB@H@0B@H@`4& l//N PPlD&$N^Nu0<N@dN Q4Nu0<*N@dN Q4 o BNuNV# (N^NuNV.ANd jR.   f^.N rf LN^Nu. @H`* HHrrf>n p.Hn* HH/N Q POrf. @H` `* HHrrf"Jg jfJf* HHrD€f .NPJfJ`pfD* HHrD€f.NDSm jR. `.p. /NXO* gp`. @H`NVH$n&j *$%K* HHrD€gp`8 * l* HH"| P`* HHr"|  q $ * l* HH"| P`* HHr"|  q(HJlp` " l.NJo,.HS* HH/N Q PO   g pLN^Nup`NVH $n* HHrrg** HH@f pL N^Nu* @ Jf.N jf* HHrD€f * l* HH"| P`* HHr"|  q $ * l* HH"| P`* HHr"|  q&HJlp` " l.Nhp`2NVH $n* HHplN * l "| , q` "| , q%HA&H* HHr"| #`.N @%HgV * l"* HH"| PA"jC `* HHr"| A"jC `d * l* "| A`-n.w xnvtsierkufamhc@ @@icrnewline or ; X/tmp/shxxxxxx.aaa/.r*@0 @  a+a+rwrw+rww+w+"$@"w+pwd=print - $PWDrsh..r/* @T @D*vi*macsIFSread w+rarletsetcooked failedshelledit* ^R ;,TtFf;eEft$%-%-;kill/etc/passwdr@(#) ksh:ksh.sl 1.9     %HA&H* HH"| P`, "| A%HA&H* HHr"| #%j.N MJg* f L N^NuNVH$n * l* HH"| P`* HHr"|  q $l@ * l* HH"| P`* HHr"|  q%HLN^Nul$`0<N@dN Q4BNu0<N@NuNVHnHxT/.N MO JlpN^Nup`0<6N@dN Q4Nu0<%N@dN Q4BNuNVH8B$lDF&.l$DF`NVH8B$.lDF&. lDFB02HBHC҂HABAЁJlDLN^NuNqNVH8BJlDF$".l"D`NVH8B  L .lDF$". lF lB@H@0B@H@`,& l//N PPlDJlDLN^NuNqNVH<zJlDD&".l&DD` NVH<z .lDD&". lDD( lB@H@40H@0H@`* l$//N PPlS JlDL>??CFpFpFpFpIIIRRRRRRRRRRRRRRR[[[[[[abeled Function Keys F1 \EOc F2 \EOd F3 \EOe F4 \EOf F5 \EOg F6 \EOh F7 \EOi F8 \EOj # Screen Labeled Function Keys - Shifted s-F1 \EOC s-F2 \EOD s-F3 \EOE s-F4 \EOF s-F5 \EOG s-F6 \EOH s-F7 \EOI s-F8 \EOJ # Left Keypad Function Keys ClearLine \EOa Creat \EOn Undo \EOs Find \EOx Move \ENc Dlete \ENe Mark \ENi Ref \EOb Save \EOo Redo \EOt Rplac \EOy Copy \ENd DleteChar \ENf InputMode \ENj # Left Keypad Function Keys - Shifted s-ClearLine \EOA s-Creat \EON s-Undo \EOS s-Find \EOX[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[aag.g.kVkVkVkVkVkVkVxxxxxx((((((xxxx߆߆߆߆߆߆߆߆߆߆pb_openpb_checkpb_namepb_emptypb_putspb_weofpb_seek s-Move \ENC s-Dlete \ENE Slect \ENI Rstrt \EOB s-Save \EOO s-Redo \EOT s-Rplac \EOY s-Copy \END s-DleteChar \ENF s-InputMode \ENJ # Right Keypad Function Keys Exit \EOk Suspd \EOp Cmd \EOu Print \EOz Beg \E9 Prev \ENg Back \E[D Msg \EOl Rsume \EOq Open \EOv Rfrsh \ENa Home \E[H Up \E[A Down \E[B Help \EOm Opts \EOr Cancl \EOw Page \E[U End \E0 Next \ENh Forward \E[C # Right Keypad Function Keys - Shifted s-Exit \EOK s-Suspd \EOP s-Cmd \EOU s-Print \EOZ s-Beg \ENB s-Prev \_adf_skptxtadf_gtwrdadf_gttokpb_getsadf_gtxcdpb_gbuf_adf_rtbl_adf_rtxt_adf_rnum_chkpbfull_adf_rsnmmessage_domsg_mwcr_scexhelpttypetacteprintf_doeprwiconwicofffmouseinsert_modef_begxf_begyfl_targetf_n_targetsf_targetsform_pageformform_2fieldfleftfdownfupfrightflmenudisp_insmmousetams2termtarget_winkstateokstatemi_targetm_n_targetsm_targetss2drawnsig_catmenumbeginminputmendmcitemsmshapemctitlemdisplaymmatchmscrollmtitlemtrunctracktkboundwdevwhiENG s-Back \E[\040@ s-Msg \EOL s-Rsume \EOQ Close \EOV Clear \E[J s-Home \ENM RollUp \E[T RollDn \E[S s-Help \EOM s-Opts \EOR s-Cancl \EOW s-Page \E[V s-End \ENN s-Next \ENH s-Forward \E[\040A # 3270 PF Keys PF1 \EPa PF2 \EPb PF3 \EPc PF4 \EPd PF5 \EPe PF6 \EPf PF7 \EPg PF8 \EPh PF9 \EPi PF10 \EPj PF11 \EPk PF12 \EPl 0707070000020051570407550000000001440000020526020421111017200000400000000000tam0707070000020032431006440000000001440000010525770420437162600001100000000014tam/NameTatryrowtrycollinescolswinmapwinddo_w_newreaddevwsigflagwsigcatchwsigintrwrastoppatblackpatwhitepatgraypatltgrayanulaerrorabellabacksahtalfaindacrasoasiescdispanelariass2csidispaichacuuacudacufacubacnlacplachaacupaedaelailadladchasuasdavpaaichsmaichrmasgratargetctdispactvisactsuactsdactsgrawrapansifinalspecialaslkinvalidainscheracheralinapngetpsrelcsrabscsradelchscrollollistwfrontwbacklayeroprlayeropreccliplexposeldeleteoldeqolenm Library 0707070000020173311006440000020000020000010525760420437164700001500000370476tam/libtam.a! / 570232085 0 0 0 3558 ` G******************)))))EEEEJ&J&LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL خ qldeqlenqflcreateolfreeaddobsaddpiecelenqbolalloclongnamemvcurplodputplodsetattrwrefreshflushtargetwprefreshwdeltargetremovetargetlinerefreshlabelflushnflushnrefreshmvnoisenlinerefreshtouchwintouchrecn_targetstargetsfreewinmakewinwborderwclearwfillwlabelspacewcleartmapstdopenwcreatesetrecinitscrnlnonlcbreaknocbreakechonoechoinchgetchflushinpattronattroffattrsetsavettyresettywindowphyscrb_onb_offwncuraspacemouseflgtbtflgtwbflgw_targetslk_onttyt   ypeAMBSCANCslkshortALBCBEBOCDCECICLCMCVDEDLDSEEFEFLHOKMLLNDSESOTETIUEUPUSVEVSXEXSPCSGLINESCOLStam_slk_offsetwdeletewcopyolwprexecwpostwaitxlatflagwgetckeypadkcodemapkeyinitparselineatoonullmousewinitiswindwsetbufwexitendwinwtargetondecdigofs_loofs_hiwgotowgetposwinstrwgetmousewsetmousewreadmousewnlwndelaywslkslkcolslkhilitewcmdwpromptwknoisewtnoisewlabelwuserwguserwnmapwpmapphysopphysclr_puts_curoff_curon_putcharwprintf"y~ RNJg`HnXN@XO-@RgNJf 9"y~ R .mB 9"y~ RN\JfHnXHRNPO$@J.Xg`NVTH$n`RJ  g  g  gJf.pP/HnNPO$@ g,B.[J.[f"Jf(.pP/HnNPO$@ fXLN^Nu \fRJ \f 9R"y~`&  fRJ`Hn\HRNlPO$@. Hn\NXOrb@0; NJ @\x 9R"y~ ` 9R"y~ `h 9Rprintwwputswputcwselectwgetselwsavewrestorewgetstatwsetstatfixtermresettermgettermsettermendtvsettybaudratenlttygetcapzappbf.o/ 567179235 0 0 100644 6827 ` R!wL6.text  .data  ,b1@.bss||4NVN-@Jg:.Hx/.NPO-@rf"p./.NXO-@rf N^Nu./.NXO|./.NXO @`NV.p/p/HnNO -@.N"y~-`L 9R"y~(`2 9R"y~)` 9R"y~/NrJgz`NVXH$n  g  g  fRJ`E`.pP/HnNPO$@ gDHn\HnNPO$@. Hn\NLXOrbz@0; NJLN^NuB`THn\HRNRPO$@Hn\NJXOJf.yHn\NXOJf 9R"y~ N~JfJf`6NVH$nB 0m 9o +g -f4.N-@$ SJo 9R"y~NJg .LN^NuNV 9m6Jf`BpN^Nu.p./<HnNPOJgJfpN^Nup`NV.N./<$NXO.NN^NuNVHNJg |+ LN^Nu.RJ \g  fRJ`.Hn\HRNPO$@. Hn\NXOrf |W`RJJ.Wf Jf`| .XLN^NuNVH $. J9|g".BHx/<NPO #$y&nSm Jg  fB#f L N^Nu` n`NVL#~B# ##|J.g.            TEXTPAGEPARAGRAPHINTFLOATTIMESCHEMATUPLETABLEDEFTABLEADFVERSIONAPPLICATIONEOF}INDCENRBHSOHHHHIBBEBPNEOPHPBFEFRSEOTULWUDUUSBLBSMIMISMDMDSSUPSPSSUBSBSJUFORMATTEXT}r+EMPTY EMPTY /usr/tmp/paste.w/usr/tmp/paste.ADF VERSION 1.0 TEXT \ \EOT\ EOF %d %d\ :^hnpP/HnNPO @-HZgHn_HnN .VZ-@HJ fSHJ gp`p..MHH//.HN PO-@DJm$./.DNXOB@`LBR//.DNPO./.DNXOp). .@NCZA./.DNXOR@ .@Vm .VT-@@B//.DNPO./.DNXOB .@R//.DNPOJ g4.` .VZ-@HJ fSHJ gp`p..MHH//  H V' t  5    @* T Z `         5                 ( 0 8 @ H .HN |PO-@DJm .&/.DNXOB@`LBR//.DNPO.,/.DNXOp). .@NCZA./.DNXOR@ .@Vm .VT-@@B//.DNPO.//.DNXOB .@R//.DNPOJ g0.L/.DNXO` .V\-@HJ fSHJ gp`p..MHH//.HN lPO-@DJm.k/.DNXOB@`LBR//.DNPO.q/.DNXOp). .@NCZA./.DNXOR@ .@Vm .VT-@@B//.DNPO.t/.DNXOB .@R//.DNPO./.DNXOB .@T//.DNPOJP X ` h p x                     0 8.filegpbf.c.text .data 1.bss|4|_pbuf~_pbcount_pbsize_pbstore_ g.` .VT-@HJ gp`p..MHH//.HN JPO-@DJmB@`LBR//.DNPO./.DNXOp). .@NCZA./.DNXOR@ .@Vm .VT-@@T`: .V\-@HJ fSHJ gp`p..MHH//.HNPO-@DJm@./.DNXOB@`LBR//.DNPO./.DNXOp). .@NCZA./.DNXOR@ .@Vm .VT-@@B//.DNPO./.DNXOB .@R//.DNPO./.DNXOB .@T//.DNPOJ g./.DNXO .@X-@`4 .VX-@HJpbfile  " , 0pb_openpb_checkpb_nameopenchmodfdopenpb_emptyfreadrewindstrncmpfputsfclosepb_putspiswindstrcpyttynamestrcatpb_weoffputcpb_seekH6fgetsB L fSHJ gp`p..MHH//.HN\PO-@DJl pL N^NuHnZ/.DNPOp-@@`JB//.DNPO.(/.DNXOp). .@NCZA./.DNXOR@ .@Vm .VR-@@B//.DNPO.+/.DNXOB .@R//.DNPOJ g .H` .@V`rb@0; NJJygHnt/.DNPO0.tH2.xHЁ-@-@-@0.vH^-@0.vHrЁ-@0.vHrЁ-@.gHnNXOJ g.wHnNXOp.0.xHU//.DNPOHn/.DNPO.DN././</.DNO ./ strlenfseekpb_getsV fpb_gbufp`jDt sscanf~ ~ strcmp_pb_first_pbadf_kw_pbtxt_kw_pbnum_kw_pbtbl_kw_adf_skptxtadf_gtwrdadf_gttokadf_gtxcd_adf_rtbl_adf_rtxt_adf_rnum_chkpbfull_adf_rsnm message.o/ 567179280 0 0 100644 7314 ` R!x1.text .data./</.DNO J g././</.DNO J gp`p-@NJgBHn$HxW /.DNO AC$ 0|$Hn$HxW /.DNO B..p/NXO @-Hf.p/NXO|`.p/NXO|`R.@N`vpDg8p-@<`p./.DNXO`pfB.`p./.DNXOB`NJgHnHxW /.DNO J.g.p/NXO.DNp   ,V ^h~    0Z bl   ,@j r|   $.tams2termwdeltargetwreadmousewpostwaiteprintf.o/ 567179293 0 0 100644 1034 ` R!x.text .datah` @.bssppNVH-|A-H-H||PA-HHn//.NO $ nBHn/./. /.NOLN^NuNVp./<PNXO-@JlpN^Nu.Jf |n` nHP . "| /1 ."|/1/<[HnNO.Hn/.NP    O.Np`Nq8:<>@BDFHJLNMCOSLPDENCOL/dev/error:%s:%s:%.8s:%.238s> z   $(,04.filegeprintf.c.text .datah .bsspttypetact"fJ.g.p/NXOp`2pf"0y"4.0y"2//. HRNO `Jyg yE"2l3E"2Bn#"" `>&j`0+Hnf y" 0G" GJfRn0.no y" B&j#"" `$ y" &&&&&6GG" JfB#"" &j`2+HHn y" 0G" GJf y" Bpѹ" #" "&j`B+HHo0 y" 0G y" .R(" GJf y" B#"$"0.f4J"(g,J",g$%y"(%y",` p./* NX eprintf_doeprp_doprntopensprintfwriteclosewicon.o/ 567179303 0 0 100644 654 ` R!x' .text  .data  @.bss  NVH$nBBB*HH/*HH/ . "ЀЁ*HHЁ/ ."Ё*HHЁ/BBBB*HHSRЀ/Hj /.NO4LN^NuNVH$n.Bp/*HH/O` y"%H%H0y"4.0y"2//. HRNO -@ f j"g f j"g g fJ mJg2BBp//*/* NO j.N.NJyg . N0y"4.0y"2/p/HRNO .!"/* NXO f y"` f y"%H%H0y"4.0y"2/p/HRNO Jmp`p-@g p-@ `pl#"(#",&y"$#"" `&&&&&6GG" y" Jf" Jg y" . /+ NXOG`%y"$ 9","(r.Nr*HH/ . "ЀЁ*HHЁ/ ."Ё*HHЁ/BBBBBB/.NO4LN^Nuz   .filegwicon.c.text .data .bss wiconwicoffwrastoppatblackform.o/ 567179394 0 0 100644 13343 ` R!x/9.text "Q .data !@.bss".N"y"$A%Hy"0.gJ"g ."N.gPJ mJJg2BBp//*/* NO j.N.N*f . NJ9g.!./* NXOJ.g.p/NXO .`NVH$nBp-@p g 2Bn&j`GRnJf0.HU#"60.HYJjDD`#":.gBy *gr-j .NBHn/.NPOJm=|0*gn*g0.nf 0.ng` xSn` p*g=|`*g=|`Bnp0-@*g*gpB"(NVH $nBp l(. /< BBp/NOpL N^NuB..p/NXO @-Hf.p/NXO|`.p/NXO. N-@J9g\. /NXOJgB. /.NXOJg,. /.NXOJg. /.NXOJfp`p3p#p g*By"23"2"4Bn&j`dJ+mJ+mJ+mJ+m+H+HA=@y"2o3"2+Hy"4o +H3"4GRnJf09"4HJjDD`-@-@09H"ЀЁX@y"2Jyg"4 ./.0n/0n/0n/NO-@%@ B`-j Jlp`Hn/.NPOJl$J.g.p/NXOpLN^Nu0.H#0.H#Jg.gp./.NXO=|`p ./.NXORn0.no.N2.HJjDD`.p//.NPO.!4/.NXO./.NXO.!;/.NXOJg.g./.NXO.gJygHp./9"6/.NPO.!@/.NXOpld.!p/.NXO`N.":/9"6/.NPO.!/.NXO.!/.NXO.!/.NXЀ-@Vy"4VJg Ty"4TTy"4TJyg y2"2l32"2Jg .N29"2Ho p-@`9HHgpK` 09HW29"2Ho.9HHgpK` 09HW.0y"2//< `9HHgp` 09H]29"4Ho>Jyg"9HHgp` 09H]".oT9HHgp` 09H].09Hg .`09"4H//< BBp/NOp`9HHgp` 09H]29"4H. N#9HHgp` 09H]. 9N29"4HlR3"40.Hr Ёr./NXO.N @#"O-jf&p".N @-H"gT%n n nB( nB( nB nB0.HT.N @"n#H nJfJ.g.p/NXOp`0.HR"n"iBq0.H"n"i3"<0.H"n"i3"80.H"n"i30.H"n"i30.H"n"iB0.H"n"i# .f J9fJ9g.!/.NXO&j`Jfp`p$+HHT.+HH29HR/NXOЂ//.NPO./.NXO+g k hv./+ NXOJyg+HH29HR.NR-@J   gT P@=@H"ЀЁ"|A"9ҮT 0.H"ЀЁ"|A+HHҹV 0.H"|#GJfJ9g.!/.NXO&j`D0n./9":/9"6BBBJgp`p/HSHR/.NO$-@Jf@GJf.g.Jyg 9X#p й#pй#(p!й#4p+й#@plp3й#Lp;й`p#P#L#\#X=|`0.H"ЀЁ"|A"9ҹ"6T 0.H"ЀЁ"|Jg^0.H"ЀЁ"|JgD0.H"ЀЁ"|.0.0HR"n0RC` g g g`BJ.f~t nB0 0R@6*H@nT nB00RC` gn gJ gv`J.g./. NXO(@gB.`JBo SB|`J.gB.`J9 fp`p 0n.. n //.NPO` g gb fj.g n h0(H$fh n h0(H(mR n h0(H".(Vn:p -@`nJ.g./. NXO(@g>B.`(nl0RB`J.f> n hJg0 n h hr g n "n "i"i |`JB.|`.g-|J.f&JH"ЀЁ"|/1/<!/.NO Rn noT0.H^#=|`~0.H"ЀЁ"|Jg^0.H"ЀЁ"|JgD0.H"ЀЁ"|.0.H"ЀЁ"|/1/<!/.NO Rn0.HovJyg .N(j r.N-@0n./9":/9"6Hnp/HTHRN xPO @gp`p/Jgp`p/HTHR/.NxO$-@Jl-@`*g g g f . gNnxr g,nJgBr gr `^ g" gL g gj`4cI`0.HSr.fB.