IMD 1.17: 16/01/2011 9:01:41 concurrent dos 386 boot and utilities 1 of 2 release 2.0 serial# 1118-0000-001458 nov, 1987  'DIGITAL ` :+"&6x&>x&z.|-@|**IF{|P^}w}w++QR|CCPM SYSDOSPLUS SYS^> |9 t}t~ts@;tX}> |AQ6|@@P>"|AV}&|+$|XZYP.|ݱSx[+Q|&|Y.&|XHPu* LoadingCCPM SYSDOSPLUS SYSUse another boot disk CCPM.SYS not 1st file *P|Xsu CCPM.SYS read error |26(|uŰ.ìt@`  @`! #@%`')+-/1 3@5`79;=?A C@E`GIKMOQ S@U`WY[]_a c@e`gikmoq s@u`wy{} @` @ ` @ ` @ ` @ ` ǀ ɠ @ ` ׀ ٠  @` @`!Aa   !Aa!!#A%a')+-/1!3A5a79;=?ACAEaGIKMOQ!SAUaWY[]_a!cAeagikmoq!sAuawy{}!Ao!Aa!Ao!A!Aaǁɡ!Aaׁ١!Aa!Oa " B b  !"!B!b!!!!!"!""#B"%b"'")"+""/#1"#3B#o#7#9}'("(O(b((((()")B)b))))*"*B*b*****+"+b+++++,",B,b,ǂ,ɢ,,,-"-B-b-ׂ-٢---.".B.b...../"/B/b/////0#0C0c00 0 0 01#1C1c111112!#2#C2%c2'2)2+2-2/31#33C35c373933=3?4A#4CC4Ec4G4I4K4M4O5Q#5SC5Uc5W5Y5[5]5_6a#6cC6ec6g6i6k6m6o7q#7sC7uc7w7y7{7}78#8C8c888889#9C9c99999:#:C:c:::::;#;C;c;;;;;#>C>c>>>>>?#?C?c?????@$@O@d@@ @ @ @DAdAAAAAB!$B#DB%dB'B)B+BB/C1$C3DC5dC7C9C;C=C?DA$DCDDEdDGDIDKDMDOE/ESDEUdEWEYE[E]E_Fa$FcDFedFgFiFkFmFoGq$GsDGudGwGyG{G}GH$HDHdHHHHI/IDIdIIIIIJ$JDJdJJJJK$KDKdKKKKKL$LDLdLLɤL@`  @`! #@%`')+-/1 3@5`79;=?A C@E`GIKMOQ S@U`WY[]_a c@e`gikmoq s@u`wy{} @` @ ` @ ` @ ` @ ` ǀ ɠ @ ` ׀ ٠  @` @`!Aa   !Aa!!#A%a')+-/1!3A5a79;=?ACAEaGIKMOQ!SAUaWY[]_a!cAeagikmoq!sAuawy{}!Ao!Aa!Ao!A!Aaǁɡ!Aaׁ١!Aa!Oa " B b  !"!B!b!!!!!"!""#B"%b"'")"+""/#1"#3B#o#7#9}'("(O(b((((()")B)b))))*"*B*b*****+"+b+++++,",B,b,ǂ,ɢ,,,-"-B-b-ׂ-٢---.".B.b...../"/B/b/////0#0C0c00 0 0 01#1C1c111112!#2#C2%c2'2)2+2-2/31#33C35c373933=3?4A#4CC4Ec4G4I4K4M4O5Q#5SC5Uc5W5Y5[5]5_6a#6cC6ec6g6i6k6m6o7q#7sC7uc7w7y7{7}78#8C8c888889#9C9c99999:#:C:c:::::;#;C;c;;;;;#>C>c>>>>>?#?C?c?????@$@O@d@@ @ @ @DAdAAAAAB!$B#DB%dB'B)B+BB/C1$C3DC5dC7C9C;C=C?DA$DCDDEdDGDIDKDMDOE/ESDEUdEWEYE[E]E_Fa$FcDFedFgFiFkFmFoGq$GsDGudGwGyG{G}GH$HDHdHHHHI/IDIdIIIIIJ$JDJdJJJJK$KDKdKKKKKL$LDLdLLɤL CCPM SYS rCDOS COM rBkRUNMENU CMD rxCOPY EXE r>READ ME r!AUTOEXECNEW rSCCONFIG EEM rSTART001BAT rCR rFORMAT EXE r@DISKCOPYEXE r/FDISK EXE r8ATTRIB EXE r:INSTALLHBAT r-LOADSYS COM r5 CMD r:PROMPTERBAT r{CPREPMENUDAT r|BACKUP CMD r1CHKDSK CMD r/DREDIX CMD rDSKMAINTCMD rVFM CMD r;FM CFG rxZ29 DAT rTERM DAT rFUNCTIONCMD rbHELP EDX rLETTER TXT rLSN EDX r5SETPORT CMD r-GSETUP CMD rQtSTUDENT BAT r#TEXT rWINDOW CMD r6WMENU CMD r5WYSE50 DAT @ %`%/%2+2`oCCPM.SYS`COPYRIGHT 1983-1987DIGITAL RESEARCHXXXX-0000-6543213.@@ 0-!-3..& &˰,2Ë u#R3SSPPS.Z Xt.hW>P</&O" -6D؋ uRP.3h_>&. &W&3h_>3./f&O" -r M K!.h_tG2  +3&G(&O*<s2*߷C>s*) 2 <r<s<v/s/v _> u 6> ؎3؋6 6 >33+̹ .&G<&G&6h&D& tD/m6>u(2..˴@t v3tPrQv YtbtXUFFF]$vUWVRQSPU..h>^>&ts o>6&&.&0&&G&@t&G&tt%rW&Jt-Dt#-s#t t tt *t,u 8sSSiwĘ.-X[#>u4&!^ F6>.!^ FX[YZ^_]&JtPu  dX FF>ÁX[Y&0&&.QSPÜUWVRQSP..h>^>S3SĘ6@.-X[!^ FX[YZ^_]ñRR6/. t"ɎmĹ u&E}&e  Z@   1`σ>u$&0&&.(X[YZ^_]4RQSPĻSPЎ؋Թ X[YZ!<uttt uϸL!&.&0&&.X[YZ^_]#r;&tqLPU& Ŏ&0&&.$I t9&&][<u u<uu<uu<t<wAS.h_>[Ã>u&G&u&g&&G"uKt <u$. ;z<t݈FÊVV N2w FÊN2Vh V_ VuN@N@t fF. &3 u  u&F$V^$ VF&PtO X<t &G BtFù uF<t < t<r<w<t#.-Fô u'e tuù0K V .&FÀw ʀ* ð   FF> &=u 'ð0   t   c   8R   A   j 8&  g O   L> 8  ;- &GFËVF&&ð   F r%>EFF&EF&EF&E FX{  n Fm r>~FF"E    m 8)   j Q    N@ H&E 3%&M 2&E!&}@r&U#&U#F؊Ԋð  F  Fð8  F  FÎ&F&FðcFbFr">&E@F&EF&EF&E Fð8$FF8 FFFFFFFFFF28FFFFF nr F8NFFFF <rա Fð8 FF8 FFFF2 r FF8 FFFF2 r~t ~tFR8F8wFF] FFF2FJ6 FFF F 8FFF F 8FFF F2r~uF FFSFFFlFFFqLFFFF F F>8FFF F F=sЎ&;2v9شHr*22364>466eFF=v u:` | tO&EG@EtO&>tEuO&G<GEtOW>RU Z£ VWhG<&,6_^r5 Er& E      GG>  ) G>6hD>_>& & G. & Wz)GGGGKG; )6￵ )-;L 6hD<&,  :      K & s=t&=t =tQ,Y3&&G&t&>&&@&BG>z&R&T&P&V&64&V&&L&D3&:uGA ù"MF"$F F /FFF F FFF&>H &q&:&>h&u!&u!sEt@.r/t6t@touf&E!&P F&R FV&>h&E!=V&P FQP/ u"XYNNXYй ;뱹Q uYNY F~xFFP$F$`FXÎ&NuPS [Xu& NFFInterrupt 15 - ROS ? Interrupt$*&h&G&@t~t5~t9~tW~tc~t~t!~t?&X F&Z F+f' uN@=uF[!Fmѱ,&g&UWVRQSP@X[YZ^_]p&>F &q&:&>h&u$&u$F s@t;.r*t1tJuf&E$&\ F&^ FC&>h&E$*S/[&!NFPtXu:<6QPdQ2Yǀu~XYـNXYйF$tFy62f^+&>h&M>&ABt Î&NuPSe [Xu& NF QA0r & N Ў&!N3PXVW.&6h&>H & t&UBG&>F & t&U8G_^x>tÀt.PSQ6tPSQ6IYuCY[Xu ÀUWVRQSP.