`p.gZ-|J.gB.`RJgJ j(hvJg(I Jf(hr j!Lv./* NXO|B`B.`p nRp~mH*g"J9 gB9 t nB0 Bn|J.g.N-@`J.g"t n p@H nB0 `nf4*H@lz0RB"n nB0 ./.NXO`PJ9 g,0.*HAl:R@6`0HS"n0SCBn` *H@l0RB"n`4B..N=@J.gB.J9g.!/.NXO09H"ЀЁ*HHҀT.0n//.NPOJ.fJ.f.!/.NXO.N"jI` gRnj g, g g, f.HRN `(j`.HRN DXO(@`.HRN `Jygplv` gp g6 gl fn*f8p. .N"jI`(0.HSr.N"jAdI`(j%L`0.HSr.`.HRN >`D-n .`JJnm<0.9HAm,H2.HЁrnd0.H2.HЁrKo$Sn`J.g.p/NXOp`=n=nHn/.NPOJlJ.g.p/NXOp`NVH$n-j |B n " 60H"H"i/.NXO6.`p ./.NXORC*H@mJ9gJ.f.!/.NXO09H"ЀЁ*HHҀT0HҀ.0n//.NPOJ.fT."/.NXOHnHnp/ n /(/.NO."/.NXO .LN^NuHnHnp/ n /(/.NO-@Jl." /.NXOp`JygLpf Jfp`p[fxpfn`XNVH$n j. HnNXO j hv./* NXOp-@ j-hv` gD jB(./*NXO-@pJmp g g fp f jr"iG0H'@ J.g( n f hJfJy f n h!K*HH29HR.NR@=@J.gTn*HT@67n*H7@7|B.N=@tp@@ n (@@*@Jyg" PA60H"ЀЁ"|A2.HҹT 0H"ЀЁ"|A*HHҹV 0H"ЀЁ.0H"ЀЁ"|/1/<!/.NO J.g:J.g.!/.N` ./.NXO.!/.NXOB`p-@BB`pf0p0n(p9m .Ѐ"Ё-@ .r0Ѯ`p;fpnf. hv./* NXO`Hn/* NPO j!nvp./*NXOpLN^NuNVH$n&n +HIJg",HBf L LN^Nu,HBo K`I`NVH$n&n +H f LN^NuIe,HBf L`,HBl K`I`NVH$n&n +H+H=@. N+H@=AI`,HBo L LN^NuIJf K`NVH$n&n f LN^Nu+H+H=@. N+H@=AI`,,H. N,H@80.DlnmIdI`,HBl L`Id K`rNVf p-@`rpf0p0n(p9m .Ѐ"Ё-@ .r0Ѯ`:p;fpfp`p0fpfp`p~fpfx` "ЀЁ"| 1".²f "ЀЁ"| 1".f|B.pf -|`|pf p -@`lpgpf -|`pf -|`@pf -|`0pf -|` J.f "| q"n #HBRo$B`J.g gB.` . gRnrgntrgxrgp`J.fJBo6`0HS"nA0RCno`J.f̴nl6nlB` "n 1CR. N".m. N-@`C R .2.HUoJ9 g p./<"` p./<"0.H_CAHPNPOHn/.NPON^NuNqForm - Invalid operation: %dTERMs2510510a510AForm too wide, width = %d screen max = %dForm too high, height = %d screen max = %d[=w[=0C X Enter Command Select Help Page PageBack[OK][=1C[=0C[%d;%d;1~[%d;%d;1~[%d;%d;1~Read-only protected form, cannot input     data[=1C[=0C *OT .Rhr &*lv&6<Rblx- .T``3.:x  ,6@-V`5p5x%~0 H @&z!j%$.<L\frx~  6@JTXr"0:@D+%%!&0%8d+r|%"5"%\&r&7& &$7t   D P \ t8 ,.filegform.c.text Q.data .bss"(fmouse ^t!&<z"##$%JV^djn&#F"X f_begxf_begy &0formform_2messagesignalsig_catgetenvw_targetstrcmp:strlentbtflgCOLSLINESldiv__lmul__ulmulmallocwputctrackfreeDwputs#b#t'z%   :$ L) * 0) L f  r  + !  +  % %  % 8, J V `+ h r% |  %   +  %  %  %  @  j    ( 0strcpywdeletefieldwgetstatwindwgotowlabelwprintfwrefreshfleftfdownfup:fright6wsetstatflmenu:wpromptdisp_insmenustrncpyOinsert_modefl_targetf_n_targetsf_targetsform_pagetams2termwdeltarget menu.o/ 567179506 0 0 100644 15044 ` R!x5C. :% l x + % &     0B T hpz%     $,6 <D NTZ`~ -& D^xtext(p*D' .data(p(pH(@.bss))NV./.NXON^NuNVH$nBp l(. /<(xBBp/NOpLN^NuB..p/NXO @-Hf.p/NXO|`.p/NXO.(N-@J9g\.(/NXOJgB.(/.NXOJg,.(/.NXOJg.(/.NXOJfp`p3B-jr`&.f*g n(R nJfJyg4p . .ЀR/NXO @-H"f   .(`$p. ./NXO @-H"f.(BBp/NO `-jr-jr-nB` n"n n"ni n"n!i nֱzf%nz nֱvf%nv n .( n/NXO nB( nr!A  R nJfh nB nB( nB%nr.g .N-@m .g .N-@.g.NJyg-n-jr`Z"n n"ni n"n!i nڱzf%nz nڱvf%nv   nJf%nr.N.NJ.g.p/NXO .`NV%qv *vrr .N-@t`NRo B*BHnHnp//*b/.NO$pgpf pL N^Nu *zrr .N-@ *vrr .N-@-@-n.N-@. .N-@Jyg,pfJ(pfp`p[fzp(pfn`Vp~fp(tftB(tp mXp~nRA.N-@pKo0p fJg" .RCA" .CB1.N` jrJf$ f.g.g -|`|  gn g"nrg2r g^ gb g g`d-|`xB.A.H$nNHnHRN#PO-@B9p* -@p* -@J9gJygBBJf4Jf.po -np`R .аm.B`& .".Sl .".蒮䰁l .Ѯ` yfLB.pg*.g" jbJg h-h |3 n"jbg3 yf"| jbJg h-h `|.g JfB.HnHn/./././..HH/HRN O $m B.B`p#(pBB`p(pf*p0m$p9n .Ѐ"Ё-@ r0Ѯ`p;fp(pf p#(p`p(pf*p0m$p9n .Ѐ"Ё-@ r0Ѯ`Pp;fp(pfp`p0fp(pfp`p~fp(pf#(tB(pv` "ЀЁ"| 1".f "ЀЁ"| 1".fpf $<`pghpf $<`pf $<`pf $<`pf $<`pf $<` "| q"jvft `z "|l|.g p -@`T.g -|`@.g8 .Ѐ"Ё"jrq` p~fp(tftB(tB.-B .̰g@Ѐ"Ё"jr1 .Ѐ"Ё"jr1 .Ѐ"Ё"jrA%Hv .İg@Ѐ"Ё"jr1 .Ѐ"Ё"jr1 .Ѐ"Ё"jrA%HzJ.gB*B/.NXOJ.gFJyf>B..HnHn/./././..HH/HRNO $l `JgHBnJ*g .N JgZ jv(g=|`Bn jv&jr`+gRnG JfpnlJnf jv(n .`NVH< $nBN-@B.    B.-j^Hn/.NPO0.Hff 0.Hjgp`p@0.Hjl,p* rm 0.H".\l0.\@=@|0.HU-@0.HY".T.N-@po-@0.V@=@|po-@0.\@=@|. .NlPp* roB @ HH-@p-@n 0.@=@0.\@=@n|0.Hr* ҮTl.f |0.Hfl p* ro.f |NJg*.g"0.Hr* ҮTm n|0.H&9HHgp` 09H]R2.H҃oSn|pJ.g.)d/.N`p ./.NXO+@Jg.)j/.NXO./.NXOJ.fJ.g.)o`.)t/.NXO`xJ.g.)v/.N`p ./.NXO+@Jg.)|/.NXO./.NXOJ.fJ.g.)/.NXO+RR .mJ(gHnHnp//*b/.NOR .mJ(gHnHnp//*b/.NO n n$ JygJ9ft`l "ЀЁ"|JgR "ЀЁ"|Jg< "ЀЁ"|. "ЀЁ"|/1/<)/.N0.9HAl9H=@9HHgp` 09H]9HA=@`~Sn|Jnl"Bn9HHgpK` 09HW=@0.H&9HHgpK` 09HW2.H҃nJ.gHn/.NPO|p* rf8 *zrr .N-@B *vrr .N-@B` *zrr .Nr* .N-@ *zrr .Nr* .N-@ *vrr .Nr* .N-@ *vrr .Nr* .N-@ .$mo|J.f .$pm^nVpf@JyfFB .R//.NPOp./.O RoN# .X././.NPO`&././.NPO.)/.NXO.N`NVH $n-j^pf@.)/.NXO z .Sr* .NЀ"Ё"jzG`"./<)/.NPO z&jzB`+RG .r* l . Ѐ"Ё"jrAeL N^NuNVH<$nBB.B.&jr`|kI >f |RL`B.Jg *SJ.g B.HH"|1HHr€fRMJgT.HHgg`D am zn HHr `HH( am zn HHr `HHgJf/.HRNbO p-@(`LfFJyg|`6B .R//.NPOp././.HRNO p-@(ѮJ.g<.(/.NXOB90n.HRN VXO .Sr* .N-@Jyg .T` .".jDD`≐-@ .SЮʰo .".S-@JlBJyg .gRJyg .gR .".jDD`≐-@JlB` .Юr* o p-@. .NЮЀ"Ё"jrA%Hz0.H%@f0.H%@j .Rr* ưl .R` p* -@J.fJbfp`p(J(g@Jbg:HnHnp/J.fxJ.fp .RJf jv(%Kv+*g||+.g+G JfA./*^NXO .L<N^Nu+`NVHpogԀpf* nJgp`pJjDD`"gU-n n n |R oJ.g pL ."nB1`NqMenu - Invalid operation: %dTERMs2510510a510Aerror in malloc menu_itemserror in malloc str_buf [=w X Enter Command Select Help Page PageBack X Enter Command Select Help[=1C  -[%   d;%d;1~[=0C[%dB %s:Hl" b z>J Xbx 2!X!#$%$$%$#, !3!3!!8!6""8":#"V"`;#>#5$.!$:#$R#$b$$r'$$$%$$$#$!$ %p$%%% &2?&D&&&&& '63'N'X;'l8't'|A'&' ' (($&(>B.filegmenu.c.text(p'.da#>&N&X j#$%$'$'& 2(@)$%$L#X$h%*+,$'Z#-.   ( 2 > x       j   !  0 ! ! 41 F! Pta(pH.bss)mmousekstate(pokstate(t#/s2drawnsig_catmenusignalmbeginmessagegetenvw_targetstrcmpcallocstrcpyminputmendfreewsigintrmcitems'mshape$  ^ v   & &  ,#V3| 33#:3 #  j   4 T # 6F <RZ5 ~6) !j#7X$h%$$$%$$ldiv__mctitle%lmul__tbtflgLINESstrlenCOLS9wgetstatwindwpromptwlabelwsetstatwdeletemdisplayltracklrem__mmatch"wgotomscroll!wcmdalarmiswindwputsmtitle&pmallocwprintfwputcw'$'D-j!!!1!!!1!!f |3 38 .!8   #0:#:66 f3t~;;"8getsel_ctypestrchrmtrunc(strtokstrncpyDtams2termtarget_winmi_targetm_n_targetsm_targetswdeltargettrack.o/ 567179527 0 0 100644 1923 ` R!y0.text| .data@.bssNVHNJf<.gN".f<.N-@pfLN^Nu.g n J(gJ(f BH Lj p , < J ^h!"####  .n$z %&'$).<BL.text3 .dataH@.bssXXNVH$n.=jf$ . m .~n.HH.HRNV`(0.Hrb4@0; NJ Dp .f5|%|<D5| LN^Nu.HH.HRNXO` .[f5|%|8D`.HH.HRNjXO` .=f %|4D` .;fRj 0* HЀC$Bq|0 .0m2 .9n*Rj 0* HЀC$A.HA005|`H.HH.HRNXO`2 .0m@ .9n80* HЀC$A2 00* HЀC$A)l).filegwind.c.textxn.datax.bss wdevxwhitryrowtrycollinescolswinmap winddo_w_newtbtflgLINESCOLSwncurwgetstatwcreatereaddevZwsigflag |fstatfopen.HA0P` .;f(Rj 0* @m.N0* HЀC$Bq` .pf>*7f6Jg^.N=@HS"y 1pf:7`t .pf*7gp5@ 5@"Bj`R .qf70* R@5@"Bj .Nl`,.HH.HRNXO`Jj&g j&n=|0*$HЀ"|01P@`=|0*$HЀ"|01@j&=@0.QCYA.Sj&nBn`0.HЀC$BqRn nmBjJ9fp nf X`^X`TNVH$n0* R@5@"Bj n8 .@m .~o.NJBjLN^Nu..HHr@"jwexitstrlenmallocstrcpyfcloseopenioctluldiv__closefreadstrcatstatwsigintr6signalwsigcatchwrastop.o/ 567179562 0 0 100644 566 ` R!y*L .text$ .data@.bssNVNJfpN^Nu.N-n =nD qN`NVH<$n8*J:*LA.?Bg?BgNPOJg$0*Lj er*Hfh.NN:*8*J0R@5@Lj.HjN4p0.p0r2Ѐ"jP"QG*7g"p.?Bg?BgHRNO 6L|j8B.HnNXO`NVH0.HЀ"nC$41HJg0."ni"m pLN^Nu `NVH$n0* Rj 4j"l0HЀC$01HLN^NuJBgp`p`NVH$n0*LH2.HЁ.0*JH2.HЁ/HRNPOL@.bssUUUUUUUUUUUUUUUU.filegwpattern.c.text.data.bsspatblackpatwhite patgray@`patltgrayansi.o/ 567179640 0 0 100644 11058 ` R!yw%ON^NuNVH $n4.6.A.0C/0B/NPOJf5CL5BJL N^NuNVH$n0. jejd0.Reje pLN^Nup`NVH $nA.?.Bg?.BgNPOJf0* n40.Bc=B0*np0."jTI9j  Tg0.Td8Hp0."jP&q0n0* R60n4`SCSBp0Ѐr2ҁ7nb`L N^NuSCp0Ѐ7nc`NVH|$n4.6.8.A.?Bg?BgNPOJf|0* C:Ec8jp0"jTI9j  TgTd8Hp0"jP&qR0D:0* R<`0RCr2ҁ0REH   @B@H@Ѐ7Fe`L|N^Nu0RCr2ҁ7Fd`NVH$n5|&5|LN^NuNVLH|$n0*$S@40*&S@68*( Dfb0H,p2HCDƁp2H0HЀ"ЁCGA2HAHL|N^Nu0HR.0HR//<8HnRNO HnRNXOp2H0HЀ"ЁCGA2HAFz E l0HЀ"ЁCGAJ0Pfh E f 0H,p2HFCDRE`NVN^NuNV.Nz.NN^NuNVp.B/.NPON^NuNV nHN^NuNVH$nBHRNNXOSr2n"H2)NARA1ANN^NuNVH$np.HRNXOD.p/HRNPOSr2* Ё/BHRNPOSr2* Ё/HRNnO LN^NuNVH$np.HRNXO.p/HRNPOSr2* Ё/BHRNPOSr2* Ё/HRNO LN^NuNVH|$n4.6.8.=R=j=B=CޖjjJDl0D@80H2H2Hm0B8` *Hg0D.?.Bg?.BgNPO0D:<`80H"jP&q0H(q0REH"jP#0RFH"jP#Cm6.j`0RF0@.HRNPXOCm`0H2H2Hm0B8` *Hg0D.?.Bg?.BgNPO<0D:`8SE0H.0jJ/HRNPOLN^NuNVH$nBHRNXO.0jL/0jJ/HRN@O LN^NuNVH$n.GHnNXOB`h .ЀC$ qf7 .RЀC$0q./<JHnNPOHnHnNPOSj"g.MHnNXOJj"fHnNXO-@RCh .CB1LN^NuNVH$n.OHnNXOB`h .ЀC$ qf*7 .RЀC$0q./<RHnNPOHnHnNPOSj"g.UHnNXOJj"fHnNXO-@RCl .CB1LN^NuNVH$nBHRNFX"jP&qSF0H(q0H"jP#0H"jP#Bn4.j`SF0F.HRNXOBnHnHRNPOL|N^NuNVH$n.NJgrf*HLN^NuH`NVH$n.NJgrfHLN^Nu*H`NVH$n0*N@46.N8g0Hሄ@.N~8o 0HF@@BCg 0F@jNjNLN^Nu  V >:: h  : &O.0jL/0jJ/HRNRO LN^NuNV nr2(.0hJ//.NPON^NuNV.NB/.NXOD. n?(Bg0hJ//.N\O N^NuNVH<$n8*J:*L`0HJ@g< @g @f6* `0C.HRN8XORCjep.HRNXO`p0* .0E/0D/HRN:O 0R@6`0C.HRNXORCjeJDfbJEf\p.HRNXO`J6* `0C.HRNXORCDm0HR.?*Bg0D/HRNO JDfJEfp.HRNXO.N4 Bf`.NLO=B4+0.Bd.AC =B././+ HnHRNO=B4+0.Bc.AC =B././+ HnHRNO=B.HSHn` .HS/. HR nNO L N^NuNVH<$nJg&j`@(j`2*l lf$.HRNXO.HjNDXO.HkN|XO(M f&k f  $(,.filegansi.c.text3.data.bssX.N.N&y`:(k`,0ld 0*ld0jd0,jd)J(l f&kfL<N^NuNVH<$n.N2.NB-j` n&h`v(k kff*y`(0Sf0-kf0-kf 0-kg*m f f&. nHhN@XO./<NvXO'n`'m&L f n-hJfj&y`&(k .HSNXO./<NXO.N&L f.NDL<N^NuNVH<$n-JB&y`l(k`Z*l n0ldH0(ld>0"nid20,id(./.HTHTNxO Jg.HkNNXO.N(M f&k f%y&yctrldispanul aerrorabell Vabacks >ahtalfaind:acr asoasihescdisp<anel &ariass2csidisp8aich acuuacudacufacubacnlLacpltacha hacup"aed ael&ailadl`./<HSHRNO &k f%y.N.NnL<N^NuNVH$n&nA"n n 0"nidx0("nidh I0"n idX0("n idH n=P0.nd,AC =n./.HnHRNnO =n n=h0.nc,AC =n./.HnHRN.O =n n=h0.nd,AC =n./.HnHRNO =n n=h0.nc,AC =n./.HnHRNO =n.HnNpXO0."n Qf.0.if$0."n if0.if pLN^NuHnNXO(@)j)J)j     J g j !L%L p`NVH$n n=P=h&y`0nf 0+ng$&k f.N(@)J./<NXOLN^NuNVH$nJf./. N~XOLN^NuNVH $n&n 0kdb0*kdX0jdP0+jdF40Bb44+0*Be5B4+0*Bb5B4+0*Be5BpL N^Nup`NVH<$n&n (k*k Rf$ g)M g+LBB L<N^NuNVH $n&n B'R Jg R!K$L N^NuNVH$n&j(j f#`'L f#BBLN^Nu)K`NVH$n%yBJ.89L:9JEfDgFA#J9g>0B.0C//9NPO-@.N3.N`<`0R@>0E=@J@lD@=@n0H2HЁ2Hl.B/9NPOv4`NJgF09S@E=@0H2.HЁT2Hl".B/9NPOt09S@6<0D>J9gEl>0H2HRnDo,J9f$Jfp .Ng y!J#Jf#LN^NuNVH$n%yJg y!J#Jf#BLN^NuNVH $np.N&@ f . 0y/NXOp.N&&YB BB K L N^NuNVH$n.NLN^NuNqPANIC: olalloc: no ol ( <LV  "<N     * 0 J9g p .NRCtEl6RCp .NJyl`.B/9NPO`p.NZDoJymSBJg`ƶEo$SC.B/9NPOJyl`Dl|0H-@0HЀ"yP"Q=qp0.@Hr29Nf p0.r`"Jg.B/9NPO`p .NRBJyl yB09HLN^NuNVH4. Jyf>09N@6ByN0F@C8gJg.Nv`LN^Nu gJg .NgJg .N gJg .N gJg .N gJg .8 V ^ f p v ~  ! ".fileglayer.c.text %.data .bss (ollistwfrontwbacklayeroprlayeropNreccliplexposeldeletevtouchrecoldeq@olenqldeqlenqflcreaN0F@@Cg0F@B8 gJg.N`B gJg.N`BgJg.N`B gJg.N`B gJg.N`ByN`  ,2 BHV\fz  "*jrxte|wclearwcopyololfreeaddobsXaddpiecelenqbFaddrec0olallocmallocwncurwputswexitfreelongname.o/ 567179682 0 0 100644 502 ` R!yB .text .data@.bssNVH$n&n `RJJg :g |f |f4RJ(J`RLJg :g 4@HNdp  "*JR d v ~ !!""##$$%%6&>&DV'^'dv(~(|fTB./<NXO`./<NXO | LN^NuNqNT dj r.fileglongname.c.text.data.bsslongnamestrcpymvcur.o/ 567179701 0 0 100644 3054 ` R!y+.textdZ .data@.bssNVH<4. 6))** .filegmvcur.c.textZ.data.bssplpplodcntmvcurplodputphyscrCACMtgotostrlen_putsplod_iobfputssetattr:HOBSBC   tputsLLLINESNCUPNDSGEESEUEXEBEDESOBOUSXSDSrefresh.o/ 567179742 0 0 100644 5854 ` R!y2.text m .data 4@.bss,09W@3,9Xg0y,.BNbXO9Xg09,HR.p/NBXO9XHHr0€g<$|&|.HRNXO@JfpB9Jg(.NB9XL< N^Nu09Y@`ZJfJ9f09HU.p/NXO09HS.p`nJgF.N-@./NXOJg.$/.NXOJfp`p=@t BnNK0B.NIv` RC Cm0B.NIv` RC CmBJngxBnn`$A}nr AnAnRnn nnmA}nrAnAnA-HxBnn`RnnR,NV0n .N-@J9g n fJBn nP lf0n .N-@Jo"9HHg n h@` n.NRn `Jo"9HHg n h@` n.NN^Nu n fX.NNJgX.NBn nP l0n .N-@Jo.NRn `Jo.N~`NV@H<$n*Hgt`ADJ0(gv`ADr0(p€-AJg Ѓ-@z` .Ѐ"ЁCGAJ0Xgpx`b .Ѐ"ЁCGAr0Xp€-AJg6 Є-@R. .R//< HnFNO HnFNx nx  f nnm nnlA-HtBnj` ntRt"nxRxRnnRnj nx  g nnm ntBHnHn}NPO`RnnRx nx  f nnm nnm|=|l n jnnA-HxBnn` nxRx Rnnp2.jHS2.nHoA-Ht` nxRx"ntRtRnn nnm| B.` nnl=|lBnhA-Hp` npRp"nxRxRnn nx  g nnm npBHnNXO=@h`RnnRx nx  f nnm nnm0.jH2.hHЁrn.)HnNXOHnHnNPOHnNXO=@jA-HxBnn` nxRx Rnnp2.jHXORpmRp mnRpm:Rpm*HL H P.filegwalloc.c.textl.datal.bsslfreewinmakewintfreecallocmallocphyscrCOLSALDL_puts%Z2>nflush_curoffnrefreshwncursetattrmvcur_iob_flsbuf_curonCOLSLINESAMaspacemvnoise^strcmpI lslkshortVslk_onFEgetenvslkcolstrcpystrlenstrcaerrnoslkhilitewborder.o/ 567179784 0 0 100644 618 ` R!z .textt .data@.bssNVH<$n*f.HHg09`LLN^NuNVH$nB` .CDB1RpnB`2B` .Ѐ"Ё$ .CGB1Rp nRpnLN^Nu d .filegwclear.c.text(.data(.bss(wclearwfillaspacertouchwinwlabelspacewcleartmap wcreate.o/ 5alloc.o/ 567179773 0 0 100644 1010 ` R!y.textl .datall@.bssllNVH t n0("Hi6`0RBr2 n hP.NCe n.PN n.TN nBP nBTL N^NuNVH $n0*j6p.?BgNXO @%HPgp0.N(@%LTg0*R4&jP`p0Ѐ.N @&gR8XKXL0SCJ@fA.HjNXOgVyeNJgFJg>H`<.NPb.67179812 0 0 100644 2127 ` R!z$&.textD* .dataDD@.bssXXNVH J9gJ9DgtB9D`p./<FNXO$mt 9lp`p.HxW/NPO.N0.H"Ё=@0. H"ЀЁ=@0.H"Ё=@0.H"ЀЁ=@=nHnHxW/NO Jl` "|GJg.N.R/NXO @&gR 3J9gBn =n J9ft`RpPl "|J   fpPmp`.:p/NXO$@ f p #`5n0n.0n/0n/0n /HRN OJnmJn m0*yb 0*ycp`n5j J5jLB*H.NJmNp09.HRNXO.N.Np.HRNXO9HHgD "| q`:p #.NJ9gJ9g.NpL N^Nu |%H@ "|#.NBN-@.N.NNJgH `NVH<$n4.6.8.:.45B*g"0E5@0D5@A L D JP^fl rx   (4:J.filegwdelete.c.text.data.bsswdeletewcopyolTj`NVHJ9gp op-@ `LN^NuB tpPl H"|Jg. HxW/NPOR`NVp. Ѐ"|01"yA N^NuNV|#,Jg.HnNXO.HnNXOHn/9NPOJg# 4,#D3Hp.HxNXO#p.HxNXO# p.HxNXO#.HnNXO.HnNXOHnNFXOJf.N.(N.N.N. NN^NuNVT./.NXO @-Hf,pN^NuHnXHn\Hn|NO pXf Hn\NXwnmaptbtflgstdopen_iobfcloseioctltwbflgwindowldeletewrefreshfreewinfreewncurwgetselwfrontwpmapwselect#nullmouseresettermwdeltarget wexec.o/ 567179860 0 0 100644 1004 ` R!zTH.textO.HxHn|NPO @ g .#|f`.NJ(gp`p`NVP./.NXO @-Hf>pN^NuHnXHn\Hn|NO pXf.\N=@Vm0@./.`N:XO.HxHn|NPO @ g .#|f`.Np`NVH<$n.N$@&|,`|(S g`G(S gm ggRJyHf p@3HHЀ"Ё.N#D yD D(HSyHBB,*S&)MGRJJfnL<N^NuNVH$n nBJg^`RJHH"|1fJg@ n"R n A"JRJ `RJJgHH"|1gJgB` n  .data t@.bssNVHNJgp./<NXO$l LN^NuJgBN.Npg.N.Npg.N.Npo.NN.W BNXO`BN.NNp`rNVNJfNBNp.NN^Nu/dev/window " @ H V ^ l t   "n BLN^NuNVH nX-P nX-P n.N=@.$/.NXO40.HЀ"y 3.N-@0.HЀ"|=q0.yl y./.NXOJg$./.NfXO40.HЀ"|3.N=@HЀ"y410.HЀ"y30.HЀ"y3pLN^NuNVH$nBn`0.H=@H@0nHH"|1f0.HLN^NuNV.NdЀ"y`PJnfpN^Nu.0.HЀ"y 01"y(AHPNXOJf0.H`0.HЀ"y=q`NVH$nBn`HnJf0.H   JjDDLN^Nu`NVH$n .NR@=@JRfNJjg40*@40@.N-@0j./*/NPO%n`0<40@.N%@0*H2.HЁ2HoR0R./*NXO%@. jHPNXO0*H-@0.j .LN^NuNVH$n&|J` r\gr^fvHHr$`f(|HHHHfHH`FRLJf |0(g2p0p-@HHr0SgHH"|1f HHJfnB |J LN^Nu H >b  ,r @1 p2 z3 &elxs2mXpbrgvwsm<opNfhn:mpnl?VtnPgnnxwEXS@MP"RBGVWSMJlLOP:eEFHMuUP4 5 6 7 8 ! @ :# $ % ^ R& * fc ` i vru .d f |i m tvd l k Jr e rs $ Zvo p p c ji L mC F I RU D F (IHM xVD Ll S nL K bdD6NL\TN^GNXW123456$7.889V0-B=[~tZ?cdefghij"CDEFGH IJadnnsxxceib~o,t6s R d S E VO P P C PN J>e 8 xs m p ~ r 6g \vws Vm o  hp f Th mpnl ? tn g "n n ^ xwE 4XS M P *R NB DG XVWS <M l y@dPfTjANSXCEI|BO*YDFkhpru|z9DgDlqvaFHNABm(r2w<U0hZC^K0UDZBGKLvQVJlMTSbML O & Pe E F lH 2 MuUPd D NL TN G 0N XW1\2f3p4z567890R-= BL br1234$5.687B8J!`@#j$t%^RWVjNHLXabcdefgh ij k*l [? OcOdOeOfOgOhOiOjOCODOEOFOGOHOIOJOaOnOsOxNcNeNiObOoOtOyNdNfNjOAONOSOXNCNENIOBOOOTOYNDNFNJOkOpOuOz9NgOlOqOvNaOmOrOw0NhOKOPOUOZNBNGNKOLOQOVNM&*c4i rudd&fLimv vdZl0kr(esvoFppcixmC>IRU`DzFRIMrVDhLlSLKsfRSpEHVOTP,PCN JOMOROWNNNHNLPaPbPcPdPePfPgPhPiPjPkPllptx|6:>BFJNR $(,048<@DHLPTX\`dh"&*   .2VZ^bfjnrvz~   4/usr/lib/ua/kmap.s4/usr/lib/ua/keynamesrrE^^\\n r t bf ".28>F\v~ $<LTZbhn  ",6T^hr|&0:DNXblv$#.8$@J%V#\&jntx'''$%# **"*(.*<F+./+,.J/l3  *.>HR\pt$(.8LV`jtx~*4b4$&0Jdv4&2&N38349N$4 4 $ : @ J T X ^ h r |              <FZdnx|"&,6@JTX    & * 0 : > D N R b f l v                   $ * 4 8 H L R \ f j p z      &0:DNXbfv  *4>HR\fpz             $ . L V ` d j t ~             ( , 2 < @ F d n x         $.8LV`jt~ (2<FPZdnx   ".filegwget.c.text 4u.data 4.bssthashtabknextknamps knames$kdefault 4ks4defbuf4kxlatsktree,kpermxlatflagwgetckeypadwncurwrefreshtbtflgread_iob_filbufstrcmp_iobsetbufLINESphyscrCOLSmakewinwclearphysclrwsetbufwexittwbflgendwin,exitwrefreshFE_putssetattrmvcurendtvfflushw_target"nullmousewtargetonresettermwinter.o/ 567179940 0 0 mouseflgkcodemapstrlenwindowioctlkfreeDkavailHkeyinitKMstrcpystrcatstrcmpcallocgetnames6getmapfreefopenmaksymfgetsfcloselookupputtreeTsdecodetmalloc_ctypeatoosavstrh 100644 1546 ` R!z~.text .data@l@.bss  NVH|4. 6.8. Dcd Cce.p0R.p0R//<?BgNO L|N^NuE[RCp0: |0PH2AA< F oRE |J0Pg0PHH"| |`;RDp0: |0PH2AA< F oRE |J0Pg0PHH"| |`HBHn?BgNPO`.NVH $n &np0. .N-@p&$Jm@J9gpJ9fashZstrncpyreallocparselinewinit.o/ 567179925 0 0 100644 1884 ` R!zF*.textp/ .data P@.bssNV3HnHxWp/NO rgNNNJ9f>.N-@./NXOJg./.NXOJfp`N^Nup=@J@gB/<NXO09330933 3.N.NN`Nfp0. .NHnHxW?. BgNO Jl pL N^Nup0.r..N&p0.r..N$`( nr2( 0(JH$ nr2(0(LH&p`NVH4.6.8.0n .N-@ nBJm4J9gJ9g$ n0( "Hi< I0(i :ElFm pLN^Nu0H2H2Ho0C8 n0("HQ@ I0( i@0H.0HЀ"n"iP"QE` nR"JTJ)0SDJ@f nBp`|Nq01234567890123456789 [%d;%dH4> hV9HHN^NuNVN^NuNVN.NN^NuNVJym0y.NJ9g .HxW p/NPONN^NuJg .NBNB09HS/NXON.N`NVN^NuTERM510a510A  , 28>D LR\dpz6LVh|$,.filegwinter.c.text.data@.bss decdigofs_loofs_hiwgotowgetposwprintfwputswinstrwnmaptbtflgtwbflgwrefreshioc $2 : B!H P^ f"p#x#~$%&'().filegwinit.c.text/.data .bsswinitiswindwncurioctltbtflgfixtermgetcapkeyinitgetenvtluldiv__wmouse.o/ 567179955 0 0 100644 995 ` R!zj.textp .datapp@.bssppNVNJg.0n .N-@Jm. HxW 0n /NPON^Nup#p`NVNJg.0n .N-@Jm. HxW 0n /NPON^Nup#p`NVH4. x`0HЀ"Ё2AA0A80B.N@H"|1f n 2H pHLN^NuNVH4. J9gR. 0B/   NvXOr;f<.0B/NbXOr;f(.0B/NNXOr;f.0B/N:XOrMg pLN^Nup`  2 @ N ^ z  .filegwmouse.c.textp .datap.bsspHiswindwnmapioctlerrnogetnumwgetc_ctype`$n&n v` p RRJRKpPm L N^NuNVNJgp./. 0n /NPON^Nup./. 0n /NPO`NVNJgB/. 0n /NPON^NuB/. 0n /NPO`NVNJgp./. 0n /NZPON^Nup./. 0n /NPO`NVNJgp./. 0n /NPON^Nup./. 0n /NLPO`NV=npopQ`p.Hn/. NPOHnHxW0n /NO N^NuNV0n .N-@Jm>pQ./ .NXO"nCYAHP/. NPOp"."n)XpN^NuNVNJgB=|HnHxW0n /NO -@JmpQ./. HnNmouseflg#wgetmousewsetmousewreadmouse wnl.o/ 567179965 0 0 100644 760 ` R!z.text .data@.bssNV0n .N-@Jm2J9gTHnHxT0n /NO JmJ.g =|` N^NunHnHxT0n /NO J9gJ.g nH` n(H`NVH0n .N-@Jm.J9fBn Bp/0n /NPO$J.gB`LN^NupĀ.p/0n /PO .N^Nu0n .N-@JmpQ./. nHhLNPOp`Nq : X   * F h~,4Xz   4 l    0Hb     .filegwnoise.c.text .data.bssNPO`Nq  0 d n   .filegwnl.c.text .data.bsswnlwndelaywnmaptbtflgioctltwbflgfcntlwnoise.o/ 567179988 0 0 100644 2464 ` R!z.text .datawslkslkcoliswindioctlmvnoisewnmapslk_onslkshortwcmdwprompt.wknoisewtnoise$wlabelfwuserwguser~lmul__slkhilitewnmap.o/ 567179998 0 0 100644 510 ` R!z& .text| .data||@.bss|@.bssNV@H NJgL=|=|DJngHnHxW0n /NO JmHnDHxW0n /NO JmJg n`Jg n` |$H0n.N(4AG v`HHgHH`p RC CmAFG v`HHgHH`p RC Cm`(pQ.Hn/.NPOpQ.HnF/.NPOHnFHnNPOHnHxW0n /NO JmHnDHxW0n /NO Jl^pL N^Nu0n .N-@JmJngJ9f nX0n.N 49HHg n` n$H nAG v`|NV0. H"|-qJn m nP lJfp #p-@ .N^NuNVB`$ ."| 1".f .N^NuRpPnp` 0 T .filegwnmap.c.text|.data|.bss|wnmapwpmapBwindowerrnowphys.o/ 567180014 0 0 100644 2324 ` R!zV'.text(CHHgHH`p RC CmJ9fJ9f nX nAG v`HHgHH`p RC Cm`pJ9g$J9f nXpQ. nHh/.`:J9f n(0XpQ. nHh/.NPOpQ. nHh/.NPO nA. nHhNDXOp`NVH 4. SB0H"ЁR& BoV BoV L N^NuNVH t$n&n &`0JgHHrr fJgHHrr gRRRJRKJfpPmJg$n&n v`jJf Jf Jg

Jg.`BB/9NPO.NJg<.NN^NuSm yRr `.p /NXON$=y` yRr `r.p /NXO`\=y`& yRr `.p    /NXO0.SnJ@g Sm`J9f .*N0.SnJ@g"Jg.N Smh`NJg.`J9gBB/9NPO.N`(Jg =y` .N0.SnJ@fN8`NVJ9(gJgJfN^NuB9(.Nl`NVJ9(f(.NLN^NuNVH. Sm yRLN^Nu.p/NXO`NV.B/.NPON^Nu  R X p x    @.bssNVH$n 0n .N-@Jl pLN^NuJ9g*J9f.HRNXO` n.@HRN`JgHH./.NXO`p`NV0n .N-@JlpN^NuJ9g:J9f..HH/NXO` n.@.HH/NXO.HH./.NXO.HH`Nq 0 8 F Z r   .filegwput.c.text   (.<FR^dt~  ".4D!LV!x#$$#.data.bsswputswputcwnmaptbtflgtwbflgfputsansifputcwselect.o/ 570232046 0 100 100644 1037 ` R! .text@ .data@@@.bss@@NVNJg .W0n /NXOJlpN^Nu0. yg0@.N-@Jm0y.N-&.filegwphys.c.text(C.data(.bss,physopphysclrtbtflgphyscrscrollmvcurDL_puts AL_curflg(_curoffrFECLHOCACMtgotoCD_iob@Jm$B/NXO.NB/.NXO.Np./.NXO nHJyg .N3 0. H`\NVHNJf09HLN^Nut`8 H"|Jg$HnHxW/NO Jm .g `RpPmp`Nq  4 B P X jv    .filegwselect.c.text@.data@_flsbufLINESCOLSAMputsCEUP_curonCVCI_putchartputswprintf.o/ 567180022 0 0 100644 608 ` R!zd.text< .data@.bssNV-| n-H-H||PHn/. /.NO nBN^NuNVA-HHn//. N.bss@wselectwgetseliswindioctlwncurwnmapwborderlexposewindow%wprefreshremovetargettams2term wsave.o/ 567181313 0 0 100644 784 ` R!΀.text .data@.bssNVH<$n0*O Hn0n /NPON^NuNVA -HHn//.NpO Hn0y/NPON^NuNq2 n   .filegwprintf.c.text.data.bsswprintfD_wprf_doprntprintwxwputswncurwput.o/ 567180033 0 0 100644 808 ` R!{.text .dataj40*R60Ѐ.N*@# g:&jP`(S8`:0SDJ@fXK0SBJ@f0*LR30*Jj3L<N^NuNVH<$n0*j40*R6*y gN&jP`(S8`80SDJ@fXK0SBJ@f.N0y5@L0*y5@J.NL<N^Nu* 2bp.filegwsave.c.text .data.bsssavpxoff   yoffwsavewrestore~mallocfreetouchwinwstat.o/ 567181329 0 0 100644 1852 ` R!΀.textP .dataPP@.bssPPNVH $n J9gHnHxW0n /NO Jl pL N^Nup0.r..N5@p0.r..N4p0.r..N5@p0.r..N5@5n`@0n .N-@Jm|&n45SO `NVHNJfJ9f $<%`p09rSr b(@0; NJ "&*2:BJRZbjt`Rt2`NtK`Jtn`F$<`>$<`6$<`.$<,`&$<X`$<`$<`$< ``$< LN^NuNVJ9gp09rfpN^Nup`NVHt.lN$@ f$|qJf$|yt.HnNXOrgRB.|HnNXOJyf.N3 yn 3` y0o30Jyf.N3 yn 3P` yo3.N3lByNBB/9NPO @ 0+ k5@0+k 5@5kp`LNVH $n 8*:<*J9gHnHxW0n /NO JmNp0r../NXO=@p0r../NXO=@0*Hr../NXO=@0*Hr../NXO=@=FHnHxW0n /NO -@J9gz8F0n .N-@Jm&n0+ k40+k 6~0*Bf0*Cg~SfkgRp0rr2+gJg6*4*fTCTBp0r2Ё29Hbp0r2Ё29Hc pL N^NuHHr€f.N.NJ9f.NHHr€g.N7FOfB9B`.HnNXO./<NXO.N.N09@33.JgDJyfgetenvtgetentstrcpyLINEStgetnumCOLSSGtgotoCAlongnamettytypeaspaceb_onb_offslkshorttgetflagtgetstrPCresetterm0707070000020173521007550000000001440000010163130420437164700001100000000261tam/Info The tam l./< w` ./< /< N1PON^Nu./< `./< `./<  `NVA-HJ gJ  f. :/< -N1RXO#  y  ( HH.N1//< x`. |  0 Hl0H`z HH./9 |N1XOR09 ZHmJ g0y T.0y R//< )NMPO. )/9 |N1XOJy XfZSy Z |`NVHnN1XOrf .  Na# d# hHnN1XOrf . ANa# l# pp.//9 lN1POrf . bNaN1# tfp.NBN1xN1# xfN BN1xp tf. x`p xf . NaN^NuNqNVH<:9 ,$y lJ (g$B/9 |N1fXO. H/9 |N1XOB9 J (gHH.Np.p//9 N1POrf. /9 |N1XON .Bp/N1nXO.