&.h&F&t &^>fX[YZ^_]X[YZ^_]˸~uC~F 3Ъ~F +Š 000īFVVConsole #"$J&Z&&Ë^r&@Frvr&r6&6$Xr+^&;r&;FFÉN&'mF<wu FËF=w TF6  HH r#&(H&>Zt@شI}ù& u6&&"&&u"*^+6,$.02*K,$O+&GߴIÎr&9u&aMt3Îcr!&>t;s &;w 4Mtڸ&@،@KÓ$r&;u&h++rD&>u/&;w> t9> u;s;vMt uá u&>Mu&>uri&>Mu"Zhr&>u&&A&;t%&&M&&&+I&QW3_YÌ&@ËFH t&Su F 4^F F@utNFtFÿ.O>SuE&& &&4ظtSt&&>N u S==|u puS&=t &:tأN&EQ&EP&ER<uTR468:2#<>@#@BJLPSJ&G [XˋV^A&;t RڻJZʋV>&E&S3ٹؾ 3\+ ]󫪿m󫪿rE&J&& &8&:&P!&R&&+=sرR&+&ZFF&G<FFÁN6&L&á&LJۋ^&~uFvG= s=t=u.=r%أVruF<t<t><t:F~&5&}S[rVV^+;¸rrrmr ~u^VrrP~F&rB^r=r8PV>r TTTDT&\&P>t >ߡ t شI t شIX?>s(~F&}&G>*&5&]}& ttPaX qI ^3P-F~tr&N#E VF~DHH؋DDD>&EF&|&N&&N#t6F&;u+6 t&LXKڌێ6 6 &63 X t ۴I>}T&>.&&E&EFF3FÁ>CMu>Dt 󫾅 t<:t<\t&7[3^P>*XVWVTŠʁBr24+ҁ v ȁǀ ?rδ?r3_^á >u3&>.&E&]3ǿX¿T&,F^&7@F&7t \F&7t lRºZV>}^3FFFFF FF FFD|&ED&ED&UP F^v^FauU~uLra3҃|tDDFVF^F u|t|uqDj~ t P^FX ] øFVF^F uʋFVDdĊ@DDDD D F^~^F u=tME 0te3^S.&h&G@E&_ &> &&G E[D ‰EEE /E S| u MD &G&uEtc&G&u Et&O&&GuEu?&> &&G "Eu">t &N#E tr[3[Á                    $.hGм&&&`G<&.31!ɉP,+ێ1.hG37F@t4F t?б౞_h6tDGBL- G0.>t` xWZuD.;u.؎>u 0PP.hG+GG478 ++ɰ.( ౄ2Bh>RRfG++hG&f$ûGG.G&yû G.G.GGq.&P&DY.h_0>`u.6&4؎Ћ&6..؎.VWU&2C]_^؎0>`u.6&4؋ϡ..؋ρu y&`t,w$.OĀtF@t P4]4645D5g5ùËz3Ë|3Ë&.LT<u\t<uѹH<w ;<v <t<u"<uѹ<u hW!7<u hW!&hW$&03ۋ&.~3ɋ&.WȎع3ɋËmrC66.D&.&}u&}u&6 t,s3.\&U&E &MþR.|t.9Du&..&&G&G6Q&G3&.&/&O&w(r.63û&.ڡ~S4[&&w&W&G3&.&&w&Wr~3-Q3ҋ-<r @+ȋ3һm uHmP3۹ .;QvSKƋσuu @;uB.+QXYX@R3һZË-u.;6@&.F;;?\t-?ttG< t< t<\t CDžt ;< wL;+.< t< t+>uuu>uuq澾V^:û_Gu 까ڀ> u\ GG3\u  .76\@3G؎6h G G G D$G$D!G!rx]>tP>tF tBx7,@3r'>t >u u#hGt (>uLGÎ++ۋZ.ЋhGR&>4_<64G< 2t>u zuSQ6P%Y[(utm,@PlG<X;=t=ar=zw%_GtG\3 3\>;tz;Otl\Dt-;&QD&St>6Ct)lDt-;&TD&V>u *6L ֹ+hg>1uP GG56|tVttԌЎX^ۜ\6\fSh O O &&&>u$h6GD>ug|GU66DZX%hO ȉOGt3 hg(3.;>0u 6@tP-;+^+;ÎG<+0>u76hD4&6G<&,+>u 64  &6b>h9 t htú>.thWAb:]&>G&6b>h9h94t6+ۇ46PP SS+RS, h ^ >h u h  >h u h  >h t j )&.j  &6.VPk y + t g G t>uIG@t>u   Gt  Gt @Gt 6t*>u#GzsLsL@sL sLp hG G j  tȢ Gt U+# .f # >h uL> t> t DDh DDf > uV:K^ G G} ?uDGD T ЋGGDG=uGDh D=t뽀?u ? u D<t| u4QSRZ[XY#SRQV^DYZ[t {f ◻# f  t-?u(GD;TvDGD;TvD ȃ>h tDh D> u3DDu3Q# f AtQSwwYY[YݻY# f ?uG)D;Gu  # f ?u9D=t$Q+ɋъ Yt@W+W;vG)DG ⽋6h t4td# f | t9Q4Vo^Yt)|tQpS_wЎ؋ԹX[Y u ٺ Nu ; t]) tN> t<w<t) u#$G3G&# u  # f |t"# f |t !A d +-󫠕 &# f |tG\ uQTRRJ&YZQ Yut&&WY&G⮀> u &Pd >h u# h gg&> t> uO&Og&> uO& G&G` > t> t b G<+> u6hD t> u 󫹀&h.)GGGȠ G G` &d &b > u&>&P&@&BX&R&T&V=u!M&P=t&T&4V+Ҡ<t&VVZ\3^d +Ƀ> tSQ6 PY[QS,[YËf # :Et<u} t XËS+ҋG _ rSX[ u3G )G u&&S+SRP6 PA YPP&6&66 P!XZx++;tGQPSWE_[XY6hDt(Àt3à +ҋh_.t؋tWࠒ nVPRh tk ZX^tY8gu8Gu9W.uG!SV^[t3 D n9]t}GE}t}]3ɉOO!\t\(u  SV_[= ߉VtV83_ G +ҋ6ht.t4tTGW.G!^SVPSWЎ؋Թ^[Mn}t}]3ɉO\\Í= t-E%=uVuu6h SЎ؋ԹwXXXZ^ùV֋t u6ht&V % D&I^D&^ËBBЎعq4UF&.V4vvVU4]^r FF{<t<:t<\uvNNFv<t<;t<.uNrEF<u(N+@+΍u}E󤖰 .+vvFs^x&.vFD].+FhO<7ً,-+&=tLt +~FFLNËT;u%߁+.sL.;u.;Ut CCuÈFUV]r%USP]v<t < t< tF++ɪ  &.NP+PPttt4tW@PHPPԋЎعVW_^u9].G t(Vu^u&.&0ˌ&0à Ë6鏈"#   !"#232@ABCDEFGHIJKLM 56$%&'()*+, 4-           !"#$%1;Zx0N`Qq[Z\^\\]]]]QQ`QQQuaQQp`R=RRRRI^^[[8O<OhG(UO*2.0Q.(áh؉Wn1hGW,3G38hW3,&0h;6hT,\3ڋ7tl39t=5DáhGt;t GW áh;Gu33GtwtGDl6lwCáh9GuPREE^Vt<P 0^h4t.GtgW|4=tEt?>^_rT6rl6lZ&9u &9UuÃË&.;u3Ü>\uQu yË\oWDt@ 3(^L.>tsffhG&&2G&aG&Lkff>lu[&h&aGff&2&LShG[>u &Nff>nu>>lu7hu-G&t O%uG%?t G:Gs ffZ&&&.ff>r,f f$f(fpf>xf6tf.|&T.V "$&>(6*.,3ێۋ8󥾀X.hW4t&S[Gtڿ@6؋7hG&tQWG&>ٹ_Y؋h_(6hh2\.WeXWWWWWWWWWW\,V^L  jL,AuI?t E;w+ȋ<7Lt)M\,?t 7lh6h4tS[6hh;6u[6h0tS+PtԹ7XX[Dh+L D?t8Ew rd<7n5t6ht D:Gv$WT _5<thD6ltlDh|>u th^hu|t;t 4th֋W4tS [G&tSG 23,>TEt9_`u-Gu&hG EuMG,nGtY;trڇtG؋64ڎ@6ڋhG&t>_@ڎ_'(O&G&tع_6.hG_(h38X>r,f f$f(fpf6tf>xf.|&T.V "$&6*>(.,&&&.&>u&6N>ltÜuZjt&Oue76jGllt |uH =jllGO  L*J|utЅtu3KÜqu tuhGw,pѹ3KÜD :t B:Ju-DڷÜ.u+ۉD:Jsʶ‹Ë6VXE.t4tWV^_u 3҉UUUUt>t3{j&.t4u 2WV^_uDthGu &u3)Ì&.&}EuEthGu W_EU й ut7t;t43 2PXy&.&\ut_SVWj^[&.&|Ou3Gt&hG3GPGbX@;Gu3GOWH7312PLX&.&]O;OuteSWW_[&.&uOuGt13G*GG;Gr+GG،Ž&bGW3|u b|u~&6.&.&.hD+DL|u b|t~&6.&.&. +D@DÜSRZ[SREZ[SQ\Y[ÜڋtSZy&.&_6t4t;u3ù R&.t&.+ñ_.>^uZË^^W&._M39MuFEu9MuMÃ}t(}t"Ee؋U&&.+ñE3? ^>^r)&.r.;r;DrD;w3ËEe3QQPPQԌЎػ`W n_.uFE ËE%t ^>^ËE`PPQ ԌЎ..&._tt&*uFG3ҹhOhW6&G I3һph_t 9GuWLhGtg_t OG2&hG&tlf.`::hGIt3ۋù#R^&.LdQt&Q pQS[YvZh;uO@+뛊W.*bEG nG&6NN&6&&`&N&&`oy3Z@bObTbObmb@bObObybObObhFl<,7jr94t TWT#3,3;uEA>Üll3PX38g uA3ɿp}t;uAË53Ʌt ;t4AÊJ2>V;t>lt3ɋGt Iu t t%AGËht4t Dt;\uV3PԹCXXÃ>t)W4t"Y&&&.QS[Ã>t*4t$WShW4t[_Y&&&Q`ddddQeefthijbk%mJnq-q SQRg>u"VZY[&؜]м*UZY[.cu#X&PSQ Y[.(Ë&.|߸;v+SW_[u&.TD+Ë&.T+&.T+Ë&.+\]&.T+Ë&.\3ɋ>h=t9Eu9]v&.T+V+QQRSP XZ[[[^&.Du  &.&G&E&EG&EG6u&u>+ɋÉ6R&..6D&t stS ^_&.D&+Mt ;v* DZËtQPPSԹ ZXX.u Cu Y&.&\&uh>SRZ[ptt;u;6ht"SRZ[wދ7t9Tt%wDD;vRVU]^Z+ۋûSVRURttԹ =.XXX]Z^[u;Tt+TTtZu4몿vms~4t>h4<;uZ >s^t;WuÍ~4t>h4<;uF9+ۋË&.uUuhu6h;tԍ=t9Uu;huE%=u]_G!݉WEGEG]Ot wKrF]E%=t_+ۊt)9uG\U7t ;Tt5?<,VS3 u^%^VU]^[^&.& tG;r@G;s9_+ۋB:w(?t#u& t+rt;OsRV^ZλA&LG;r&L;vt &DtV^&D&D&G+ۋ.&.&_t .G! +ۋ&TA:w;;u&;Ttu1&LG;r+rOu uu 6 .tD!.n};uED]]4t\>\SQY[uW+щUO;u+ۋA:tX=tMtGW8ou!+t)G8muҋEGSQWE_Y[+t8mt Q)GY)E롽3ɋA:w?t8ot33&P+ˋ[OOø&<u+N|OOË+ȺPQtSRV)^Z[;sYXPQuYXt؋g&.3& t +r';Os"9u@W&;Tsu&;Tw+PH&+TsڱЋX=w7 +ɉO:S[E7uLMLMHt4+S ^ߋW+PO  L+ɈL.Ëstr#t 4SW_[^ +ۋ?t E;Dw7Ã>t/Ë KW&.&&}E&t+69DvL4ut@;>ht>h_WP}4t+EU69Dt4uL+Tv4u=X_&.3)ttKDuT & t +r3;Lsދ؋Du9TuDtTu&;Esut+T&;Eru uʼnGDGGGV6hz^SVWU ]_^[&.u9SVW"_^[OhsOD+L4w&u;6htO+Ë>FdW<2u>+t =95u_Ã44tDt7>^À>Ë6!D4uDt/>D+Ʌt";Et=Et@tHHEM=;LrVO ^=Dt=ÜXt76X P Xt 3ɉOOOÜ6X7X@$ouË&0++^@uP@P蒠Gdd’+ɰ.bYZ++&d&?&G+St;Gw)GGG[TX;u 0PX%0u+P&nptrv؎м7f+Jf" f "иrP ؎f+f+fPfPtfPrfPpfPnfPfjfPf+vfP^rfPfπ8wGFt FSb[uu؋G6Zu6DDT8t<>t56r-JfJrf"ڋD.+%.6DJs%Gx%+GGHH6tO&%urO 2+2(PQAGGË.;r+;Ts%0,++DًЋ6f+ɿ=t ;Uw)UEtUEÌغh GWغGWË;Ts.;r .+ø >(* .ػGۻH6RںGWZf+hff^\f+*ffdb)D++AٌAJu/hP&*G.A2;.*F@t +ۇZt XXD6D+=rFtWʁفOZы6;TtV[^WG7+.hJ6ZG%W+ЁuGG+á,%Hb*v3P.ë«+www"w'w,w1w6w;w=wBwSwdwuwwxxxh.0Hȣ*أ*,6h3x F3á. u!.0+t+fE ÎJ+f+6f ff+f6+f+ffff+fff+fjjjj jjjjfj$tf6j(tf6j,tf6j0uj4xf6UfUffSfVfPf+ۋ^ff8f\f+ۋ^ ff0f\ދvv<"u v "c<"uᭉv"SF@F 8ۋFPF R ؎ f%""f%"V.؎.PRD ^t6hDáD9\DtK㗎L+&2+&y6hD++ËhG&tDuFf+Һ\t3|f+f 6ffff2&y֋4u"؋6hD+,EMMXXXX0Y{& t&O&Oˀ>9uv3+z)ȫ+Ž«GbN+&: G(?L+@+VWRQSPUNw!F.2@.{]X[YZ_^F{{{{J||||| } }!}<}G}n}á:FÎ24N++&uCSۋËhGB[;w^Ë^tLSۋËhGB[;wB !r4S[u0&Lë+r FFFFGN&;MwBF<s;&2&6hD Nf+f f]"FF+&zBh_4t;WuGtXXF2hG NuhG NLÎL+ +&tC^U&EF ~ +L++ҭtCB^ÊF<rFH~thG ~ N~t!hG Nv0"ËhG 䗋:N6f ËhG 䖋:6NfffffÎL+ +&tBÉËXt4X+GGG @G6hL&t4<t4Î2&L+ËG +2>>u>t) u+Ët 6&4+> >>>>4++uG- 9 t&&=uGG+;~  u  Ë6t&@&CCKK&ËV sVL&=uXFË6ht43DtTJ◎L&E؋4 u. Ft Vk^ Requires Intel 80386 to runXHvXnB[b}xۃ߄Fą()-z. .(û36hT!$P6h\!: r+Ë6hT!D!6B hW!RZhʊW!QRZYhW!RZ%hW!RqZ&PR`_ZhW!&.M]=RQSW'(_YYZ 3VN6hT$?$32 uDu >hM&Ë6hT &6bu&6bËh;t6<t$ $]RT V^ZF3͉VR0(Z^13hh<t?9t  &;6bud>he&DRT@ZVR1(Z^3R#_&.}v]ptt(;t)pWU&.._5SW_X&.P.hX<t9t Q@YÉPV+^X؃<t9t457׹`3>ltI 3&.&E=w HuG u&}t &:G tAË6h2\ Ë6h2\$:rË6hT .&6b3:r%Ë6hT$2D$6@ 43ËhG 2> 4à6T+<t+&;6buRdT"PV^XZPRV^ZXB,Ѡ6 6: 3 tPRV^ZXB ËhBtJW"3Ë_" < s< t < t< t<uP X G"t! v hE"t : <u\*2ËhW &6bt;t2 t= tD*R+ Y:Gs|]9]tL&D\& 2Ë6hL"SR_[3 y.Ϸ"&.":tSQW; \ _Y[G6hd"ÊuI R_&f&.uO+͋%BtJ&f&fR_&.EM=:GsKHhG"uA_YhW$ R/hW$[&.GO?R_GGDDG"P G"W t @tG8R&.3Pw:VW3ۋ< r_<t[NF t;uRS^&:WtAR+tVWN_^&AZ[+tFBF tK[+vS^&? sI&Iu Wu_F[Q+RHZX[+ y QWS_YAnFSW tHٿ܍_u+.[F$[+SRVWU6hT Dv!]_^Z[Ĺ $u.e YShO@shg[<t< rYȸF tB&UJv Y&U&5H_^hG:XʌW Gg"XPuȿ܍ZD$ ƈDXhG"DF uh_6 t8vtrSRVW3 t3OO+rU tFF;v+NN(AGGvS.hO8[BV_^Z[ tN&8 sA+;t&< sCCFW_;t&8 s@ tN&8 sA+PQrXYVS+шN+RW+WP+t~W[YQ8YX9_Z[^ u+t ދ֋ t 3ۋ tVN k:vAY++؋RW~Ѱ vB_Z;tSQR^yZY[QYV+ :sA+^+&I< t<0r<9vLJF+GXS  t!FFOuS.hw8[;w u8nu#3 uK u8nu tFFN+N;FF+S.hO8[]S.hw8[뱱8NrFF tNS.hw8[ t~&:EwN:vu*NNȋ8NuʆNF uދFwP^+tRPZ[+t1SRVWU6hT Dv]_^ZF t hG&u[ËF&w[N VWU6hT DvW]_^RSVU6hDT v]^[ZÊV RVSVW_^[ZU6hT DvQY]  劼$K_mz$͈|GHIKMOPQRS=@hO@h hgŠW &6bt9uPS[XËhG" u< u \u< s P^X@hG"u&\tC sK tuK u\ËDtu RTtZ:Gs39\*u|9]tð:Gs=|*u^hG"uC_ &DJ5 &Xr1Ia>ץק20.Dt33.ˊ20hG^3Z^3hG%POVR~b9\tQYZ^ thGt2&&(.$G&.?&0A&gV،Îێء&+.^V.dtt^*>?>u>& <t<u  A&0X&&(PStx6?tS6&>t P~XuP>tXAytP&PXط.A&0 t.>u*G<`uOG %Gñ!$26*?ûKuGRZ u.&6h&D.6hD(Ê㋟ G&>u:1.3/>S66686:6hD( < t4uY%8u:<t<u&$?À>4u&%u 8t׈&>t6hL몡13Ҋ3&Ã6 ÿ22¢&J2CË2Q2 2YÀ>`u2*** CG Ë6hD$u(t$u >t [(u t *7آ7u7Ê ËÊ<2à sPtA88À&6û:u [ `? u/. G2ûeS?u=Iu.