|p/N1nXO.p/N1nXO.p/N1nXO.p/N1nXO.(p/N1nXO.p/N1n  ZHH./9 |N1XO0y T.0y R//< )NMPO. )/9 |N1XON`J y l f".N1 .HRp/N1POL y JRf"N8"y #@R y  hR!y V y #R R rm$y &| ^t`RJf`L N^Nu RpPmB 9 r nR r` y L#R L#  P#  T#  X. L/< NVXO. P/< ,NVXOB vXONJ (g2HnHn/9 |N1BO 0.R@3 R0.R@3 T`*p.N1. /9 |N1XO. |N1Jg6 g. g& f`By p.p/N8PXO09 y lRy "| 1g gJ*g&`Jy Zg . NHH. y 0N`  l Jy zf g  fD09 ZRy Z"| 09 \Ry \"| 0By X3 TB `L  f@NB*g609 ZRy Z"|  By X3 TB `Jy Zg . N g8 g2  g09 ZRy Z"| 09 \Ry \"| 0HH"y 4 qB9 ^ nJf`fNVH v`R R n Jf n PJg n P  g n R "n"Q nRRpPm. BNV n B n P  g n P  f: nR n P  f(` t` n BR n  g n B nRpL N^Nu n P  g n Bp`NV.p/N1nXO`. .gp../< XNVXO`6p..N1p.Hn/9 lN1,POrg. wNV k.p/N1nXON^NuNVJ f(p./< Ĵ/9 lN1,POrfb # J g4p./< ĵ/9 lN1,POrf2 9 Ĵf 9 ĵfpN^Nu. BBp/N1N` y  g fJy .g y 8R 8Sy .fh y 8B. <09 ŲR"| |AHPN1XO09 ŲR"| |A.N1 -@ ż Ž ų ž ſ09 ŲR"| |A./< N1XO .X./< ż/9 hN1POJ dgNW# ( Ÿ`Jy zgJy f y ŸR ŸSy zfr @ y ŸB ż Ž ų ž ŵ ſ. (/< N1XO09 ŴHX./< ż/9 hN1PO` y (gbJy XgN6 |  ZB . Np./< . |  ZHPN1POZy ZN6:4O p`NVH$y lBy \3 \ ZB*LN^NuNV|p.Hn/9 hN1PO. N p.N1xN^NuNV. 2XN1B|p.Hn/9 hN1PO. N BN1xN^NuNVBN1xN^NuNVJ (g:.p/N1nXOJ o. ĸ/< N@XOBN1xN^Nu.p/N1nXO. /< N1RXO-@.pP/HnN1POp./< HnN1POJfTJ 2Xl.pP/HnN1POHnN1 XOSCB1.Hx HnN1PO# 2X`Tp./< HnN1POJf J 2Xo . 2XN1Bp# 2X`p./< HnN. N`Jy XgN609 ZRy Z"|  N09 \Ry \"| 0N6:`LJy ZgJ*f. N8. |N1J*f"p.p/N8PXO`9 kg*B h0E./< /9 N1,PO3 o` p./< /9 hN1POBN1xLp/N1nXO.0Np/N1nXOJ9 gN^Nu . fHJ (gNb`p./9 tN1XOp# tN1-@JfNbN16`p. r€f f< y (g.p./9 /9 N1POJln. #Na`^ . f` y JgJfP y (f p./9 `T y (g p./9 `:p./9 /9 N1PO` . f. N1 ./< /9 N1PO` y Jg f. y (gp. .N`p. .N` y  g fp. .N`fp. .N~`Vp.Hn /9 N1POJl:. #Na`*BN1-@fNbp./9 xN1. $N1J9 fJ9 hgN` .g .f(p.Hn/9 dN1,POrg . Na.@H @g@ @gn @Ag* @g @fzp..N`Jp..N b`<. !`.p.Hn/9 dN1,POJy < f | !Q` | !y.Nap.Hn/9 dN1,POrg(`p../< !/9 |N1PO. |N1. !`NV. !NaN^NuNVBnp.Hn/9 dN1,POrg . !Nap.Hn/9 dN1,POrg . " NaBnB@.=@`6p.0.RnCAHP/9 dN1,POrg . "(Na0.SnJ@fp.CB1XO`NV. @HUrbX@0; NJ>N\jx &BNXJJJJJJ y N^Nu y (` y ` y (`p./9 /9 N1POJl. $`4 y Jg f.p./9 /9 N1POJl. $ .Ѐ"| Bq. $pR/ .N1XO"| (AHPN1XORplN^NuNVxp-@Hn|NPXO-@N y Jg"|0 1g .\fRRy 09 R"| A P .cf| `P .nf| `@. #Na`2 .^f*Ry 09 R"| A @..fRy 0.BA.Ae N Jf`NVH09 R"| A P .\fN09 R$09 HRq .qg .Qg .eg .Ef.N`J.f. $N1Jy fJy fJ9 hgR09 R"| hJ1gNRy By 09 R"| J1f>09 R"| hJ1f(.p/N1nXOB9 NpLN^Nup`NV|| fppg6. N1 ./9 /9 N1POJl . $NaN^Nu. N1 ./9 /9 N1POJl. $`npg6. N1 ./9 /9 N1POJl. $Na`. N1 ./9 /9 N1POJlh. %Na`XNVHt. @Hrbh@0; NJ$.8@JR$| %8`~$| %<`t$| %@`j$| %D``$| %H`$| %Jt`L$| %L`$| %N` y (fp. r"| $q`p. r"| $qJBgX y (g O `[  $| `*p. JRJHP/9 N1POrp.Hn/9 pN1PON^NuNVH t`09 R& R"| hq.HHJ@gR @bg4 @ng @pg @rfB| `v| `lp.N1`BHxT/9 N1PO`n. #W`. #Na`. .^f&09 R"| hA"RA@p.Hn/9 N1POrf . #Na09 R& R"| hqg .\f`L N^NuNVN^NuNV . fDJ 2\m. \/< 2\N@XONyLp.N1. NyBN16` . fBHxT/9 N1`t . g( . g . g . g . g . fp. .N f . %PNaJfLN^NuNVHt. @Hrb@0; NJJT^hrz$| %q`p. JRJHP/9 N1POrf. %Na`~$| %t`t$| %w`j$| %z``$| %}`V$| %`L$| %`D$| %`< y (fp. r"| $q`p. r"| $qJfPLN^NuNVHp. r"| $q`*p. JRJHP/9 N1POrf . %NaJfLN^NuNVHp. r"| $q . e . bB@. @=@HЀ"| JqgfJ9 @g\0.R"| (A.N1 Jg>0.R   "| (E`*p. JRJHP/9 N1POrf . %NaJfLN^NuNVJ 2\g. \/< 2\N@XONyLp.N1. NyNrBN16N^NuNVJ (f NN^Nu|n p.Hn/9 pN1POrg.0/< %NV`p./9 xN1XO`NV. @Hr bT@0; NJ &6F>FFF.NhN^NuN`N`N|`N`N`p. ./< &NVXO`NV-y H`././< &4HnN1O n Lf. &EHnN1XO n Pf. &PHnN1XO n Xf. &^HnN1H$y l`S**HHC1H0HSrb@0; NJ(8X`ht|*p.p`R*p.p/NXO# 0`8*`0*`(*N`*`*p.p/NxXOJ*f8NLN^NuNVH$y l *fJ*fp.p/N6XONVLN^NuNVp.p/NXON6N^NuNVH$y l *fJg fp.p`" *g *f( g fp.p /NXONLN^Nu *ftHnHn/9 |N1BO RR*g0 .29 `Hm 29 bHn .29 `HR-@XO n Tf. &nHnN1XOHnNVXO n-hRJfPN^NuNqNVH . $y l09 ZRy Z"| *HHrb@@0; NJTpB f(|%| ' 3 ZL N^Nu@H"| & qN` [f|%| (B*` #f|` (f |` )f |`@H"|0 1gp.N<,`r =g >fp.N7j`V gJp.N7`> ?g6 ;fB*p@HHCB1`$@H"|0 1gB*0@|` gJ*fB*R*p.N7`  r sp.p`pN(`pNVH. $y l *fv 7f )0y T.0y R//< *N|PO3 R f3 T h3 t j3 v l# * *3 x **gp` LN^Nup ) S r U s t * u k v m w * xp .p/N4XO`> 8f6J9 )gJ9 )g` *`p.0y `//< *NPO3 f R3 h T. */9 |N1XO# * *B` .rb@0; NJ >Pb9 *g`. *m`9 *gL. *r/9 |N1XO`69 *g,. *w`9g@H"|0 1g>*HHCA&H K"K*HHCA0`h ;f(R** fNLN*HHCB1`:R*p.N7`&N7` 8f N>h` f N7`NLN` Af 3 t`< BfBy t`. 0f 3 t` 1f 3 t` 2f3 tJy xfNQRNLv` Af 3 v`< BfBy v`. 0f 3 v` 1f 3 v` 2f3 v y xfNQ``NVJy Vg009 Ry bn"Ry R09 Ry bo 3 b RN^NuRy R y Ro3 R`NVJy VgSy R09  *g. *|`9 *g. *`Rpnf3 j t3 l vJy *fN`NN`XNVH. */9 |N1XOt`. * /9 |N1XORB Bm. |N1N LN^NuNVH$y l *fJgf g^ *f@Jg f6J o p.p/NFXO. ĸ/< NXON TLN^Nu *f: g f.J l. ĸ/< NPXO-@fp.p/N`2 *fJ op.p/NXO. ĸ/< NXO`zNV p-@Hn&NPXO-@Npf. *BBp/N14O ` nJl. */. N1XOBRy `l 3 ` RSy R y Rl3 RN^NuNVRy T09 TH DoNMp# N^NuNVBy XB Sy T y Tl3 TN^NuNVJy Vg,09 Ry bfNN3 TBy XB N^Nu09 ZRy Z"|  Jy Vg y Rg09 ZRy Z"|  N`NqNVH. $y lB*jB* @e ~cN LN^Nu@Hr@"j qN`NV .> fp.p`p.p/NXONN^NuNVH$y l|Jg f"%| ' 3 ZLN^Nu%| ,`NVH 4. $y lA0 HJCg *H@N1-@./< *HnN1POHnN1 XO=@ @o"p.0.H[CAHP/. N1`Hn/. N1PO. N1 "n B1.Hx/. N1PO"n" nJl . *NapN^Nup`NVBp/N1nXO-@ nJm^.N1B nr . /. /< *HnN1O HnN1bXO-@pf. *BBp/N14O .p/N1nXON^NuNVN^NuNVH$y lSy ZJg f8N.*g,09 ZRy Z"|  3 TBy XB LN^NuNVH$y lSy ZJg f8N*g,09 ZRy Z"|  3 TBy XBm pL N^Nu0H`NVH$y l*HJBgJ*f pLN^Nu0H`NV q0n./< p/9 hN1PON^NuNVH $y lBNR4p.NH6 CfvCl3 `3 b Bf CfBy V`\3 V0H 0 *0Hr .N10 +0H 0 20Hr .N10 3N @gD @gF`bp./NXO`L*`DJg f:`2N`&`Jg fp.p/NdXOJ*fVN|LN^NuNV LN^NuNVJy Vg09 Ry bgJy Vf y Rf N 0NZN^Nu y RlN5`N `NVN 09 ZRy Z"|  3 TBy XB NN^NuNVJy VgZ09 Ry bfLRy R09 Ry bo4N 0y T.0y R//< )N PO. )/9 |N1XON^NuJy Vg y Rg09 ZRy Z"|  N509 \Ry \"| 0 `NVH$y lJy VgrSy R09 Ry `l>N z0y T.0y R//< )N PPO. )/9 |N1XOLN^Nu*fM 3 ZN`*fM 3 ZNSy R y Rl   3 R`NVN6fN^NuNV0y T.NH3 T0@.0y R//< )N PO. )/9 |N1XOB By XNN^NuNVpn, . Dn | 3p-@ Do 9 DN^Nu .`NVH$y lJy VgBNLN^NuN829 R@3 R Al3 R*f[ A 3 ZNx`NVH$y lJy Vgp.NLN^NuNy R3 R @o3 R*f[ B 3 ZN `NVH$y lNty T3 TH Doh3 F Tp# *g 3 X`By XN. D0y R//< )N 0A0Hr .N10"n@ n2Hd0A0Hrd.N1 0"n@0Hr .N10"n@L N^NuNVJy Zg . N. 8/9 |N1XO. @/9 |N1XO. F. +h/9 |N1XO3 xNN^Nu. +n`. +t`. +z`NV3 TB By XJy Vg09 Ry bnN-@09 Ry `l0H-@`X0y T././< )N~PO. )/9 |N1XO. @/9 |N1XO. D/9 |N1XOR .29 `Hl .SJf0.S@3 R0y T.0@//< )NPO. )/9 |N1XO`NN^Nu. @/9 |N1XO. rgRrffp * *. +`vB * *. +`^p * *. +`Dp * *. +`**S*Jgf`NVH$y lNrf. +#/9 |N1XO*f4. +&/9 |N1XO[ 0 J 3 ZNLN^NuNVH$y lNjrf. +)/9 |N1XO*f4. +,/9 |N1XO[ 0 K 3 3 ZL N^Nu@H"| + qN` [f|%| -B*` #f|` (f |` )f |`@H"|0 1gp.N<,`r ?f NW`b *HHCA&H K"K*HHCA0`Z ;f(R** fNLN*HHCB1`,R*p.N7`N7` ZNLN^NuNVN~N^NuNVN^NuNVNjN^NuNV. NN^NuNVH$y lBy ZB*B*LN^NuNVH$y lBy ZB*B*LN^NuNVH$y l |  ZB. /9 |N1XOBy ZB*B*LN^NuNVH$y lN$40. HJ@g* @g @f<3 R0y `m"y bo$`v09 RB3 Ry `l 3 ` RN"0y T.0y R//< )NPO. )/9 |N1XOLN^Nu09 RB3 Ry bo3 b R`NVH$y l*g3 X3 F TLN^NuBy X`NVH 4.6. n2H8f N>h` 2f NY` f N7`NLN` Af 3 t`< BfBy t`. 0f 3 t` 1f 3 t` }f3 tJy xfNQRNLv`p Af 3 v`< BfBy v`. 0f 3 v` 1f 3 v` }f3 v y xfNQ``NVH$y l*H3 HЀ"Ё"| pA# 8# <3 .*H3 Ų*HH` AB0(Rpm*H3 Ŵ3 z* H3 NLvLN^NuNVNLN^NuNVH Bn` |  | Ȝ Rn0.H Dm=|`0.HSrb^@0;    NJ (08@H=|`6=| `.=|`&=|`=|(`=|4`=|=`=|FBn`l0.R"| |A0.H2.HЁ"| 0.R&0.HP"| |10.H2.HЁ"| ȜRn nmRn no B9 bB9 . Ȝ/< B/9 |N1O p# d||p.Hn/9 hN1POrg . .Na| p.Hn/9 hN1POrg . .7NaNLvL N^NuNVBBBB/9 |N1O|| p.Hn/9 hN1POrg . .RNaB dNLvN^NuNVH$y l09 Ry J xo.p./9 xN1XOBN1-@ xfp# xN^NuNVJ xo.p./9 xN1XOBN1-@ xfp# xN^NuNVJ xl$J 2lnJ 2pnN1# xfN J tlN1# tfBNp.N1N^NuNVH`. ;A`. ;D`J (fF.p/N1nXO.p/N1nXOBN1-@v 2lfN1N` .sp/N1nXO`NVJ 2lo,.p/N1nXOp./9 2lN1XOB 2l`2J 2po2.p/N1nXOp./9 2pN1XOB 2pBN1N^NuNV| |p.Hn/9 N1POJl . ;gNap.HxT/9 N1PO. 2hN1BJ 2Xo" | ./9 |N1rXOBN1xN^Nu | ;`NV.p/N1nXOB 2tJ 2lfJ 2p` . =iNaJfBB/9 N1PO.Hn/9 N1,PO=@A-HJ@l. =y` n ml nT PWCg. =Na` nf. =` nT=P nT=P nT=P-| Bn`" @l nT"nT0`TRn0.nm y g y f # D`pP# DJy g y f" y  #2P 0# & 4`@ y g y f, y  y #S 0# + 4-n-| Bn`" @l nR"nR`RRn0.nm3WD p9 Ѐ"| Et3 By 09 HЀ"| FgBN1p# 2p# 2lJ (g . /oBBp/N14O -@p f y ` y g y fn y f <`pP# D y  J (fJ9 f. ?BBp/N14O -@p fX y ` y fh y J (g`J9 Hnl/9 ̈N1POp./9 ̄NXORRhx`FpgJl0D./< DNvXO`p./9 ̀NXOJlp./9 ̄N2XO D lHJDg0D./< DN4XORD .h./.h/< DNPOp ./9 ̀NXO$pfn D mp`. Ds`\./< D`Dpfp./9 ̄NXO. DNp`p./9 ̀N@XO$m./< DNXO`. DN`:NV.Fp/N1nXON^NuNV . R.N1p.Hn/.N1,PO-@BN1pgpN^Nu.@H`NVp.Hn/.N1PON^NuNVJ 4g./. /./9 4N1O N^NuNVN.Zp/N1fX. ?BBp/N14O -@p g BN16`* y B#2P 0# & 4` . @3NaN`nNVBBB | .HnN1XOHnN1 XO-@RѮJg8B`"Ap"|0 1fp-@R .mJg p# $`HnN1VXO# $p# | .HnN1XOHnN1 XO-@RѮJgHJ9 f@Hn/< ˀNizPO.Hx/< ˀN1PO# Jl . @WNap-@` | . .UrR/N1XO"| AHPN1XO .UrR.N1"| A.N1 RѮ | . .UrR/N1XOnXOp./< QN1(XO-@pgJl. \BBp/N14O BN16`. \/< \N1XO`p f8 y ElJg NFJmrNp./< QN1(XOBN16N^NupfN1 Q"g8NN1`,pf. \BBp/N14O `Jmp./< QN1(XO-@ gv gl gb f`V g f`NV.Zp/N1nXOp./< ]N1XO-@Jl". ]BBp/N14O p.N1x. ]/.N1rXO.N1BN^NuNVN<.Zp/N1nXOp./< PN1(XO-@pgJl"| hAHPN1XO .UrR.N1"| hA.N1 RѮRpn@N^NuNVJ ln.Hx/9 N1PO# rfH 90rgr f. /< @z` . /< @BBp/N14OBN16BB/9 N1PO3WD .L/< /9 N1PO-@ Lg . ANNaN^Nu. /< A*`NV. N1 "y A-Hp. Ah/.N1XO-@3 By Jf 3= By 3 B9 N^Nu39 `NVNN^NuNV. B/< B/< Bp/N14O pN^NuNVpN^NuNV`&. n /(0P//.N1. ]BBp/N14O BN16`t. ]=/< ]6N1XO`\p fN8`pfN1 Qg4NN1`(pf. ]HBBp/N14O `ZJmTp./< PN1(XO-@ g6 g. g& f` gL fX`.f6HnVN1"| ٯB1 .rgrf*# 4# 1 8`# t 4# 2 8N -@N^NuNV. 0/9 4N1XOBB/</9 8NO -@ fJ _FgpN^Nup`NVH$n. /9 4BB/< ٰ/< ^N O-@pf2B/< N1XO-@JlF. /< _`fLN^NuJf@B/< N1XO-@Jl. /< _`..N1Bp# _F <`pf . 4/< _BBp/N14O`(pgpf0. _BBp/N14O -@p gT <`J .`BNqNVxp `,g 9 `,N^Nup# `,B <. `hHnN1 XOCVAA-H`S n /f nRB.HnV/.NfPO nJf nJf nJ(fp`p`./.N1XOHnV/.N1POp`ZNVH pd-@Hn nHhN1tPOJl pL N^Nu. ` nHhN1RXO-@Jfp`BB .Ѐ"Ё.N1B @-H"n"Q#HrJfp` nJ(gA./N1XOJf. nHhN1XOHn nHhN1PO.HnN1XO .*fHnHn` nJ(gA.HnN1XOJfVHn nHh/< `HnN1OHnHnN1tPOJlp`.g. `HnN1XOXO. `tHnN1XO. `vHnN1XO. `HnN1RXO# @JgN-@|m. @N1F. `N1 @ g. `N1.HnN1XO. `HnN1XO. `HnN1XO. `HnN1RXO# @Jg(NF-@|l. @N1F .|`". @N1F# `# `B `p# `,`NVH `lJ # H.Nd @&H 9 H"ЀЁ"y <#f pL N^Nup`p`NVH $nNr# `,p `,n8&y Jf6ppmJgpm pL N^NuAB0(`Hn/N1POJgPKJf +`NVH$n`RJ  g  g  gtp"|0 1HHrW€g R"| <pm | fp.N7j` f N7`p.N7`  e*@H 7 1&p gp gp gp#fB`6NVH y @Sm y @"hR@H` . @N1$p g6 y @Sm y @"hR@H` . @N1$pfLN^NuNqNVH$nJfp.HRN1(XO-@Jm>B..p/N1nXO @-Hf$.Zp/N1nXO|`LN^Nu.p/N1nXO%j`N1` . g`rJmj g^ gR f`Fp flJ g. n N-@fp -@` g g fVp.HRN1(XOJ.g.p/N1nXO .`& fJgb|@|`TN7`JN7`@NV3 tNQRNLvN^NuNVBy tNQRNLvN^NuNVH$y lp.p/N8PXO#2P 0NLvLN^NuNVH$y l|N>LN^NuNVH$y l|N>LN^NuNVNOdNLvN^NuNV0y :.0n //< vNVPOJy :g( y ڔ LfBy :# ڠ r# ڜ vJn g&p./9 v/9 r/< NO NN^NuNV./< vNVXON.N1xN^NuNqNVH 4.6.0n.0C/0B//< wNVO n2H 0A0Hr .N./.N1XO`NVp.HRN1(XO-@pf"N1-@l`NVH$nJfB*B* B* p.HRN1.XO-@JmFB..p/N1nXO @-Hf,.Zp/N1nXO|`$N1`LN^Nu.p/N1n`p .HRN1.XO-@pfN1-@m .^g`Jm g g g g gp gd gXp gNBJ g. n N-@pg.pgD fHJgB./.N1XO` p.HRN1.XOJ.g.p/N1nXO .