[2t3</Q*Y t/6hD& t/ &/ uPS tEt<>4uC#>!t0:t[X<tzX[X u)[XW0./>h]>g._<tt>4u"613LTptJ6D:Gt2S6htLt':&u :GtGG[GGGtyCu3ËB u 6ЋG # u tJRVZ;r<6 u uR#RwSZtG;Gt6wS uGGH^6XD t G t;Gt>4uk!|HS ttñD8:ËC;v$QY<u uhQ-uuÁ> u Gu(T)T2Gu2?t?tG t2ҹ F$t u QR ZY tWGGw6=r2t 3ҹ H+ۋ6h\tgSO:8[G&6D uS[y+ÎGSy[+[6+EEE@E &DE&D E&D&d &d&H&4&L&D++&LE=r&D&$E&DE +v &&dus MHE&DHE& v E&D G&&&&6&DFF&DFF^^â0R[s4uM0+:tttG$G> t2'1"Ţ C":`uG$*$t#w|tSxEx,t<2G u/ tx6EiO0Ou$WO+H%?PQX>u@;r62t%oO>!t0:u0;vÏñ6h\6ËÊ!à$tSh_G[Ëhw.ttG@h+w.t|"uQVt ^Y] POu RRð-u@3+ӹsQS ȸ [Yډ>tPrŅuX QS.͋YRQRI[ + Z ڈ,U9u',tSG;htZ2[ܻ [YtX>t.ڋG[øt3!! 2VȢSh_[r5<w)m<w"ヿ u6hL6@u.$hG>t u\󻙣S([* $ u?>*?u `2 6??t$oá? t*t'?7 I,A$ !f< : uhWBJ;:u iA+1+~ 4QA2* O!G#'!! ! Ë<>*ul+PLX@>t wr uSR>$u?t2+>t>.t&>/t>.u >tnZ[벰 5J s2ڷ㋟ t$ʸu u h/ sڷ㋟ th;Gu+G+Jph>q"R *>hGD>t ]R..?>t^Z>ugz8:6 >t / / eH3#D_?3I>IË6h\&ËË6hu\ÀT3 t s&K&&&&0&Ë~&.Ë~&.+&@+ێ+v+R@+S.y[&++H@+ZJuՋhG+ø &6QRRֈW+ɰ.S/[GGY+  & : O ^ r  %&()s+ u t3GxH t6??t 2s t2u>r G tt݀>u S[=t̝>sg>u` G u3 >t?tG t7  !23'!2 t\GS>u G tJ?t?u 3*B3SPWn_[X +&=u2䠶 FH GWرg? u tH@;swø@U~Fu&3ۋ62uD t uD t uD u &QC rơ%&E FЀ tFu&E &]&eD t @D t  &E&E&]3&E&E}t]ð!G_ u G + ËGЀЀ袬GЀЀ?袯ËGG;Zx0N3ۊK.pP2䠬@@m[3ۊP22[ãþ~NKmuB;r+A3u;vNN t .p;wP.p++ÈC:1袱ËuK.p;sH2< r, 2<r, á t_ k>u~3trq um*ta+7t6D:GtGGuyHPxX)XC;rQ=Y t.u Àu  t4tG uQ Y t Ê2+ >4ut |?t* Ê2t 4?t2FC áu >;>w@t6>#>G3Ҭ+.u>, u,G +GGt]P4X3ۊ6sE t t />t"y >h] rv>h@G tJ4>&u G t& 6$2v=u@P3r#xS( [X>Ju4F$J),XSP*Sn>Ju G$J$C0Q8Y"4t t;sP?[@ tΡAA_?<qô,局^RXu>+.u>, tށ>,. t=u3ۋ+$C r3 BZ@t+#3t$6DD u tDL 6t]%L & /SCS*S$&.+<rPXuPM2X uPG t*Xt<ukPG t*S*[ttaJ%r\)tHA1&t+Ggg G=**XuP] u@G=X t>3tT3tyuG t*g103ۋ6 s ;$C빊: uhWBJF:u tt?;tWFu_ 1>E t_&D06[L 6 t 6DGit3[u1; L1uDy0/&@t'J tGW-r $ GW6+䀀u u ĀtD  D À rVr>Mr'tU/yyUy+é téDt@ét ðu2h-rGDGD Lu!.tDT 6DTKt$&&e&U|;&>È>w -s u,Guet%>Mr$&8:u:6t:3.86Jr"u u2 u2ň.33ۋӊ ף>vË,GW.>?t$> tف  :tutHty.> r 6.t @86J=u29à<&:PHXu;uf+rËu.uuLu.tV^+ۋtOtR t ?>R t>F ދ>6DGU;u6 tDLGOWGËt G3GtSڋ>h8Z3Rt SR[ø 蚸ӀCON AUX ,COM1 @COM2 TPRN hLPT1 |LPT2 LPT3 ĀNUL +0,&GL4&&(hG6 6FX 6h!DGu[ù3(h_.ۭ<rSRP옓..Ë6hDWq"ŽIӿ6(1V <r/y&u=t.t3>hE&g  .qlgb]hG&&B@ <t &6NN  && u+ s t uYY۹uV3ۋ+C rD 3 y> t't6DDL 鷑+<.t< t8s! t 9rY'mk3 sV t >&}:u$&}=urjG&=t]< s ヿ uR>u >+ t/ u>+. u+GtG t &js* tk P t Gt2""JS&tA%_%rGu[U&Gr2i2ٹu?+ t6$ +RneL&tGOO 6%XOs+*t ~j r5}$EG tu!+ҩtʪ tDP%XZ Gu3rv7 + o* G@u5Gu1:r&Gu~>17 + +st G u#J$$G t60G@uFGuOAIt ItIGW wDTGWv+ۉ\\O sEtd >u G >u$J"2G u0G Aڀ>uG%À>u`#"t#6h\6#Gt O g%t G t  GuGg ٸEvD<uD <uD+1t[ >&t +G BtdG;G tXt17O\>tBO@ك@=@vOʾ>r s@*tX4 )h_wWt/u$*r   uÃ> t' sGt Ju!"6 L*> :tuOfuJ{չ uQ+> L 4t *H6D;EG@u5Gu>w>u DD áDD Lv+ۉ\\ s"tu,F (u st t:q6G@u(Gu'`r|>u@![!f7s x0>hE<&>4> ,tG^_s.VĻ=aЄ#xхіXҗ 6h<t,&2&>4&6QY+SQY[CË6GGG_hO>h;uU<;Wu7VG &>4+p^[ҋ6OoO*6*yhW@s(,GG hG<&4v\ s.Ż$jՃ՜թ.e֏֥Ayr6ws`tZ>/so>>A:\6&<tX^u6G GG pt\t07O\B>GGف=@vOʾ>6ެ<tu+6..t8.tU>+OO\tO<tJt &>&}t+\GG<t Yuq>&}t+OO&=\u&+6hL6ڷpt@vTthWs rvrvtvt|:u|=u ߀ArvËt:uFF߀Arv Ë>hUMj6h\vDTE9-2)~6h\vD`T6h\vDTy/Q6h\vD[|O'h_G"hG&&GhG&XShG&G&&G[."6h\vDTulcWNE9z0q'h_eS +G>hE^.0Avh_6h_6W _6h\vT6htJT\UqhG]x,S ~_rW6_s6h\>rЋ?uˡt̉W +GW G6h\G @G DDhE<&>48x7v\>huE<&>4&++ӋtԀ> tRZRXU >O&EuCsG t>TuG u9uþ+ *? uËhO<&,+&=t߹Lt+lj>KM&=tl&=;uGO?<;t <tDK}\t\.8;1*O4ut G uG t>KAPPEND=< tĪ>sW?t ^& u'tG +F&<u * &<tA@* r0 u+>+. tV؎^tG tVk ^뾸sK&=t&&}:t hG&P hEh<.t hEh>2&E @+ GGwGG0 @Gcܫt+05>>2&E>&u Gs@6&62 &&&&>&ts>>2 &۫+@>hE&>6>2t @D @ +&t +G4sG t?JoG t6 s J/sF+ ?t&t0&t|tJG3ƹu ߋ?+ &t 6$ +ۋȸG t+6@t+GsuJ; >2&Mu&MG_Q~Y&E!@r&U#&U#69%), >>2&M&e &E >>2&M&E!&U#@rt PXӋ,GW ᑋ>hE&>4u;v+4">>2+ +&ut0t,@P &UW>hE&>ʰ_X;u>4t  >rt&E &} r &m &E À>r &E!&U#&E!&U"&E &U 2u)hG&t/<t< t G&t<uss + ?tÊ.&uG uñO t"o tG u G G@t%t _ g u hG"t vD+ G@t vDtt"h uG&uG" G" G"ÈG G@tug G@tu\ |O &>t &6D@ux&DFF&DFFGGGG^^GGy G@u$Gu G+DGDvD+G@uGuvD+i+> u@Su"G@uGuO u+vD+%$wh_L˜؋tÊyhWD 3 t6D=t+Ë^À>4tu䡗36>. > Ԓ..>U Yu)G+PSD[X6<t34tøX ݁À;r+;rË>rOuLt:u ;Ou u}uܜ輼Ë>+..uG;G uW_Ë>hyL5t |tL6Rt-R+D @D56FFGG;tDË>hyL+5tLu R6RÖhpL>ã+.. t(6+~t[ڹ Y_:.;,=\<>|/"[]<\thE&>&+ +6h\6&&+ &&&&5-/v @ À>&t>vuhG&t\> uU,sM&t $G u;+6+/яt<thE&>& G wFFËG;hËtwt:DuÅá+ɩutpu@u t t PXtqu?؁ ӻtO;wuGuWtrߩ uGtػt$;wuGth;OtuGtE t뗋>+u +EÉ6.P@u>+uq+OWXGG >6hDE tOG%DG@uG >hE<&>4> >4u޴ r> Ë6h|<tD<&2&>4߰uO+Ut,t6.u .W+ GtwDhG+ɡht;GuA:r>4u޴ 6Ë+ 6>tDdEDD>Ed+DD L/V| 6t^-r*Gu#T,wt>+á4r0,6.G@tø_vD s  6h|<t0D<&;2s!&>4&;su=s^.״؋W w6h|<taD<&;2sS&>4&;sB>t5Ou/G SC[w[tOu w Yøx܋t ;tË6h|<t:D< &;2s.&>4&hE<&;2s2&>4&;s">=tE`u E&>4&+ &С t=t ø þ4t:Luø!G uG u@&y>G u9hGu,PrG%=uqGJ+M t#PXtPD$<XuCPXrG%tDu)rGø ,*G!À>At% `OִrK>hE@u:&u3u%&@tGtO gwL :0镺*ht:;GuG@twtLt*GWRG QZ[hËh t ;WuG664`Xht;GuGWRG Z[hût4wtD:udgG@tWGG 0[>>2&}u&u&u W_&E &E&M&EWs_r&}u&E6.zSV5rG tG A^[Stht ;wu;Gt[Ë(*O:uIOGt;6.ht);wu;Gu,G 0;t SUtBt9;wuGt/h;Ou&G t Ju G@tG y[À>4u״RqȊދ4t";L u;Du:Tu;6t 6à4t:DuFøASVPGt76h;DDt./;Gt&XGuGUtA>4t鷱X^[þWIRt'R<,G EEߍ}>4u9ְVTGuGtÿ*e!U"أ.t&t|t8&@u;Dw r;Dv66$>RuOR>>+\Ӌt:0:GuG&RyZ<t<uRRډ<u>>R>RË>><u>>}RRډ>>}6.\Ӌt6>tJs>>ډ?+ɡht6;Guwt|=tU:W uA:r>4uԴ 驮@66.\tHvr&tGuÍw$rrðþsðí;EW~_rW_s@Ћ?ut؋W +_W @GG ;u&EG &EG  G6hDDhE<&>4хt"G <t<uShG}[>hE<&>4>Ãtf,~D&ED&ED&EDGU} ^EF^EF^]G+ۅyۃу^>hM"W ڍT.N>he"+V&.ttTV諪^D)DuDD+&.+GËh>tG"t(&.L|VWQ_Y_^D+ZR_>':)r2(( / ')Ƈ* Ƈ+ )'Z&.&M6h\>)*';v'&M&=*Ãt~GjvW w &.LXu >hE"u!G u&.|uA)LL'hO"&.T.hg"+ttTV.^D)DuDDùpߌ‹>hE&> +w ڹ&} uO+΃u! u  u 賨tiPyD tWjD DUS V[^EF^EF^[]TJt+ u UH]tvD+?λ96t[!6HH&Ët2#CÃ133-PSn>2[X13Ku&&&&@>:8+@û+t Sm[0;u2;Gt1SU>&1"&@_0ûGW6&1"&@&&>u+0૓+Hr@H &6@&ë& +ë+Hc+@;s#PXu؊G +{&>u&*tOá@p0&tb&:u[&+& uI:sCPR@8>:t&t &&ۇZX&àa&&&Î&t&:u&&&& &:u&&t &&&:uu ҎuàA=r;sPX+QXP[u PXá13&ÃtPV=^X&;6 u& &; u&& & &ȃt > &6sS+ێ&t,&&t%&:ut &*&s&t[+Ҿ Ã>uot@;s PXuM+ t<-"PZ@+u+E;r3+Åu ;r+u@@;s PSV*^[XuP8Xø;vދ3S&u >t %[Ã>uBPS[X+҅t&;u J&;tB&&&T &PSY&t ɸtuNtF# &^D &>t3B&&&K&G P+҃>tÃ>u؁SĊ RKSAY[X>u;;tP&GB&ێûXôQY0&;u&:&u &:u+&>t&&;u&:&u&:uS&tPSQR&&&ZY[X&&&&Ĵ6 & &+& &h&&t&& t[t&&&t#QR+ҎuڎZY&tuPSQR&:t 譩uD&t /&t//+PQޢYX.&&:tQZY[XÊȺt RxZ!&t&/&t//&+{蹤30&:8+&&6 Á> tC&t; +Ҿ&&&6+6;uÉÉ>+ ,GWڋtu@;rH>u u,6.t&;Twu;Ds;Twu ;Dv+D),W;u  t;r t+£G >,G @D>u t ;spt* t(ء t6.\>uCa: t;s!6.D~6.+D\}],G G ,G ,6.;Dw r ;DruC>tC t?t,Q蜶YPR6.DT茶Y[+ t t>u ;vu(@;u H> uH>us#)s  ,6.GWuL;Dw r;DvuDD>tCuÊ&Ë6#@+;r.A,W &+ҡ++v 6 tBA+t&6.\+Ls33;w r;sËхu;r+ҡ tP:8X%á3ɅtaPQR:ZY[C;uAJuJuC;v=SQRZY[ u.;s(QRGS XZYCAJuË,wGut@uDSV^[+D{+D=r%;suSVn^[2>t+tDPu 6.\[Xuۋ6.DDL,+G G L6.DD Ë,wDuÀdD HSV+Ű^[tSVM t }Þ^[ø  %s %c:=  /.-dsawlprcnd:d:%c:%c%-9s%-3s%-9s%-3s %9ld %9d %s%10ld %s %*s $n$gcc:..,p%s:VER=386XMx:*.* (%s)c*.*%2d%c%02d%c*?\.:;,=+<>|/"[]%2d%c%02d%c%02d%2d%c%02d%c%04d%2d%c%02d%c%02d.%02d%s E*****$CLS=p*****$ON=q*****$OFF= %sInternal Error Code %02xh r  * < *.**.*0123456789abcdef000000001000000000 Volume in drive %c is %shas no labelFile(s)bytes free%s files exist SystemDirectoryInvalid option: `%c%c' Disk full Syntax ErrorBad command or file nameTerminate batch job (Y/N) ? Batch file %s missing retry (Y/N) ? Batch files nested too deep Directory of %s\%s ECHO is %s %s (Y/N) ? Are you sure (Y/N) ? File not erased: %s - Label not foundUnable to create directoryNo APPEND PathAPPEND=No PathPATH=Strike a key when ready . . . PROMPT=File already exists Invalid path, not directory, or directory not emptyBREAK is %s VERIFY is %s Auxiliary is %d Printer is %d Invalid Process Name or Console Number 8087 is %s BANK is %s SUSPEND is %s MEMSIZE is %d KiloBytes LIMSIZE is %d KiloBytes Copyright Digital Research (c) 1985,86,87 Concurrent DOS %s Release %s File cannot be copied onto itself File(s) copied Copy:- Out of environment spaceEnvironment errorIncorrect version of DOS Invalid number of parameters Cannot do binary reads from a device Content of destination lost before copy onoffMust specify ON or OFF Illegal operation on CP/M MediaIllegal drive in Path SpecificationFilename too longFile not foundInvalid directoryToo many files openAccess deniedInsufficient MemoryInvalid drive specificationFile Sharing ConflictPhysical Media ErrorInvalid PasswordLoading ConflictYNPath requiredFilename(s) requiredSunMonTueWedThuFriSatCurrent