`JfNn`10"n@ n2H 0A0Hr .N10"n@JngN0H# v0H# r 9 v nBy ~` 9 v oNXp./.NXOL N^NuNqNVH. /./< w4NVPOx$y L&9 $9 p./< NXO# v# rBN.//< w]`@ RlBB*Q.N1 .HRNXOp./< wNXO$jR.//< wNVPO`. wNV g,B*Q.N1 .HRNXO# P# X. w`. xNVp./9 v/9 r/< NO . x>NVN. x\NVLN^NuNV. xtNV y L Hg&NV./. /.N8PO-@Jf nrg.N-@Jfp n P(p. n/N1.XO-@JmH n PB(B..p/N1nXO @-Hf.Zp/N1nXO|`N^Nu.p/N1n`.N:-@ g g gJlF n P(p. n/N1.XO.NRJ.g.p/N1nXOp`| f./.N1XO`tp gN `d n PJnn. tBBp/N14O `< n P(p. n/N1.XO.NR nA./.N1XO. t/.N1XO nA./.N1XO nA./.Nǘ# H Lp./9 NXON^NuN`NVH. D/< xNVXOJ Df^ y H Lg&$H./< xNVXO#R H y HBV`:$y T./< xNVXO#V T y TBR`$y D J#R DIR&J` RKeBVBR J LN^NuNVH< J oV 9 gHJ fX.p/N1XO.N1B(@ g# N`vp fBNL< N^Nup# N`.p/9 N1XO./9 N1NXO(@ g 9 l# # ` g# # N` 9 "ЀЁrZ.N1K` AZ+HRKZ 9    "ЀЁrZ.N1"y AeJ DfD 9 "ЀЁrZ.N1A# D 9 "ЀЁrZ.N1AB`F 9 "ЀЁrZ.N1A!y D 9 "ЀЁrZ.N1A# D# `NVH (y BVAZ)HR# L L# HGR$L` RJep rf# XIZt`6GR$L` RJeA)HVAZ)HR rf# XIZR o$9 pZ. N1"y AIBR# P L# Tpo A)HV`BV 9 "ЀЁrZ.N1"y AAdpZ. 9 N1"y A# D(H` AZ)HRIZ 9 ". ~:NV y L.R///< ~ZNVO y P.R///< ~NVO y X.R///< ~NVO Nǘp./< NXOp./9 DNXOp./< NXO y LB(Q. LN1 ./9 LNXO y L#V L y P#V P y X#V X. L/9 L/< ~NVPOp./9 v/9 r/< NO N y L.R//< NVPO y P.R//< 7NVPO y X.R//< iNVPON^NuN`NV0y :./< NVXOJy :g y ڔ LfBy :N^Nu3 :# L ڔ# X ژ# v ڜ# r ڠ`NVHЀЁrZ.N1"y Ae 9 "ЀЁrZ.N1"y AB. X/9 T/9 P/9 L/9 H/9 D/< xNVOL N^NuB D`NqNVH. r/9 T/9 P/< ydNVO y P TgXt$y T R l*$jV f.//< yNVPONLN^Nu# Lp./9 NXO`8 9 r g$p.//9 /< NO N`NBy :`NVH. H/< yNVXOJ HfB`#V L`p-@ .SJg$y L. r/ /< yNVPOt`$jR R rm# X. / /< z&NVPO$9 r`$jR$n$. 9 Ђ mNJo-B 9 "| HGJ Bf(J`A(e`V(J`F  d<  g6  g0 g* 9 Brg rfS`^R@`RLA(e .ѹ LN^NuNVhHt 9  o` . | H HP90HH/N1PO( 9 "| G 1 g pQ l #  B B LN^Nu#  `NqNV. NV9 ]g 3 ~`By ~ 9 Z@H.Jy ~f$ | HP/< NVPO# vN^Nu | `NV. NVp./< NXONN^NuNVJ g. N1FB R l f fl y L.V//< zVNVPO y LJVfPN8$@ y L%hRR y L%hVV# L.V/*RHR/< zNVO `# PB`LN^NuNqNVH y L.V//< zNVPO y LJVg. zNVNǘt$y L. //< {NVPO`$jV R lJVfp l `NSnp.NLN^Nu# L. v/9 rNXO`N`NVH  y P.R//< {HNVPO y PJRg. {wNVNǘt$y L&y P. //< {NVPO`&kR$jR R lJRf. //< {NVPOp l ` N^NuNVNJgpN^Nu.N&-@rg. /.N1XOJf .`NVJ f NtJfj. N1# . p/Hx/.N1dO rf4p./< /.N1 XO"nAHhN1POJgpN^Nup`NVJ f$. /< N1RXO @# fpN^Nu. N1. N1# p`NV | "X "`/ QNN^NANqN|Snp.NL N^Nu# L. v/9 rNXO`NBy :`NqNVH $n./. HR/< | NVO &Jp-@`" ;g"Jg .Ѐ"ЁrЁ-@`RK` .Ѐ"ЁrЁ-@ ;gJfp9 گ. .N1R"n "p9 ڮ. .N1R"n"L N^NuNqNV. /./< |HNVPO. /./< |pHnN1O p.HnNXO# v# rNhN^NuNV. ||NV y P.R/< ^/< |NVPO y PJRg". |NVNǘ-y r-y vp./9 /9 /< NO p./< |NXO y L.R///< |NVO y P.R///< }NVO y X.R///< }7NVO y PJRg2B(Q y P hRJRg& y P.RN1 . y P/(RNXO`6J9 ^g.N. ^N1 ./< ^90HH/N1PO y L#R L y P#R P y X#R X. P/9 P/< }cNVPO y PJRg"p./././< NO N y L.R//< }NVPO y P.R//< }NVPO y X.R//< }NV`.J9 ^g(. ^N1 ./< ^90HH/N1PON^NuN`NV y L.V//< ~NVPO y LJVgAttempt failed when terminal emulator tried to set the group file access privilege to the login user's.,'%d','%d'Attempt failed when terminal emulator tried to set the user file access privilege to that of the login user's.wait_for_ok: entry wait_f   or_ok: read ret=%d, buf=0x%x Bad read while waiting for ok from phone mgrPhone mgr says not okHOME/u/%s%s/Filecabinet/Profiles/vt100.tab%s/Filecabinet/Profiles/vt100_132.tab%s/Filecabinet/Profiles/bct513.tab%s/Filecabinet/Profiles/bct513_132.tab%s/Filecabinet/Profiles/unknown.tab/tmp/ate_loga{%4d} PCan't create a window for the Terminal Emulator.Async Emulatorstty -ixon -ixoff/usr/spool/uucp/LCK..No profile or line device provided. Both are needed for emulation.NG H I J K L M N O P Q T W Z ] ` c f i j k l m n o p q r s t u v w z { | }                                                                                            o profile or line device provided. Both are needed for emulation./dev/ph0/dev/ph1Cannot use the line now because it is being used by another program.FilecabinetFilecabinet/Profiles/bin/mkdirmkdir/HOMEw1w2//usr/spool/uucp/LTMP.%d/usr/spool/uucp/LTMP.%dsomething is wrong with the pipesomething is wrong with the pipeFile control failure.failed to fork the keyboard managerfailed to fork the communications manager *****Use EX to exit Emulator and CM to                 ! " # $ % & ' ( ) * + , - . / 0 3 4 5 6 : > B F G H I M Q U Y Z \ ` d h l p q r s w {                                                                      access local commands.***** ( 0   F1 F2 F3 F4                                      " $ & ( ) * + - / 1 3 4 6 8 : < > @ A B C D G J M P S V Y \ ] ^ _ ` a b c d e f g h i j k l m n p r t v w x y { }                                    F5 F6 F7 F8 [=w COMM died on FCNTLshadow entry str='%s' shloop entry top = x%x, '%s' shad                                                                 # $ % & ' ( ) * + , - . / 0 1 2 3 4 5 6 : > B F G H I M Q U Y Z \ ` d h l p q r s t x |                    ow is '%s' shadow_loop top='%s' shadow_loop cur='%s' get_shadow: too big chk_page_msg: unknown msg=%d chk_page_msg: read of cpkprdfp failed Received unknown message from pipe_loop./usr/lib/ua/ate_inforscaponscapoffprintonprintoffresetrrm %sUse Shift-Exit to exit Emulator and Shift-Cmd to access local commands. PF1 PF2 PF3 PF4 UP DOWN LEFT RIGHT       ! % ) - 1 5 9 = > ? @ A B C D E F                                      $ ( , 0 4 8 < @ D H L P T X \ ` d h i j k l p t x |                                              $ ( , 0 4 8 < @ D H L M N O P Q R S T U    V W X Y Z [ \ ] ^ _ ` d h l p t x |                                          $ ( , 0 4 8 < @ D H L P T X \ ` d h l m q u y } D  .Can't read pipe char count.Can't read pipe data during saving of system label string.Can't read pipe function key no.Can't read pipe char count.Can't read pipe data during saving of syspf string.Can't read pipe char count.Can't read pipe data during auto-logon.Receive string in auto-logon contains unknown control sequenc.Unexpected end-of-string found in send sequence.Illegal escape sequence found in send sequence.problem writing data to the hostproblem writing data to the hostproblem writing f1f2f3f4f5f6f7f8f9f0f-f=!@#$%^&* 741-8520 ,963.OcOdOeOAOBOCODOj741-8520 ,963.br OwOtOqOmOxOuOrOp OlOyOvOsOnOPOQOROSOAOBOCODOwOtOqOmOxOuOrOp OlOyOvOsOndata to the hostproblem writing data to the hostproblem writing data to the hostproblem writing data to the hostproblem writing data to the host problem writing data to the hostproblem writing data to the hostproblem writing data to the hostproblem writing data to the hostOPOQOROSABDCproblem writing data to the hostPQRSABDCproblem writing data to the hostproblem writing data to the hostproblem writing data to the hostpage_msg: write to pipe faile 741-8520 ,963.cdeABCDj741-8520 ,963. ?w?t?q?m?x?u?r?p ?l?y?v?s?nPQRSABCD?w?t?q?m?x?u?r?p ?l?y?v?s?nPaPbPcPdPePfPgPhPiPjPkPlOCODOEOFOGOHOIOJOAONOSOXNCNENIOBOOOTOYNDNd, errno=%d page_proc: unknown key 0%o shad (0x%x): %s --top_vis --bottom_vis --current_line --bottom_line L&L:L:L:L:L:L:L.DD$BATAALQ`QRL:L&L:L&L:L:L:L:L:L:L:L:L:L:L:L:LNLNLNLNBBhLNLNRLNLNLNLNCTLNLNLNLNLNLNLNLNLNLNLNLN:LNLNLNLNLNLNLNLNOLNLNLNLNLNLNLNLNLNLNLNLNLNLNLNLNLNLNLNLNLNLNLNLNLNLNLNLNDE*FNJOKOPOUOZNBNGNKOLOQOVNMOMOROWNNNHNLOcOdOeOfOgOhOiOjOaOnOsOxNcNeNiObOoOtOyNdNfNjOkOpOuOz9NgOlOqOvNaOmOrOw0NhPaPbPcPdPePfPgPhPiPjPkPlOCODOEOFOGOHOIOJOAONOSOXNCNENIOBOOOTOYNDNFNJOKOPOUOZNBNGNKOLOQOVNMOMOROWNNNEFPLN:VCTK*KLNLNLNLNLNLNLNLNLNLNLNLNLNLNLNLNLNLNLNLNLNLNLNLNLNLNLNLNLNLNLNLNLNLNLNLNLNLNLNLNLNLNLNLNLNLNLNLNDE*EFPLNLNLNFLNK*KGH LNLNWLNLNLNILNLNLNLNLNZ|LNLNLNLNLNLNLNLN:LNLNFR98>LNLN:I;FLNLNLN8zLNLNLNLNLNLNLNLNLNLNLNLN[00;000HNLOcOdOeOfOgOhOiOjOaOnOsOxNcNeNiObOoOtOyNdNfNjOkOpOuOz9NgOlOqOvNaOmOrOw0Nh[?1;0c[?13n[?2[?10n[?0 OM?M problem reading data from the pipeLeaving terminal emulator, press any key to exit.Line terminated, press any key to exit.Line disconnected, press any key to exit.unknown %x unknown header in the pipeTimeout trying to login to Host.Can't read pipe function key noH *EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE Printer/Spooler is not online./tmp/PR%dFailed to open printer file.lp %s # -a %sLine Printer spool failure.     wrm %swrm %sL&L:L:L:L:L:L:L.DD$BATAALQ`QRL:L&_DL&_L:L:L:L:L:L:   L:L:L:L:L:LNLNLNLNBBhLNLNRLNLNLNLNCTLNLNLNLNLNLNLNLNLNLNLNLN;,LNLNLNLNLNLNLNLNOLNLNLNLNLNLNLNLNLNLNLNLNLNLNLNLNLNLNLNLNLNLNLNLNLNLNLN`DE*EFP[8[^FLNK*KGH LNLNWLNLNIILNLNLNLNLNZ|LNLNLNLNLN^E]:^~E*FLN98>LNLN:I;FLNWLN8zLNLNLNLNLNLNLNLNLNReceive File - UMODEMFile %s not found in the Filecabinet.File %s not found in the specified directory.File %s cannot be created in the Filecabinet.File %s cannot be created in the specified directory.File transfer in progress. Execute command at later time.te.hlpLocal CommandCan't create window. Close another window and try again.This function is not supported on the remote terminal.Communication processor is processing data. Some data might be lost if continued./usr/lib/ua/ate_infowprint_LNLN[1@ Error in writing via pipe.Error in writing via pipe.Error in writing via pipe. 3 3 3 3 4 4 41 4@ 4N 4^ 4h 4w .p .p 4 4 4 4 4 4 4 4 4 4 5 on %s Host printing is in progress. Initiate printer at a later time.*PRINTING* Communication processor is processing data. Some data might be lost if continued./usr/lib/ua/ate_infowprintoff /tmp/logError returned from menu is %d Bad key returned from menu is %d User ErrorCommunication processor is processing data. Some data might be lost if continued.Recording on file : %s*PRINTING*/usr/lib/ua/ate_infowscapon %s Host printing is in progress. Initiate file capturing at a la / / 5, 58 / / 5[' L 5i /\ / 5x' t 5' ɜ 5 /\ / 5 /p 0p 5' 5 0 0 5ter time. *PRINTING*/usr/lib/ua/ate_infowscapoff Host printing is in progress. Cancel file capturing at a later time.Can't open file %s.Transmitting ASCII file : %sFile transmit error, bad writeFile transmit error, bad writeFile Exists, do you want to overwrite?-sbtt7-rbmtmt7m:Am:A2:W:S:P/usr/bin/umodem/usr/bin/umodemFile transmit error, bad writeUnknown key. Use Arrow keys, Enter, and Home/usr/lib/wfont/system.144.ftwrm %srrm %s/usr/bin/getoff.sh %s/u 1 1 5 1 1 6 1\ 1\ 6! 