time is Enter new time: Invalid timeCurrent date is Enter new date (%s): Invalid date mm-dd-yydd-mm-yyyy-mm-ddInvalid Number CP/M MediaInput Redirection Already ActiveOutput Redirection Already Activeis Local Mediais Remote Medi aWrite protect errorNot ready errorI/O error Data errorSeek errorBad media typeSector not found %s drive %creadingwritingAbortRetryIgnoreFailF ;,=%c:%s%s%s%s%c:%s=notexisterrorlevel==indo$n$g%c:%s%scmdcomexebat\;/P STOP.CMDDEBUG is %s alr%c: %s %c: %s batchbreakcallchdircddatedeldirdelqeraeraqerasemkdirmdmorepathpromptrenamerenrmdirrdtimetypeververifyvolappendsubstdbgauxprinterstop8087banksuspendmemsizelimsizenetdriveclsechoexitforgotoifpauseremsetshift` C` 22` x#` ` #` ` R R "/` ` lR lR x!` " D&#*1;70D;A?BG|BL|CQCVC^TDfDnEw'{>VK-ڱ3౜vx&O" &G&G&G<ƣ,v&G6&x&@ +33PL!+ұ౎Î&PA)&A&6Cr8 r7-X u- -Át3Î&=s =r%&&>t&&G- ;sƺ&GƊε:sQR᣶ZY=uQRVF&>t ^ZYڀtRZ[м33@& 000t&&&@t_&m&&/-UFË]UVWFFFv&O6] uPXv&O6_^](UVWvv&G&G &> &9&E W&9&:E _t GGvW&9&:E _uGG_^].טUVv`6( PGPV3F<:t tV+~+,V}'<t<:tV  uVPU V+PP0 FPo P+P6P+PPP8PP>&t&(>t~P6GF*VVPGP.=@P.F u#F*PP$P.@P-F t P6F.FP ~u~}v68GF6PFPP+FtP6|F~u>uF^]UPP (>t>u:>.t)~P\-+PP) tn5 >0t=2t2t!>.t4u4t>>.t7w+P866+P><t<NP2뜸P68P>:t<:>PNPE4o]UF=wE.JWPPP%P (*n4PA,x P0, Z**9,]UFPPD]UVdžD,džFF^?t|?"uDu+DF܃Du^?>u:FFFdžL<>udžLFvV#P+P%VvND벋^?<uFtt+Pi' u> P;+F><tNNF PF,J }P'ʸP+P!J+PPJ2>:u ~uP& u` x>:t7PP4؎&*APP>P +F>P>P"FFLt Pv{ +Pv_JP<' } LtP+PPJPPJJPxJE4>:t4,+^]UbWVv,*P# t<.u ,_vFFF*PU# t^FFN u^FPCa=tbFP5B uIV!F}t ؀?uu,PPVvUPPg~uPPMFPv+P#FP}BFPXB=u~:u FPyoFPFPF }#=t =t=u dP(?v%7>*t%OP؎&?tFPPi(FPvV;^_]Uv% t ^*P> *-a(Ps,]U~u*FD0F*vvr.\>.t0vN F؀?uFvvvkF }!=uFv$Q럋]UVWËI33&8tH~t >N~ u-UVWt~ u 3_^]UVW^ttۋ3:t uUVW.t-33&:uߋv &t&3&,KC&>mt&>zu & ~ك33Wʋvu_ Y&:u[Y-+r/;r)XZRP+RPQUFr;r]øPP>UF=s]Y+r;rPPx>U&4^F&2]UVʀ]ñUF u)W>&E^&E^&E ^ &E@_]UF`]U8F]U8kU[UKU:FF2]U8F]UU8FF]UU8FFF u]U8 U8} FFFF m u]UDF:]U8 FFF x]U F^]U FF]ñ^UV.ڱ3' FF}=u]UVڱ3KM=u]U8*FF]U8FF^^  u^^ 3]UVUR]UVVE]UVS8]UVT+]ù#3ҋPv_L&t CCZ#¹ &tCCʋU6F\9 u ^3]UVWNV_^]2 & & q~=rx> tq=l=|g6 6 6 P6v&G2&P&P9   =t =u& & =t PP9v&G&u&g& uPUV]UWVvVPFP+P tV5<uNFuHWzP= t+ tv&G&tzPz W jPj ,Ft+v& G&<=t<;uF<tGv&O&V9zQF9F@PzPWY9VN:PW8WFuv&g&wzP( ^_]UZVvFPV(P+PFPFP u~tdP,FPV%^]UDVvAFF:`FFPDPFPPM^]U VvVPFP+P) tFt7FV F VF~|FtvpF~^Vt8PBv|:u?*-aDP&>| >KP3؎&*;u N(<=u"F<t4V t7<u%PV7<uv t6 v>P/^]UPVvPFP+P! tlv7PuF؀?tFVF:`FF~r1FtvvAFFPF@P'FP-7FFPF@P2~t"FP 79FtFP6+vBFPFAPPgF~^o^:uy*-aPF>| >KP؎&*;uZAP(PFPwFu5vFP5vDF u'"^?u PFPP^]UV^?tSb uY P P. PiFFP P~tvBFP^]U vFPFP* u^F*P4P4 uFPFP u^F*P4P4 tlFPFP t]=t=t?FFF FFFFFF=P| =cFlFP# uFFFFF+]Uv+P]UVvtt>jKtt$?8 t8^]UWVv+FFV:P"P+P t<"""t'FPVPPFPP+P tDPP3AP GP*P3A*`P*P3-P@PFP)nPn3(n:u;}((n(t(un:u-P(n n@P,*PnPPFdžrh-"t+&tPPFP' "uF*%;&tF.PFP52$ tF9$t $$dž$J"tXr u "% P$FPFt`* Pr t APKP e"% Ph$FPYPFt bPvvlP~t qPpv(tP`v rtPD uFruPpP PFP@Pr } Po"% PRP+P Pv_2RPZ2FVPRvPrwP "% Pm~t&t&P P^_]UWVv~= t= uG<=u DPVZP0PP0 PBPi0 u*M P(PO0 u*3<u ;t>.t Wj>*t  PP^_]U>.t'+PP+PP +PP]UVv,V t;6 t 4 P$VK t=uP] N,^]UWVvV<u66WP t P,P W,M<=t<;uFVy/QFl/F@PPW//V$0PW.W^_]UP t`PP+PFPPFv+PPP.PP]~u P8]UWVv<uV.QF.F@PPW\.VW-WG^_]U]UVvVP`P+P tbPV) PPPV PPbPPP tPP+Pw tjbPb;t;P;u+PBP-bPP +PP,bPFРb*Pv -F t+P-@PFҠb*Pv,Pv6-PwPFP#-FPPbPwFPv-`tbPPP+PM tkFPPP,bPP6~tvҍbP,PbPr } ,=u P-6FP uS^]UVv,V] t;6 t 4 P$V t=uP ,^]UV^?u'FvV tV Fދv ~=tF^F u^?t;uaQF^FV,V }r P,,^NF tV tX ^]UWVvvVPFP+P tFt1, PPPP t\<tVY uO P P PuFFP P ~t~CFP^_]U +FFFv FPFP* u^?t3F*PP) uFPFP u^?u+FFFFFFFFFPy ueb^F*PP) tGFPFP t8^?tF*PPe) tFPFPl t ^?uu+]U ~tuPrhH]U VFF~tPPvzF ~kF~t<t< t NF~u9vt+FPvPGvF~t<uFvFFNFv랃~uv,^]UVvFVPrP+PM tFPVPPE FP(pFPPP tPFP(9pt` P,-FP vb*Pv'x t.P@(@Pgxb*Pv'Px'v tFhHzPPFP1FPv'FPRP'xtx=P ' P/PRt }P e~t4FPi(r%P+FPP ,r%Ptr%PtzP uN^]UhH+PP]UPP< t{PP ݃؎&?tP Pd ]U4v F uPFP&AF̸`PFP%PFP%6.APP FPPFP u3FPZ&=v~.uFPFP&FPP  P 6 t2 PP ]UvP]UvPpP+Pb tFPvP\FPPP7 tFPxb*Px%z t.P%@Pzb*Px$Pz<%p% FuQPPx% u;P ƆrƆsrP Pt$:N t ,~uFP uFP7 u|PPFPFPx$FP2P$ztzP#džv~tFPP P+PvvtP t+ tFP&P 6|P uZ]UF F FF%?F>u%Fa~uF ~ |Fp~ ~n F*PvPvPE ]UF P+ҹdVF%FF%F*F=t=t*RvvvvvvvvvP  vvvvv]U*FFPSF*PFPvFPvFPP ]UFPFFF*FFFFFv P%PB =t=t,vvvvvvvvvvP vvvvv]U2P)P(]UAP8P]UOPFP]UVVvL uV v^]UV+^?tc tA<0r<8sf,0FN=u F6t F*P^*P+F볋^?\u F^*P t~t F*Pt^]U~Ar~ZvF*F* ]U~ar~zvF*F*- ]U~0r ~9w+]UVv< t< uF^]UWVv= t= uG;tWV  < t < tF<u<u^_]UWV+v`8t<:u+FGF<uvvW ^^_]UWV^ ~t^^F*P t^?t7^-0^^*V uи+^_]UVv <*t t068Pt݃FvvPރvPT݃vvPރ]UWVv |Z,u}uuu؋㋇tF t PXPW[^_]UWVv(<tz|:ut*Pz*-a܋6܃;t+FW܃>|&>KPу؎&*;t~t P+^_]UWVv F^*PF0tV!>*t * >.tQ  t >.u>.u4 tV+Pt<@uDPV>*t ?u<DFG*ƇH FP PكG*HHF>=t!="u~u+F=!u!~uGWu~t&>*t9=|u~u G:ҊGF+^_]UWVvG-FP3 u, v' usv@G-F/=u~|=%tE8G1tFF^?tǃ~}F^F?tP׃PPvփF }v`@G-ӉFw-P Pvv#^FG!^^_]UJV>.tsvF uP0ӃFءG+GGG GG0^`8t@FP@PՃv~t`PFP`PAPPPevAPPPKP<@P҃^G ҋ^GvP[ҋF*PP{ t0F^F uF*PPV u^FF^F uF0P@P҃^?uPуPу>2u2>4u4F.,^]U >.u]U>.t46уG0.u ,*]Ut+dt8GUw PK+PP u s Pw 7҃F |G]U>.t"tw"҃G]Uvv,~t^?:t~u^?:u tы]UWVF+F* u[= t&=uN=%tJ=|t3}^F؊Fc~ u^u$?~uF :҃~tyN^FPtPXPtPtP:ωFvFPtPv΃ tw^?ul~|dF^FوF<0r<9v~%u%DFF*G -0FW tW@FN uW=rWFPWGF #<u G o_^_]Ut>t39W|#9Gr;WP|;GwIGW+PRwwYЃP Pwσ  GwGWGW+ *]UG ]UVv>.u<:uFvdž||sF|^*P u^+GGGJ#~PP~:uPVP  tt,>P^]U>WVk͉F+FFvPv PPvG  uFFPPv PPv  uhFPxFƉFċ^ĊF*P u ~*t~?uF݋^@PBPv& FPPv|σ t PPv  uoF PF*P u!FʋFL*-0Fʊ*P u٠*9Fw+FVPv vv<=tF< wPPVrP  t|V`PY~G= w=uYEP7Pv vv  u+F~t~u+F~t vP^_]UVv2P?˃F>tvT˃d)VF|%u^G1< rٸPPVV"  uDPF|(uˋ^G-b<)tbʉFF*PP  u*P u <*t0t6 ʃ0]UHV>,tPɋVPȃ t PV( VF @PmɃPV <$t*F*P*=gttv=$u=_tq=btg=dt=etlFP(@P˃FP`P(AP PF^PR(*APD><|s0ܸ$=ht=lt=nt=pt=tuq=vtF t$^]UVvVI<t;V+PP@؎&*PFPb t P&vP+PP̃*P" Pn^]UVvV<t;V+PHPӽ؎&*PFP t P)&vPc+PPW̃*P4 P^]U>WVvzPFP5FPPC҉FV1b8u!^F*Pc u^V <u FP+PP PFPF*P" t*P~CFF~r܃~tDFPFPHVPvFP u#FFFHFȍFPPY˃ t D P^_]UVvVn Pvx@RPP^]UVvV| Pvx@RPP^]UVvV Pvx&RP P^]UVvV Pvx@RPP^]UVvV Pvx&RPP^]UVvVPvx&RPP[^]UVvLP蛻؎&Fv&G0 FVo<tGV+PPFP t P5~tF9FvFFvF- &G0 v P^]UVvv&GBFP؎&?t+P亃؎&PӺ؎&FF V<t2V+PvFP t P!vF&GB v P^]U VvVPFP+P tȉFPA؎&FFt?F~|Ft Ft  PFAPPrFnnVVP+PK uȉFFFFu P\FtP誹؎‹F&!>FtP茹؎‹F& "FFt  PAPP^]Uv F^ ?tXSH^ ?=uF  Pv  u ^F& G Pv  u ^F&!) Pg^F&t  Pv H] Uv FPF P4 u"^ ?uF9F|F9F^F+]U*PFt0PPF t6PPFt>PPP+PPƃPFF*=At-=Ft6=It=Rt}F ut+(FugFuY FuK]UP+PLƒFPP>ƒFj^ FAPFt"P P6vFv+PvPF]UW~ߋNFsIs&_]Ëŋ^wgNO3ËF u@^wgON/UVW~3O~߹Aً_^]UW~3AيFO8t3_]UWVv~3AًD3:ErtIIы^_]UWV~3Aً~^_]UW~3@@_]UVvַAZ 3Ɋ :r:wȈ F^]UWVN&ً~3ˋvD3:EwtIIы^_]UWVv~N=AZ $ t tFG:r:w:r:w:u3:t rIIы^_]UVvַaz 2 :r:w*Ȉ F^]UW~F ^Nt f_]U^WN^W]2~$PIN0 :VINQ @ABCDEFGHIJKLMNOP Open file on drive(s) , Printer Busy UVN]U^VN6hD]UFNV6hD(]UPPX&G Pn]U^&:Nu@P:V r@Y"sP&PX&G Py]UPv P=]UPvP(]U^&G$<t G"P^&O]U^&g^G"P]UX&GFPPu(XSPPX&G PXS]UX\^F,@&GTX]Un:r]ànnX&:G u]X&G%t]àn6n\S\&Dt#D&g&D&G&%s \&O\&OX&DXSX&G d&O dQQP\P>DtD&O&X&G%tv&gpp&P;Du@YPu@Z"spp&;Du36D&&tlt&D&D&GDt&X&gXPX&G%tPPX&G P]UD&G"%ufD&O&X&gX&GxPPnxw9|#zt"%P6z<txA&zxs>wXSPPPPPPxȴ9xw)PPPPPxPxsʰPPPX&GX&GXS4]UD&G"%t 6n1]X&wPP X&G P]UX&gPPX&G P]UD&G%t]D&G"%t 6n]X&G% &GPPX&G P]UX&gXG$PPPX&G Pb]UD&G"%t 6n<]*X&G%;tD&G$ @&`@&GF$@:tGD&9Ot=&GNLL&GPRD&W$É֎R&@B%;t`&?u4s-&`&G D&G$X&GX&OXS$PPPX&GX&GXS!MX&G @&``&`&G X&GX&g`GPPPX&G P]U>DtD&G%@u]às ]Uvt򤰆Pv_PPR]UFd1N+ȉȻ 10F1ш~PX&G]UBbZrv@>XX&G :tX,X&G PVX&(t&G(XX&w 0ݠ,@&GTXPPVDFX&G d&O d{>ouX&D>DtD&G&%t >ou&O&@Ds 6n 볠sD>ntD>nug뙀>ntUXPPPX&G PXP̀>nu>nu뵀>nuR멀>nu;X&G%tof]CLOCK :WCCCÎ6hDRZ3ɀuR(Z~G'G<`sGG'G<`sGG'G<$sGCFlush1 :s___036hD.(k +2`<3w..hG˸˙  GHP)5555+++H,b,},i,D6?,6#DDDj5ZmlQPATCH C=>R Zt*tñhG.P` Xϊau C3BBt ra a `ua$aa€>(uK&>@t&>@u &?t䆨t@tK"J&@u*&?t䆨t K&@u&&? 2Pa aXD&lu&nc>h tE&t @.wX.!u<ubub\&^Z.ZSQRUWV@<u&&;t6>`t>0tct+ҋヿ:t:u  G B;(rۀ>6uq> uv,F&G>u&GJu 6\+PXX6\^_]ZY[\&^` bZ.. 6uz2{냺낀gO@O;dtd$,Gt9s!8,t>(tO, +OF +..`h`~.KKuPR.ZXu.!u:.(u..f&h.PSQRVWU.6j3jt D:uOD]_^ZY[Xf&h&jϾ@ J ^ h T ..2 3 ;hG` rhg ËhwË GFMP$תXø@r4dhW #G?@ۋr0 u ].<P!t+،9&u!t du`>2t.4t'Bt<8uC<u5QPVW>Bs@ؾD'@D'_^XYu@ء.:X. P.;:uJ><u,WVQ@ؾD'e]@'Y^_<X.<X.. .&0..SQRUVW8A.&0..SQRUVW8ظ@&&t#2t*4t#?t@t<:u<6t<*u&&9<9t$2t4t . . 62t>2t>2tt>2tu,>2uu<7u^:&2u3t~,tu46a aaa !tF><u%@ؾD'Z@'_^]ZY[.&0<X.. PQ+dYXdP,G@X>!t <)t<+u4AtqCt@u uT tM uCtA>8)u6>8Vu+<9u 3uAtɀ@t>,t>>u?t@utAt>8)u6>8Vu+<9u >u?ukCud@_CuX>8rQ>8 wJ8t7&8A82r#r!rrr'r ,r3rIrD&8@ًCC;u;t*t&9+`#'3؊4u4k>>2u t>t>2u?