6G 6u 61234567890 !!!!!!!!))))))))1111111199999999AAAAAAAAIIIIIIIIQQQQQQQQYYYYYYYYaaaaaaaaiiiiiiiiqqqqqqqqyyyyyyyy !!!!!!!!))))))))1111111199999999AAAAAAAAIIIIIIIIQQQQQQQQYYYYYYYYaaaaaaaaiiiiiiiiqqqqqqqqyyyyyyyy Record Screen to File Stop Recording to File Transmit File - ASCII Receive File - UMODEM Transmit sr/bin/geton.sh %scan't open host communicationscan't open host communicationscan't open host communicationsProfile %s cannot be accessed, bad permissions. Try using 'Security' command to change above profile to 'Read and Write=Public'.Profile %s not found in Filecabinet/ProfilesUnknown error in opening profile %serror reading profilecorrupt profileerror reading profilecorrupt profileprofile overflowerror reading profileprofile underflowYou are making a remote call from a remote terminaFile - UMODEM*Terminate File Transfer Start Printer Stop Printer Emulator Reset Set TabsLocal Commandsavailable choicesBinaryASCII (8-bit)ASCII (7-bit)StandardModem ProfileRS232 ProfileWord ProcessorSpread SheetBusiness GraphicTransfer ModeSelect transfer mode from list.DescriptionSelect file description from list.Name of File:Transfer Mode:Name of File/Directory:Name of File:Transfer Mode:Description:Name of File:Record Screen to FileTransmit File - ASCIITransmit File - UMODEMl. This profile was created to run from the console. The terminal type will be defaulted to REMOTE.You are making a remote call from a remote terminal. This profile was created to run from the console. The terminal type will be defaulted to REMOTE.You are making a remote call from a remote terminal. This profile was created to run from the console. The terminal type will be defaulted to REMOTE.You are making a remote call from the console. This profile was created to run from a remote terminal. The t   erminal type will be defaulted to VT100.Undefined terminal type in profile.Can't open auto-logon capture fileProfile %s cannot be accessed, bad permissions. Try using 'Security' command to change above profile to 'Read and Write =Public'.Profile %s not found in Filecabinet/ProfilesUnknown error in opening profile %sError in writing profile.:A2 BT Bc Al Al Bp B I R S S S JH S# S) S/ SD J SV S\ Sb Sy B B B B B BlaTerminal SetupEdit Profileterminalset-upterminaluser pf set-upuser pftabs/ marginsruler quit quitPlease select a menu entry or SLKWaiting for receiver...TIMEOUT OK Sending block %d or %d bytes TIMEOUTBADUNEXPECTED REPLY: %c%c Retry %d, OK TIMEOUT on receiver termination Waiting for sender...TIMEOUT %dUNEXPECTED REPLY: %c%c TIMEOUT after 10 retries OK Receiving block %d or %d bytes TIMEO K S S@ S S L Fh  E  G  I  HL  I 0 L: @ Jf  K  K  D S  S Fh S  S G S T E T T2 I TB TZ HL Ta Ty I T~ TUT on block # MISMATCH on block # TIMEOUT on reverse block # MISMATCH on reverse block #: %x OK BAD CHECKSUM Retry %d, Receiving block %d or %d bytes TIMEOUT %dUNEXPECTED REPLY: %c%c Q2 Q8 Q> QI D Q[ Qa Qg Qt  L: T T Jf T T K T  T K T  U D U U! UA( 2 UL U{ ̈́ U U%* U V ( V VK%* z VP V V V%*  V W p W! Wa%* Wf W  W W%* f W X2 и X7 Xw%* X| X \ X Y%* Ѯ Y YH YM Y%* R Ex  Q Q Q Q Q Q Q Q F" Q Q Q Q Q F R RY Y  Ҥ Y Z %* Z Z^  H Zd Z %* Ӛ Z Z  Z [1 %* > [7 [x  Ԑ [~ [ %* * [ \  4 \ \K %* Ն \Q \ N N \ Mx Mx No Yes Auto Logonavailable choices No Yes Check Parityavailable choices 110 bps 300 bps 1200 bps 2400 bps 4800 bps 9600 bps Baudrateavailable choices No Even Odd Parityavailable choi G R R R$ R8 H. RJ RW Rd Rq R~ R R R R H R R R R0 R Rcesscrollpage Off On RS232 Modem Controlavailable choices VT100 513BCT UNIXPC REMOTE VT100-132 513BCT-132 UNIXPC-132 Terminal Typeavailable choices 5 6 7 8 Bits per Characteravailable choices No Yes Local Echoavailable choices No Yes Flow Control To Hostavailable choices No Yes Flow Control From Hostavailable choices 1 2 Stop Bit(s)available choices Baudrate : Send Parity : Check    Parity : Terminal Type : RS232 Modem Control : Character Size: Stop Bits: Character Echo : Flow Control to Host: Flow Control from Host: Auto Login : Timer:Enter receive timer in seconds.File Name:Enter the name of file to capture screen data.RS1:Enter receive sequence. Use \E, \e, \q, or \Q to Exit Emulator.SS1:Enter send sequence. Use \r for CR, \b for BREAK, and \n for LF.RS2:_J _Y ^File to AccessSelect the file you wish to access or enter file name or folderRead permission denied for file %s.Read permission denied for file %s.File %s does not exist.Empty file foldeEnter receive sequence. Use \E, \e, \q, or \Q to Exit Emulator.SS2:Enter send sequence. Use \r for CR, \b for BREAK, and \n for LF.RS3:Enter receive sequence. Use \E, \e, \q, or \Q to Exit Emulator.SS3:Enter send sequence. Use \r for CR, \b for BREAK, and \n for LF.RS4:Enter receive sequence. Use \E, \e, \q, or \Q to Exit Emulator.SS4:Enter send sequence. Use \r for CR, \b for BREAK, and \n for LF.RS5:Enter receive sequence. Use \E, \e, \q, or \Q to Exit Emulator.SS5:Enter send sequence. Use r or file folder does not exist. `P `U `\NameSuffixDescription/usr/lib/ua/SuffixesrLOGDIRLOGDIR/Suffixesr!#%+,-.:_~heap_cpy: out of memory%s/%s%s/%sr%s/%sFile folderExecutable fileStandard file%-14s - System/%srFile folderYou may only open a folder if it is your only selection (you have made %d selections)Empty folderFile does not existFile folder does not existStandard fileExecutable file m m m m m m m m m m n \r for CR, \b for BREAK, and \n for LF.RS6:Enter receive sequence. Use \E, \e, \q, or \Q to Exit Emulator.SS6:Enter send sequence. Use \r for CR, \b for BREAK, and \n for LF.RS7:Enter receive sequence. Use \E, \e, \q, or \Q to Exit Emulator.SS7:Enter send sequence. Use \r for CR, \b for BREAK, and \n for LF.RS8:Enter receive sequence. Use \E, \e, \q, or \Q to Exit Emulator.SS8:Enter send sequence. Use \r for CR, \b for BREAK, and \n for LF.RS9:Enter receive sequence. Use \E, \e, \q, or \Q to En n n n n n n n n n n n n n n n n n n n n n n! n$ n' n* n- n0 n3 n6 n9 n: n; n< n= n> n? n@ nA nB nC nD nE nF nG nJ nK nL nM nO nQ nS nU nV nW nX nZ n\ n^ n` na nc ne ng ni nk nm nn no np nq nu ny n} n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n xit Emulator.SS9:Enter send sequence. Use \r for CR, \b for BREAK, and \n for LF.RS10:Enter receive sequence. Use \E, \e, \q, or \Q to Exit Emulator.SS10:Enter send sequence. Use \r for CR, \b for BREAK, and \n for LF.RS11:Enter receive sequence. Use \E, \e, \q, or \Q to Exit Emulator.SS11:Enter send sequence. Use \r for CR, \b for BREAK, and \n for LF.RS12:Enter receive sequence. Use \E, \e, \q, or \Q to Exit Emulator.SS12:Enter send sequence. Use \r for CR, \b for BREAK, and \n for LF.RS13:n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n o o o o o o o o o o o o o o! o% o) o* o, o0 o4 o8 o< o@ oA oB oC oG oK oO oS oW o[ o_ oc od oe of og oh oi oj ok ol om on oo op oq or os ot ou ov oz o~ o o o o o o o o o o o o o o o o o o o o o o o o o o o o o Enter receive sequence. Use \E, \e, \q, or \Q to Exit Emulator.SS13:Enter send sequence. Use \r for CR, \b for BREAK, and \n for LF.Auto-Logon SequencesTerminal SetupCan't create a new window.te.hlpTerminal SetupCan't create a new window./dev/windowBig TroubleCan't create a new window.te.hlpAuto LoginCan't create a new window.User PF keys not implemented yetTabs and soft margins not implemented yet/bin/shshno match for menu initializationpage mode not implemented yet o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o p p p p p p p p p p p p p p p p p p# p& p) p, p- p. p/ p0 p1 p2 p3 p4 p5 p6 p7 p8 p9 p: p; p< p= p> p@ pB pD pF pG pH pI pK pM pO pQ pR pT pV pX pZ p\ p^ p_ p` pa pb pc pd pe pf pg ph pi pj pk    pl pm pn po pp pq pr ps pt pu pv pw px py pz p{ p| p} p~ p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p q q q q q q q q q q q q q q q q! q% q) q* q, q0 q4 q8 q< q@ qA qB qC qD qH qL qP qT qX q\ q` qd qh VNMOMOROWNNNHNLOcOdOeOfOgOhOiOjOaOnOsOxNcNeNiObOoOtOyNdNfNjOkOpOuOz9NgOlOqOvNaOmOrOw0NhPaPbPcPdPePfPgPhPiPjPkPlOCODOEOFOGOHOIOJOAONOSOXNCNENIOBOOOTOYNDNFNJOKOPOUOZNBNGNKOLOQOVNMOMOROWNNNHNLOcOdOeOfOgOhOiOjOaOql qp qt qu qv qw qx qy qz q{ q| q} q~ q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q r r r r r r r r r r$ r( r, r0 r4 r8 r9 r: r; r< r@ rD rH rL rP rT rX r\ r` rd rh rl rp rt rx r| r r r r r r r r r r r r r r r r r r r r r r r r r r r r r r r r r r r r s s s s s nOsOxNcNeNiObOoOtOyNdNfNjOkOpOuOz9NgOlOqOvNaOmOrOw0NhNo filename was specified//usr/lib/wfont/system.144.ft/usr/lib/wfont/system.144.ftCan't load /usr/lib/wfont/system.144.ft into slot %d/usr/lib/wfont/UK.ftCan't load /usr/lib/wfont/UK.ft/usr/lib/wfont/BLD.ftCan't load /usr/lib/wfont/BLD.ft/usr/lib/wfont/ELD.ftCan't load /usr/lib/wfont/ELD.ft/usr/lib/wfont/VBM.ftCan't load /usr/lib/wfont/VBM.ft/usr/lib/wfs s s s s s s s! s" s# s$ s% s& s' s( s) s* s+ s, s- s. s/ s0 s4 s8 s< s@ sD sH sL sP sT sX s\ s` sd sh sl sp st sx s| s s s s s s s s s s s s s s s s s s s s s s s s s s s s s s s s s s s t t t t t t t t t t$ t( t, t0 t4 t8 t< t= tA tE tI tM tP tT tX t\ t` td th tl tp tt tx t| t t t t t t tf1f2f3f4f5f6f7f8f9f0f-ont/SCLD.ftCan't load /usr/lib/wfont/SCLD.ft/usr/lib/wfont/ROMC.ftCan't load /usr/lib/wfont/ROMC.ft/usr/lib/wfont/ROMG.ftCan't load /usr/lib/wfont/ROMG.ftch_pagestate: entry, putcurs_flag=%d, actions.paging=%d cleanexit: exitcode = %d xformcup: entry, line=%d, col=%d, writeout=%d display_mem: entry, line=%d, column=%d display_mem: about to loop, out_lines=%d, scr_lines=%d display_mem: in loop, out_lines=%d, line_info=0x%x display_mem: finished loop display_mem: last scr_output df=!@#$%^&* 741-8520 ,963.OcOdOeOAOBOCODOj741-8520 ,963.br OwOtOqOmOxOuOrOp OlOyOvOsOnOPOQOROSOAOBOCODOwOtOqOmOxOuOrOp OlOyOvOsOn 741-8520 ,9one display_mem: **ERROR-NULL line pointer found display_mem: about to flush display_mem: exiting first_page: entry getfree_meml: entry, free_list=0x%x getfree_meml: take from top=0x%x getfree_meml: take from bottom=0x%x init_scrnmem: exit, free_list=0x%x, top_line=0x%x, top_vis=0x%x, bot_vis=0x%x, bot_line=0x%x, cur=0x%x last_page: entry, bot_vis=0x%x, bot_line=0x%x, line=%d last_page: line_counter=%d, line_info=NULL line_scrnmem: entry, top_line=0x%x line_scrnmem: top_visabl63.cdeABCDj741-8520 ,963. ?w?t?q?m?x?u?r?p ?l?y?v?s?nPQRSABCD?w?t?q?m?x?u?r?p ?l?y?v?s?nPaPbPcPdPePfPgPhPiPjPkPlOCODOEOFOGOHOIOJOAONOSOXNCNENIOBOOOTOYNDNFNJOKOPOUOZNBNGNKOLOQOe=0x%x, number of lines=%d line_scrnmem: current_line=0x%x, scr_lines=%d line_scrnmem: line_info=NULL, error, i=%d, previous=0x%x line_scrnmem: new top=0x%x, next=0x%x, prev=0x%x page_back: entry, top_visable (0x%x) previous = 0x%x page_back: previous is not NULL page_back: line_counter=%d, scr_lines=%d page_forw: entry, bottem = 0x%x, next = 0x%x page_forw: next is not NULL page_forw: line_counter=%d, screen_state.scr_lines=%d page_forw: now line_counter=%d, screen_state.scr_lines=%d    pixel_addr: entry, coded_address=%s, line=%d, column=%d put_cursor: entry, line=%d, column=%d [%2d;%2dHroll_down: entry rd: shado is '%s',next = 0x%x roll_down: next is not NULL roll_down: top_vis=0x%x, '%s', top_vis->next=0x%x roll_down: bot_vis=0x%x, '%s', bot_vis->next=0x%x roll_down: cur=0x%x, '%s', cur->next=0x%x roll_down: output(0x%x)=<%s> roll_down: (exit)top_vis=0x%x top_vis->next=0x%x roll_down: (exit)bot_vis=0x%x bot_vis->next=0x%x roll_down: (exit)cur=0x%x cur->ne/< XN1X OQ./HJf/H#0Nnext=0x%x roll_up: bot_vis=0x%x, '%s', bot_vis->next=0x%x roll_up: cur=0x%x, '%s', cur->next=0x%x roll_up: output(0x%x)=<%s> roll_up: (exit),top_vis=0x%x top_vis->next=0x%x roll_up: (exit),bot_vis=0x%x bot_vis->next=0x%x roll_up: (exit),cur=0x%x cur->next=0x%x save_scrvars: entry, actions.paging=%d xsetwrap: entry setwrap=%s wrapmode=%d NOYESsound_/< N1XO# E8rgDp ./< k/9 E8N1,PO-@plp o . hN1|. E8N1B# EJ DfN-@p n./<  /<0N1POBN. ;N1z-@Jg6.  HnN1XO.HnN1XOBBBHnNlO p ;gDp Df". 0N1 ./< +/9 ;N1PO. ;N1B. ;N1lp Df`. 'N1 ./< "/9 ;N1PO. ;N1B. ;N1Bp# ;# ;N.BN8p.N1. </< ,HnN1PO. <NVJg . 8HnNXOp.N`X. DN1# D`. <N# ;# ;. DN1# DdJ ;lj. <N&. ?HnNXO 9 ;D.N 9 ;D.N 9 ;D"| . 9 ;D"| D/1`. FHnNXOp .NBN. EN1Jgt. <N&. </< PHnN1PO.^HnNXOp.Np.Np n Hn/< \/<0N1Bp n./< 5/<0N1POJfNB D.N1xL N^NuN`NVHp n. |/< C/<0N1POt`Np n( "逐"| E@A./< O/<0N1PO "逐"| E@A.N1R |mLN^NuNVH$../N1nXO./< eHnN1PO. oHnNXO.NLN^NuNVH$..0/< vHnN1POHn/< yNPO./< HnN1PO. HnNXOBp/N1nXOBp/N1nXON.NBN8NjN1.N1JN1LN^NuNVp./< EN1XON^NuNVHO `.$p/N1nXOpZ.N1-| o^. ;HnNTXO-@JglBN1. </< HnN1PO. <N&.^HnNXOp.Np.Np nf.^/< ` .SfrBN1p.Hn/< N1POJf~. <N1 ./< <HnN1POJgX. <N&. HnNXOp.Np.Np n.^/< /<0N1`p nHn/< /<0N1O J gHn/< NPO-| ^. <N-@J g. @H/< NXOHn/./< @H/< HnN1O. ;HnpS/N$n`RJg  fJgB J LN^NuNVHt` .N1BRpPmLN^NuNqNV H B.  /<  N1RXO$@ f B/< -/< "NPOp.Np nT. K/< A/<0N1PO`8p n. \/< R/<0N1POHn$NXO&np-@Hn$/.HRNO $n.N1FJlJg .L N^Nu `p n. m/< c/<0N1PO.Hn$/N`POrf .N1Bp` `NVH$np n./< t/<0N1POp n./< /<0N1PO# H H.N rf pLN^Nu y HA./< 4POp-.N1. ;HnNTXO-@p nHn/< /<0N1O JgBN1. <N&`^ .RfBN1 .BfN. <N&. /< NXOp.N. BJ HgBN1. HN1-@ .Ѐ"瀐"y HA-Hp n./< ,/<0N1< /<0N1POJlBN1p n. /< /<0N1POHnN1XO ../< I/< D/< /< HnN1O. )HnNXO n.N&p`J.NBN1HnN1XO.0N1L ../< I/< D/< >/< 0HnN1O. CHnNXOJgx. 6HxT/.N1POBy 6By 6By 6 6 6. 6HxT/.N1POJlLp nB.0/< F/<0N1`&Bp//.N1POr.p//.N1PO .`0NVH $np-@p n. g/< ]/<0N1PO. POp n./< 4/<0N1POp n n . /< >/<0N1POp n. H/< G/<0N1POJ Hg@# G(t Hl, 9 HЀ"瀐"y HA"ne-y Hp n n./< P/<0N1POp n n. /< Y/<0N1POp n n./< a/<0N1PO n f n . n/(N1XOrgp n n./< i/<0N1POJ Ifz n.NVrg n.N3 "fNB I`2. +/< $NXOp n. ;/< ./<0N1POpLN^Nup/< hN1RXO&@ flB/< /< NPOp.N`H. ; y HHh" y HHh y HHh y HHh/< HnN1O$plBHn/< NPOp.Np n y HA./< /<0N1POp n y HA./< /<0N1POp n y HA./< /<0N1POp n y HA"./< /<0N1POp n. ;/< /<0N1PO 9 Hй Hrm. /< NXO 9 Hй Hrm B/< /< NPOp.N 9 Hй HЀ"瀐"| G0A-H.  y HHhN1X n n./< s/<0N1PO n(g n ; n. /< ~HnN1PO n./< HnN1PO n./< /< GN1POp n n./< /<0N1POp./<  n/( N1POJf8p.HnN1XO# op . n/(/< DN1PO` p-@.HnN1XO# mj3% 6 6-| ` "nf n-hP nJlp n./< /<0N1POJl"./< /< NPOp.N0.@ 3 6p np09 6./< /<0N1PO. 6HxT/9 N1POJm\pOJf0. y HHhN1XOJfb.N1FpL N^Nu. " y HHhN1XOJfj. y HHhN1XOJf. y HHh"N1XOJf. y HHhN1XOJfR H n`DHn/*N\PO. &HnN18XO(HnN1 XOf. 9 y HHhN1XOJfJ. y HHhN1XOJf\. y HHh"N1XOJf@R H n`V. = y HHhN1XOJf. y HHhN1XOJf. y HHh"N1XOJfp. y HHhN1 XOR/N1TXO @"n#H nJ g y HA. n/( N1XOp- nHn/< /<0N1O . A/./< . I/< D/< Hn0N1O . Hn0NXOpLN^Nup-./.N1&XO-@Jg @RB./.NXOJfp.N1. R"n /1NXOTmp`NVH$| 8 . /.N1XOJgVB. EN1Jg. /< `n.7p/N1nXOp-.N1`p.Hn/. N1,PO$n@BN1p n./< /<0N1PO. /< NXO`/< }Hn,N1O. Hn,NXO .``NV n . N .N1V-@Hn n /(NPOp nHn/< /<0N1O HnHxP/.N1O .HnHxP/.N1O Jl$p n.0/< /<0N1POHnHxT/.N1O BnBnBn mp `p@=@||HnHxT/.N1O Jl$p n.0/< /<0N1POJy g. HxP/.N1POHnHxP/.N1O Jl*p n.0/< /<0N1PO`B.`^.HHCA.HxP/.N1POJl2p.HHrr m.HHrr~o p nB.HHr./< `p n".HHr./< /<0N1PO.gRJ 96eBN1pLN^NuB. 8 /.NdXOJfBN1p`NVp./< EN1XON^NuNVH $. v-C./< NR..HHCJ1f. VHxP/.N1POJl6. j/< XNXOBy . {HxP/.N1POpN^Nu3  .`NVH $np n. /< }/<0N1POp# Dp./< N1XO$pfp n.0/< `:.HxC /N`POrf2.N1Bp n.0/< /<0N1PO`tp n./< /<0N1PO. HxS/N1POrf$.N1Bp n&.0/< `. (HxS/N1POrf$.N1Bp n.0/< /`Tp./<0N1POB`p n. /N`O rf$.N1Bp n.0/< `. EN1JgD.N1Bp n. /< /<0N1    PO. /< NXO`.7p/N1nXOp.N1BnHnHxC?/N`O rf,BN1.N1Bp n`.0/< `BN1Jng$.N1Bp n.0n./< `p.HxC)/N`POrf$.N1Bp n.0/< 5`^p.HxS/N1POrf$.N1Bp n.0/< ^`". /< xN. rpH/NXOJf y IhN#T B#4 FpLN^Nu .NWf,pg ./< /< tNPOp.Nt`N>. /9 /< /< jNO Jf . pH/N,XOJf"HnVpH`|. pH/N XOJftVH$.p-@N1# 98. /< HnVN1POB9 jB D. @(/< <(N1XOB Mp n./< /<0N1POpX.Nzpf. Mp/. /9 /< jNfO -@f . `  y MpPUpm./9 MN1&XOJgp`p-@po./9 MN1&XOJgp`p# Mpn./9 MN1&XOJgp`p-@p n./< /<0N1POp n. M/< /<0N1POp n. M|/< /<0N1POB.Vp-@`2. HnVN1XO ."| Mp.HnVN1XOR .ʰmpozp../< jN1&XO-@Pp`@. MpHnVNhXO-@. MtHnVN1XOp nHnV/< /<0N1O # M Il .!Vg.p;.HnVN1&XO @ f p;./9 MxN1&XO @ fpo . `pm./9 MN1&XOJgp`p-@HnVNxXOHnV/< </< NO JgT. pX/NXOJfHnV/< NPO . HnVN1XOHnV/< <HnV`. MxHnV/< HnVN1O R D. HnVNXOHnVNXO. pX`\p!.HnWN1&XO @-HPgA.HnPN1XOp!.HnPN1&XO @ g.PHnPN1XO. <HnPN1XO. HnPNP.P/< HnVN1PO. @(BBHnVNlO -@pm"./< j/<  NPOp.N .XUf8# M IlHnV/< &HnVN1O . +HnVNXO`x. M|/< 3/< <(N1PO. M|/9 Mx/9 Mt/9 Mp/< 6HnVN1O. BHnVNXOJ gD. M/9 M/9 M/9 M/9 M|/9 Mx/9 Mt/9 Mp/< JHnVN1O$J g. _HnVNXO .SUf<# M Il. MtHnVN1XO. g/9 MN1XOJflHnVNxXOHnV/< k/< <(NO JfHnVNXOJg0. s/< lNXO . MN%.1XO. M|HnPN1XO$y Mtp!./ N1,XO-@.R.../< N .r2.ڰg" .-@ .r2.ܰg .-@p0.g@p.Hn 9 # R # "逐"| NAHPN1PO`.N1F`NVHp`nb @7g @bfx`vt(J`HHr0ԀRL rl 0m 7oJf \N` E`0 `* @rg @sg @tf ` `  `\RJJfBX nJfLN^NuNqNVH $n .p/p//< :N1dO rg pL N^NuJy :gt&| :`(gRpmB*p`NVH<n|.B.J $f. $/. N1RXO$@ fB/. /< $NPOp.Ntpl "| :BR`HnN1 XOCAKHnN1 XOCA-HG`R ncBp nHn/< $/<0N1O J.gH n./< #/<0N1POp2 # o.p./. 9 # R # "逐"| NAHPN1POLN^NuNVHp nB/< #/<0N1PO$| Nt`6. "逐"| NAHPN1XOJl "逐"| NER # m././< #/. N1O S # p. 9 # "逐"| NAHPHRN1POLN^NuNVH./.N2XO$f*./. /< #/.NO JfpLN^Nu `NVHJ #g<. QxN-@Jg$. #/< #/< #NPOp.NB #$| Qxv #l> nJg./N1XOJg& n Jgp./*/N1POJgRnNXOJfvHnNVXOJfdHnN&XO. $/< :HnN^PO# $p $n2J fJ $gpBN1. $N1# X``HnHRNPOrfp nHn/< $/<0N1O HnHnNp n ./< $/<0N1PO .E` #m0 nJf$y #`$y # fp n./< #`8&n`F /f>./< #N C& S !gXKRB\`8pѓ SJfր C&XKR`BE.HxHnN1PO @ g^ .#g . g . g . gR #pd #mdp.HnN1 XOR/N1TXO @-HfT`:.N1Fp`6NVH$n&n BJ #g<. QxN-@Jg$. #/< $G/< $:NPOp.NB #(| Qxt`p.HS/,N1POJf4p-@./N1XOJfvp nX,HH./< $H`8 lJfP./N1XOJf@Jf/.Hn/< %HSN1O.HxHnN1PO @ g.HnN1XO`.N1F.N1FJf. %N8. %N1 .`NVHB/< %N1 XO$g. %N8pLN^Nu. %N1. &/< & N1XO$. &3N1. &GN8 `NV. &^N1. &rN8N^NuNVH $n$. Bn-Jp nN. &/< &/<0N1PO`2$n=|`&Jg  fJngBpL N^NuJngp.Hn/N1,PO-@rfJ.p n.@H. o | &` | &HP/<0N1PO9 &fz`jBp`NVH . $n:p n,HH./< $W/<0N1PO,HHLN^NuIR #mPp`NVHB/.N1 XOrf.HnN1XOp/.HnN1,XO$@ gBHnHnN1tPO$pfJ g>pg\Hn/< $fNp./< -/N1POJf"./< -/< XN1PO n XX nJfN^NuNqNVH$nHnN1XOG(J`RLgAeB*LN^NuNqNVH1-@p<. .N1-@p<. .N1-@-@././/< +/9 *N1O. D/9 Dl/9 D/9 Dh/< D 9 Dй D D D/ 9 Dй D D D/ 9 Dx Dtr>>,82NVJ 0g./<0N1XON^NuNVH$n. 0N1 $.N1 Ђro. 1N LN^Nup.HR/< ;(N1PO. 0/< ;(N1XO. ;(N @`NVH$np.HR/< ;8N1PO.N1 rl".N1 r./9 0/< ;8N1POB9 ;G$| ;8`HH"|0 1g RJf | ;8 LN^NuNVHp-@J Df.N1Jf pLN^Nu$| 1@`  f-jPJJlp n./< 1/<0N1POJl"./< 1/< 1NPOp.NHnH#   xT/.N1O BnBnBnJg=n`nJg <`p@n||HnHxT/.N1O -@Jl./< 1/< 1NPOp.N`NVJ Df.N1JfpN^NuHnHxT/.N1O .fHnHxT/.N1O `NVH$.J Dg pLN^Nu.N1JgBHxT/N1PO`NVH. J Df. ;N1Jf pLN^Nup nHH./< 1/<0N1POHH @Rg6 @Sg @XfJ 1gB 1. ;lHxT/9 ;N1PO`. ;ZHxT/9 ;N1PO | ;Z"| ;l""""2N10XOBR./< 3/.N1PO# D./< 3HRN1PO.N1F. 3N8p`NqNVH.N1$@ f nBpLN^Nu./.N1XO./. N1XOp`NVH.N1$@ f nBpLN^Nu./.N1XO n p`NqNVH $n&n fJfpL N^NuJgp`NVHJ f-| 3 Jf-| 3p n./< 3/<0N1PON1$f.p/N1nXO.p/N1nXO.p/N1nXON. ;N1B. ;N1BBN1BB/. N1XO(g.N1xp.N1B.@ ;g. ;ZHxT/9 ;N1POR 1`8NVJ DgpN^Nu. ;HHxTBN1PO-@09 ;L@@ 3 ;L ;Ky ;N .`NVJ DgpN^Nu. ;HHxTBN1PO`NVH J g$|0`,BN1-@. 1/< 1N1RXO$@.N1 gN1-@. ;/< 1HRN1PO./< 1HRN1POHnN1XOHnN1XO&@./+/+/+ +R//< 2 HRN1O./. /./< 2!HRN1O.N1FL N^NuNqNVH . 20/.N1RXO$@ f`.N1FpL N^Nu. HnN1XOHn/. N1tPOJfhp0./.N1HXO(pg.N1x. ENPOp0g p0fJ. N1`>. N1Jl0.0/. /< 4EHnN1O Hn/< 4SNPOpLN^Nup.Hn/N1PO.N1B./. N1XOJm. N1Jl0.0/. /< 4\HnN1O Hn/< 4bNPOp`NV./< 4o/< 4iHnN1OXOBN1-@,. <(BBHn0NlO $.,N1 `NV.NJfpN^Nu nA./< 2/<0N1POp`NqNVHnNnXOR9 fR9 Hn/< .HH//. . HH//< 2/.N1Op n./< 2/<0N1PON^NuNVHt`"p ./< 2NʬXOJgp.N1Rpmpm B/< 3/< 3NPOp.N. 3./< 3N1RXO$@ gjHn/< 30HRN1O ./< 3G/< 34N1XPO$@ f B/< 3V/< 3INPOp.N./< 3iN10XO`>. 3/< 3|N1RXO$@ f pLN^Nu./< 3 HnNXON^NuNV./< 4z/< 4tHnN1O .HnN(XOJlpN^Nup`NVHHnN1XO-@t`, "| XJgHn "| X/1N1POR 4mLN^NuNqNVN1Jf.NN^NuNVBN1Bp.N1Bp.N1BB/< 4N1XOp./< 4N1XOp./< 4N1XO.p/N1nXO.p/N1nXO.p/N1nXON nJgJ./< 4HnN1PO. E/<0N1PO9 Xf.N-@| f$-| |0y X./< 6Q/<0N1PO3~ XBN1# Xp n./CBCALLBACKREQUIREDCALL BACKBAD LOGIN/MACHINE NAMEFAILEDFAILEDLOGINBADSEQPREVIOUSBADSEQOKBAD SEQHANDSHAKE FAILEDBADSEQchmod 600 SYSTEM STATUSCAN NOT CALLSYSTEM STATUSCANNOT CALL SELF%c.%.6schkNO WORK    call to %s LOCKEDFAILEDSUCCEEDEDcall to %s %s - wrong system BAD LOGIN/PASSWORDcall to %s %s - failed here=WRONG SYSTEM%s - failed valid sys %s HERETIMEOUTsend Myname%.7s -Q%d %smsg-%s BAD SEQHANDSHAKE FAILEDOKHANDSHAKE FAILED Rmtname %s, Role %s, MASTERS< 6d/<0N1PO.N1-@Br//.N1PO.p/p//< XN1jO `0y X./< 6l/<0N1PO. XN1F.N1F. 6N8B X.p/N1nXO.p/N1nXO.p/N1nXOpLN^Nu. 6/<0N1XOp`NVBN8N^NuNV . pN^NuNVJN^NuNqNV-n B-n . Cgn CgnT Cgn& Cg Cg Cg`p ` Cg Cg Cg` Cgn C g C g^ C gV`^ CgJ Cgp CfBp`t C>g0np C(gLAVEIfn - %d, Loginuser - %s startupFAILEDSTARTUPstartupOKTALKINGcntrl - %d %s %s %s %ldconversation completeOKconversation completeFAILEDCONVERSATIONOOOOOsend OO %d,CICO: Fwdsys - ret restline - %d chmod 666     exit code %d TM_cnt: %d TM file unlinked: %s SIGNAL %dCAUGHT%dINTREXITSIGNAL %dintrEXITn, `  % K q t w z } /usr/lib/uucp/L.sysrCAN'T OPEN/usr/lib/uucp/L.sysfindn. Cg@ Cg8 Cf B`-|` C)g C%cBREAKEOT    BLANK DELAY NO NL NO NL - MIDDLE IGNORED NULL CHACOPY FAILED (reason not given by remote)local access to file deniedremote access to path/file deniedsystem error - bad uucp command generatedremote system can't create temp filecan't copy to file/directory - fiRACTER BACKSLASH BAD WRITEBAD WRITE2 SuMoTuWeThFrSa%dWkAny%d-%d%s/dev/%sLINE IN USEPHONEphone - %s/dev/%sLine open %s failed%s %s P%s %ldDIALUP LINE openLine dialling %s failed%s %s P%s %ldDIALUP LINE diallingFAILEDChanging file mode %s failed%s %s P%s %ld Changing line mode%s %s P%s %ldDIALOKcall phone number %s ioctl PIOSETP/ s4 dial failed: %d ioctl TCSETA/ s4 dial failed: %d ioctl/PIOCOFFHOOK s4 dial failed: %d ioctl/PIOCDIAL s4 dial failed: %d NO DIALTONEle left in PUBDIR/user/filecan't copy to file/directory - file left in PUBDIR/user/fileforwarding error%s/*** TOP *** - role=%d, cntrl %d cntrl%s cntrl%s /usr/lib/uucp/uuclean -n0 -p%sARG COUNT<5 - file removedX %sREQUEST%s%s %s %s %sREQUEST%s %s %s %s %s %s %sREQUESTD.0DENIEDACCESSaccess deniedrD.0rCAN'T READ %s %dFAILEDN2D.0rCAN'T RREAD %s %dFAILEDcan't accessDENIEDACCESSaccess denied%s/TM.%.5d.%.3dwCAN'T CREATE TMFAILEDTemp file storedwrktype - %c PROCESSCONNECT FAILED: $BUSY or NO ANSWERCONNECT FAILED: slancall: entered%s /dev/starlanslancall: open(/dev/starlan) errno=%d slancall: CS_MY_ID failed errno=%d slancall: open ret=%d ccmodslancall: push(ccmod) errno=%d urpmodslancall: push(urpmod) errno=%d slancall: net_ioctl(N_ANAME) errno=%d STARLAN.SERVEslancall: using name %s slancall: net_ioctl(N_CONNECT) errno=%d timeout on connect%s connectTIMEOUTslancall: net_ioctl(N_RCV_CONN) errno=%d slancall: conresp.reason=%d slancall: net_io: msg - %s %s RQSTCMPT:REQUESTED%s HUP:YWRONG ROLEchkYNXUUCP-slave: filename is %s NNXUUCP DENIEDN2%s %sxuucp stringY!~//usr/spool/uucppublicNO FWDING TO NONPUB DIRN7/../ILLEGAL FWD ATTEMPTN7INVALID FWDR SYSTEM/usr/lib/uucp/ORIGFILENO FWDING FROM/usr/lib/uucp/FWDFILENO FWDING XUUN7Y%[^m]m%stestX %s %s %s %s %s %s %s %s %s D.0DEBUGX-BAD XFILEN7XUUCP-SLAVE file1: %s XUUCP-SLAVE W_FILE2: %s X %s %s %s %s %s %s SNDFILE:REQUESTWRONG ROLEWRONG ROLEfile removedctl(CS_OPAQUE) errno=%d ioctl(I_SRDOPT) errno=%d STARLAN.SERVEslancall: sending NLPS service message%s NLPS:000:001:102ATT service message failed, ret=%d, errno=%d gBx0nB&RT4 n     $ a  in cntrl.cWRONG ROLE/usr/lib/uucp/uuclean -n0 -p%sARG COUNT<5 - file removed%s %s %s %sREQUESTEDmsg - %s SLAVE - filename: %s N2DENIEDPERMISSION/%s%s!/usr/spool/uucppublic/usr/spool/uucpNOT SPOOL DIRN7NO FWDING TO NONPUB DIRN7/../ILLEGAL FWD ATTEMPTN7INVALID FWDS SYSTEM/usr/lib/uucp/ORIGFILENO FWDING FROM SND/usr/lib/uucp/FWDFILENO FWDING SNDN7chkpth ok Rmtname - %s %s/TM.%.5d.%.3dtemp file createdwN4CAN'T OPENDENIEDTemp file storedYINPUT FAILUREIN SEND/SLAVE MODE%   N5YFAILEDSUCCEEDEDCOPY%o->PUBDIR %d DEB1%[^m]m%stest1 %s %s %s %s %s %s %s %s %s DEBUG-BAD SFILEN7YSLAVE Dfile: %s SLAVE file2: %s S %s %s %s %s %s %s %s %s cntrl.c: system.0 - %s %s RCVFILE:REQUESTWRONG ROLEWRONG ROLE/N5YFAILEDSUCCEEDEDCOPYN6Y%oWRONG ROLEREQUESTED/usr/lib/uucp/uuclean -n0 -p%sARG COUNT<5 - file removedmsg - %s W_FILE1 - %s /%sN2DENIEDPERMISSIONchkpth ok Rmtname - %s rN2CAN'T OPENDENIEDSTAT FAILED%s %oYrmesg - '%c' got %s FAILexpecP/usr/spool/uucp/LCK.SQ/usr/lib/uucp/SQTMP/usr/spool/uucp/LCK.SQ @ @imsg %s>%c\%3o r! user: %s ted '%c' got FAILBAD READgot %s expected '%c' got %.25sBAD READgot %.25s wmesg '%c'%.25s notif %d notif %d copy succeededfile %s, system %s %s file %s on %s %s STMES %s a+STM %d uucp job %.4s (%d/%d-%d:%2.2d:%2.2d) (%ld:%ld:%ld) %s %s Nprotocol %s Protocol %s Proto started %c Proto start-fail %c %s/%s//usr/spool/uucppublic%s from %s!%s arrived FREESPACE IS LOWREMOTE TRANSFER DENIED - TOO FEW INODESREMOTE TRANSFER DENIED - not cntl %o alloc change not implemented srj not implemented pkaccept bad:p_is %spkaccept chksum %xpkaccept skip %spkaccept bad %sr short %d want %d rcount = %d xcount = %d chksum:%o LOOK HDR1 retry = %d LOOK HDR1:%ctries = %d rec h->cntl %o bad header %o,h->ccntl %o state - %o bad header %o bp NULL %s Received Data %s pkxstart:osum:%o pkxstart:checkword:%o send %o /usr/spool/uucp/RDWRLOG WRITE HEADER %d PKXSTART ret/usr/spool/uucp/RDWRLOG WRITE HEADER/DATA %d PKXSTART retalarm %d /usr/spool/uucp/RD/usr/spool/uucp/LOGFILEa%s!%s (%d/%d-%d:%2.2d:%2.2d) (%.1c,%d,%d) %s (%s) /usr/spool/uucp/SYSLOGa%s!%s %s SM(%d/%d-%d:%2.2d:%2.2d) (%.1c,%d,%d) (%ld:%ld:%ld) %s [%ld:%ld:%ld:%ld:%ld:%ld:%ld:%ld] [%s,%ld,%d,%ld,%d] %s/%s.%.7sSTSTr%dwSYSTAT OPEN FAIL%d %d %ld %ld %s %s %s/%s.%.7sSTST%s/%s.%.7sSTSTWRLOG READ %d tried %d PKCGET READpkon - %d Ofn - %d -> %ld / %ld secs%s <- %ld / %ld secs%s -> %ld / %ld sec%s <- %ld / %ld secs%s /usr/bin/getoff.sh %s/usr/bin/geton.sh %srCan't openr%hdanlwrkattempt made to use old workfile was thwartedFinished Processing file: %s w%dFOPEN%dbldflrentf %s gtwrk %s/%sgetBAD USERFILEchkpth failure - u=%o /../chkpth failure - spool failchkpth failure - notptr=%d /usr/lib/uucp/USERFILErcBAD USERFILr%d%d%ld%ldMAX RECALLSNO CALLMAX RECALL COUNT %d RETRY TIME NOT REACHEDNO CALLRETRY TIME (%d) NOT REACHED gtcfile0: sys - %s gtcfile1: sys - %s gtcfile2: sqnm - %s %c.%.6s%c%.1s%.4dgtcfile3: jobid - %d a+CAN'T OPENgtcfile4: previous Cfile : %s %c.%.6s%c%.1s%.4dgtcfile - temp: %s || Cfile:%s QUE'DEnter us_crs, cfile: %s /usr/lib/uucp/R_stata+fopen of %s failed mail %sw%s rLOGNAMELOGNAME=%s enter us_rrs, cfile: %s request status: %o /usr/spool/uucp/LCK.RSTATulockf oEcallcheck1 %d callcheck2 %d /usr/spool/uucppublic/usr/spool/uucp/usr/spool/uucppublicrBAD DIRECTRYgns %s gns1 %s srch %s srchst1 %s /usr/spool/uucp/LCK.SQCAN'T LOCK/usr/spool/uucp/LCK.SQcan't lock %s /usr/spool/uucp/LCK.SQ/usr/lib/uucp/SQFILEr/usr/lib/uucp/SQTMPw/usr/lib/uucp/SQTMP%s%d%s %d %d/%d-%d:%2.2d /usr/spool/uucp/LCK.SQ/usr/lib/uucp/SQTMP/usr/lib/uucp/SQTMP/usr/spool/uucp/LCK.SQ/usr/lib/uucp/SQFILE/usr/lib/uucp/SQTMP/usr/lib/uucp/SQFILE/usr/lib/uucp/SQTMf %s failed /usr/spool/uucp/LCK.RSTAT/usr/lib/uucp/R_statr+fopen of %s failed /usr/lib/uucp/R_stat/usr/spool/uucp/LCK.RSTAT jobn : %d /usr/spool/uucp/LCK.RSTAT enter us_sst, status is : %.2d /usr/spool/uucp/LCK.LSTATulockf of %s failed /usr/spool/uucp/LCK.LSTAT/usr/lib/uucp/L_statr+fopen of %s failed /usr/lib/uucp/L_stat/usr/spool/uucp/LCK.LSTATs.sysname : %6.6s /usr/spool/uucp/LCK.LSTAT enter ub_sst, status is : %d Rmtname: %s /usr/spool/uucp/LCK.LSUBulockf of %s%    failed /usr/spool/uucp/LCK.LSUB/usr/lib/uucp/L_subr+fopen of %s failed /usr/lib/uucp/L_sub/usr/spool/uucp/LCK.LSUBin ub_sst name=Rmtname: %s /usr/spool/uucp/LCK.LSUB 1 1*.SERVEnetnodename: nodename arg too long n, `  % Kfixline - speed= %d BAD SPEEDRETURN FROM fixlinesetline - %c /usr/spool/uucp/ERRLOGaASSERT ERROR (%.9s) pid: %d (%d/%d-%d:%2.2d:%2.2d) %s %s (%d) r/full %s w/usr/  % Kfixline - speed= %d BAD SPEEDRETURN FROM fixlinesetline - %c /usr/spool/uucp/ERRLOGaASSERT ERROR (%.9s) pid: %d (%d/%d-%d:%2.2d:%2.2d) %s %s (%d) r/full %s w/usr/spool/uucppublic//usr/spool/uucppublic/usr/spool/uucppublicMKDIRS - usrmkdir %smkdir - %s mkdir %sMKDIRSCan't expand filename (%s). Pwd failed. %c.%.6s%c%.1s%.4sfile - %s LCK.SEQLCAN NOT GETLCK.SEQL/usr/lib/uucp/SEQFr%4d/usr/lib/uucp/SEQFwCAN NOT OPEN/usr/lib/uucp/SEspool/uucppublic//usr/spool/uucppublic/usr/spool/uucppublicMKDIRS - usrmkdir %smkdir - %s mkdir %sMKDIRSCan't expand filename (%s). Pwd failed. %c.%.6s%c%.1s%.4sfile - %s LCK.SEQLCAN NOT GETLCK.SEQL/usr/lib/uucp/SEQFr%4d/usr/lib/uucp/SEQFwCAN NOT OPEN/usr/lib/uucp/SEQF/usr/lib/uucp/SEQF/usr/lib/uucp/SEQFw/usr/lib/uucp/SEQF%.4d%sLCK.SEQL/dev/null/dev/nullshio - %s /bin/shsh-cstatus %d /bin/shsh-cLTMP.%dTOO MANY LOCKSCAN NOT ALLOCATE FOR%s %s %dULOCKCQF/usr/lib/uucp/SEQF/usr/lib/uucp/SEQFw/usr/lib/uucp/SEQF%.4d%sLCK.SEQL/dev/null/dev/nullshio - %s /bin/shsh-cstatus %d /bin/shsh-cLTMP.%dTOO MANY LOCKSCAN NOT ALLOCATE FOR%s %s %dULOCKCULK err %s %dULOCKLNK%s %dULOCKF%s.%sLCK.%s.%sLCK./dev/null/dev/null/dev/null-s%.7s/usr/lib/uucp/uucicoUUCICO-r1/dev/null/dev/null/dev/null/usr/lib/uucp/uuxqtUUXQT/dev/null/dev/null/dev/null%s -r %suucp/bin/shsh-c%.6s%.6s/usr/lib/uucp/L.sysr KILL %s CULK err %s %dULOCKLNK%s %dULOCKF%s.%sLCK.%s.%sLCK./dev/null/dev/null/dev/null-s%.7s/usr/lib/uucp/uucicoUUCICO-r1/dev/null/dev/null/dev/null/usr/lib/uucp/uuxqtUUXQT/dev/null/dev/null/dev/null%s -r %suucp/bin/shsh-c%.6s%.6s/usr/lib/uucp/L.sysr KILL %s Can't unlink %s /usr/spool/uucp/LCK.RSTATcannot lock %s /usr/spool/uucp/LCK.RSTAT/usr/lib/uucp/R_statr+cannot open for reading:%s /usr/lib/uucp/R_stat/usr/spool/uucp/LCK.RSTATr/usr/spool/uucp/LCK.RSTATuucpJob %d an't unlink %s /usr/spool/uucp/LCK.RSTATcannot lock %s /usr/spool/uucp/LCK.RSTAT/usr/lib/uucp/R_statr+cannot open for reading:%s /usr/lib/uucp/R_stat/usr/spool/uucp/LCK.RSTATr/usr/spool/uucp/LCK.RSTATuucpJob %d is deleted Job %hd not found fp: %o job %hd already complete Permission Denied /usr/spool/uucp/LCK.RSTAT@(#) uucp:uucp.sl 1.18 0707070000020171111006440000000001440000010537720420437167600001200000000005uucp/NameUucp 070707000002017231100755000000000144000001053773042046704710000is deleted Job %hd not found fp: %o job %hd already complete Permission Denied /usr/spool/uucp/LCK.RSTAT@(#) uucp:uucp.sl 1.18 0707070000020171111006440000000001440000010537720420437167600001200000000005uucp/NameUucp 0707070000020172311007550000000001440000010537730420467047100001200000000244uucp/Info The uucp (/usr/lib/uucp/uucico) has fixes for the following: -uucico hangs at call completion -uucico turns modem speaker on -time stamps incorrect in LOGFILE 0707070000020173611007550000000001441200000000244uucp/Info The uucp (/usr/lib/uucp/uucico) has fixes for the following: -uucico hangs at call completion -uucico turns modem speaker on -time stamps incorrect in LOGFILE 0707070000020173611007550000000001440000010537740420437167600001500000000123uucp/Installmv /usr/lib/uucp/uucico /usr/lib/uucp/uucico.ORIG mv ./uucico /usr/lib/uucp/uucico 0707070000020173611007550000000001440000010537740420437167600001300000000000TRAILER!!! failed /usr/spool/uucp/LCK.LSUB/usr/lib/uucp/L_subr+fopen of 0000010537740420437167600001500000000123uucp/Installmv /usr/lib/uucp/uucico /usr/lib/uucp/uucico.ORIG mv ./uucico /usr/lib/uucp/uucico 0707070000020173611007550000000001440000010537740420437167600001300000000000TRAILER!!! failed /usr/spool/uucp/LCK.LSUB/usr/lib/uucp/L_subr+fopen of %s failed /usr/lib/uucp/L_sub/usr/spool/uucp/LCK.LSUBin ub_sst name=Rmtname: %s /usr/spool/uucp/LCK.LSUB 1 1*.SERVEnetnodename: nodename arg too long n, `%s failed /usr/lib/uucp/L_sub/usr/spool/uucp/LCK.LSUBin ub_sst name=Rmtname: %s /usr/spool/uucp/LCK.LSUB 1 1*.SERVEnetnodename: nodename arg too long n, `  % Kfixline - speed= %d BAD SPEEDRETURN FROM fixlinesetline - %c /usr/spool/uucp/ERRLOGaASSERT ERROR (%.9s) pid: %d (%d/%d-%d:%2.2d:%2.2d) %s %s (%d) r/full %s w/usr/spool/uucppublic//usr/spool/uucppublic/usr/spool/uucppublicMKD&   &   '   '