>2u?À>3r?t:tCÄy3u@<~t ȿ}t/8?t@utɀt >89Ë>tA狽^t㋟#989>< tuS>3u?t:tC[Pǀ=t: tG+XS>3u#>u?t:tC9G u3 u-t(u ;ru3ti u*ø=à4~,r]u>e,u~,6S8=,v*3,KS[~,v*4u3uQ:7Yu"u+G?O tG()@@G?8G>t!<u>u G>z O?2SGI [(t  gG(O 8,t uz,QOFYO,tA5 r"P8Gug(-P\XGGSH[Z:,uz<u,fYtM+þTK|t8~u>t4 66"&&F&FF H6>>+ۋB#4t Dtt6Grڊ,㋇B#7D$0Gt^S t^Ot^P=w0 As uO*@u84t7+4t2㋇>~,t @ؠ@t  t >}t"tBP>(u&(:w!:r>(u(%wQY p ~| !tUÿP;tCt&t0>f,u)SQR>|,tغtZY[GGCCô3ȱà"Auð|u~6>6666Pڋf``6G2t*2*ۈ543 t$ߋ> Guڹ6|~ö |uS( ((["ֈ|} :: 0}ðtuu P(BðtG tr P++ۊހs U~QRW/_ZRW/_ZYt]LJ~+)F Uv&QVRZRZ^Yt]Ƈv+)F  Êڷ Uv&QRV1^ZY]N vÀt{2ڃu w >u K#O Rێû@ۇ3ҴP&)ZRZÃu0,ȫ*+ÀuO +Ë QRZYBtc2uË>h} rQR ZYSQRu  uV H 0DZY[}u-U  t"ttU ËU ;Esu] F;uv+uÇ]ߋ;Grú &u2w_;wv+w*n? s ?u*ðSQRG W ZY[ÜGuÀgGt ?GtE|su U *E*㋿""W W ."c ."d"&".@#PQRVW>@#A#㋿""wt2"D2DtCr8+C㋿"" @# A#W $u*"wu>A#u_^ZYX"&""Ϡ@# W W t}u[tt=t&u];uv+u u U U } t^E- 9wE FEԋW Eu6;WsJw_F;wv+wB ;Ws**G tO<t<tG9W Ogt t$t$W tE USWW U_[]Êet t tt Às&2㋟,G4uSW$[G4  w}ÊW RRPPQԌG4x :Ws G@O *҉G@OQ^+ *< rG>u#@oGt!G& ^,G@G5rt:WsG@OGtGIËG*:r:r Gg:s:a G@OG :,uGts*ъG(:tƉG@PO to +yGt WyÊG :,u`  c+- +sX G>t DWG(GuG@GCv&>3t GPu< svȋUW$]N tGtNN wGO+΋GC@++vȊgUQRmZY]G@Gu xtIH;GCu*GPQRZYXG@wĉON)N t MG4I wURv&vZ]N uVv&vȊV U\]N u^Àr u P?>(u <@ugG>u o! .e,PX8,u%u@ء$0<0u u) uH"8,@ttu 8,t gJu+uFG>uROJS[6+uZOJS2[6+K3A,ÀgJ+>>@s >Ps G++@>rK>r߹}ڰ0рt t@u4,:GBtGB@ڋcføÊ+t+uG!Єe,tQYݠ,:G t+%$uo>G8,u u GIG.f,S[GIh,+GI+GIPG!e,XG(+.+GIGI6,GIPG! e,XGPVQPXY^ou@o>.f,G!e,+øG(;@HGP(  GG$GIPXP+:X:,t2,+8,At WKIt ItIt}%ú=t =t=t8,@t tyv8,tu 8,u` 8,uUS=@t=Hu㋇",[PQ*BJY>(u$r@ Xg, * $S_B:[,t"[,*S [ t [+Át$ށu u}$,&6,%6,BJ+øt1B)(1LS4[OE2G S[G!Єe,uhghW RQP y:w(r€Pry + +tuo(*5*-Pg(H-P*ҊGF+ *ҋ*҇ʑ+uð gGt G' *gƠPX2)W@OPg(-P+v P*GGuG& Ë@O*tFF|0 x:O(sO  xPsx g ĊG$ ĈGGtdOO,Mg>(tO, W"ËW"Gu!O GtgG%w ĈGÀOÀgÀOÀgÀOÀgÃ>(t>e,u/>(te,umH&(ggOGIGG&, 8,t O,OFgG!c, d,G> GI$.%W  0@G5G56 @G5<r&p% uG4S#[G4,QYF>(t 6c,_>(t 6d,L,VQj,ur,xY^F_QGtRGJuG>t!,:G u>V+G_~^w+VG_Z^ÀOug u,8G ÊG(8GuPðG4tSQRUhG.]ZY[SQ,nY[SQ,G4nY[ÀtgG+:w *gx :wĈg+WPg++ЊG*+ЉW,ZOEGMG>u:f,t8,ut*2TGEtgE2 G S[8,tbË&G!tGS^,d.b,b,`,wWOQRO&P:b,Xtt.OAtOA+;`,t FFFFD£`,uZY:wvFFb,y[ÊG*G@GG*G@GËWG(*G:sP*G:sЉW*^,+G!& GWt΀tʋOtŀOt*+ʁG!WQ&GuY_Puʘ,ÊG€S_&[uN+ÀgG$0ÀO@G$}t?,>(u>f,sA>f,Pr:R8,uY,xwG8,uGGZ G>uGJtRS2[ZGu +GG@GJP" uwG8,uGeGXRtNi>(u>f,s >f,PrRCZ"8,tS_J8,u}[GJtS[G>t S2[OSo[u>(uWSRsrC@@PsC@@Y+r tȰ;(}->(u$&&&&:&&uGHZRPX:GHt9(Ht (GH$ P$ GﺸXZ[_ËO,RtBJBrZË>h} sr~,[Às~,t#6s*.+3՜8OPQKP+X;Ou ;GuFPGGGGOYOG :,unXlW6c,_t6d,GwO=fG4Otte|g(̰O9Ou9GuOGu;u?G tS5[P R,Cj,Zþr,WOxD+wƀsDWOxPW€PtCVRQP\,^,t XPOON&],>ʡ\,4XOt],$YZ^VQt^,X ǞOY^P&F:G XudGG++^,(&4uCGGF-u"QR++Pg(ȎG_WZYOSRGGt;v>i,t#>i,t'uut Z[SRU.Gtqtmpv.i,<tP<tVtu+uttuut.7p;v+ȑ7%.8,t!t]Z[P.g, P!tĺXRS RSGWuu ut[ZRW_tu utZVWQGvsY_GWG_u_^RtBJ@B:,t2,^Z8,tWRW` uDG>u8,tvvuڿ@:r*Q*̀Yu_Z..FJwW.>h]`>`u6&4ߎ׋&.VSUURQSP>hU VsNF t<t<t< t G>uBGJu<.0G4X[YZ]]^^`u6&4_ϊF<u PFu^X[YZ]][G4^`u6&4_1~1111111q22253 0 0N333444F$<v 8, t<v>(u5<@thU SUF][' 0@ P`pNQ&OFYQg`u:wOYO,V:w(rw(:WrWrыFG,FFËV4YrVGvVCr@GPnZ~tNVW_^NuN fRWb_ZNuÊF*Fr)@+*Fv ~t+ЊF*Fr @VNFËGuG&FÊFfNPsXGt3QeG& ^,Gr:WrPYFNP*XGt6QG& & ^,Gr\:WrYËЋS^ [@ؠfGBÊNu uz uvuQYwgGÊGIgFF8,uSKF^VF <u S*[=8<u<u<uYQQoJ ͈OJYYQˀIt ItItˋN[8,uNSF<t<u gJG>u O! e,<u%G!Єe,t G4Uh]OJO!e,FtU^NVF n ]]NVF F [8,uS^6^N[ËF<t <tD<t$<t]ËNv ^ fVQ Y^ËNv ^ VQY^ËNv ^ VQȊVWV#Y^ËNv ^ gVQȊVY^À ru u u{uRW 8,Zu .5P@11 451N$ 2.N)f2&h2.f2PSQRUVW9t B *7 t_^]ZY[Xf2&h2.. F}~ u ^*Ƈj2 LTDu8|t|u,D\P+>x&EX2;rF\LTDt tD |uTL+V00^\t*(LTDs|uV>4\&6@&^4(dlTlrOD|uPV>64@^X<t'؊lTDD S@Ê*&[S@Ê*&[ô>$Ջ u$Q"33>YSP+PP4P"F#f5t "B#f"J#MF %^$*}Ƈu #Euv>4^@&HF+4))u$>#fu>+64F@H2 ËF %F @'HJ(`X$*!t 9t1a_o6<U&6>z2tf $t1u092$0 *3>' F}&7*ۡ%S$*j2tj2t j2t[sC[&O:v *ĢN&P!tS$*[â$ $')Ȣ79N+6x&D L$79Dú9f !+6x&*쨀t@uBJBJ$%>z2u{2 uFz2$*tu#tQtXQtX5E E +634R*X654Ę664ĶP t 0X&>sWFA33F 2z2-2Ɯ24>h} s3/4Qz2uVO Wg!uQS'GwWʀO;B4t A4B4ɀ O_4[Ygr>4u(>!u!RZt@4QS 4[Y┊G@4^ t4tSV^[4wSQR/ZY[ u1RGG*&4GD8Gv(GGD8Gr(GGZ++ø+ϋs4;w+щ444+á4r ;4w4ø)Êڋ4s42㋟B#_ 2㋇5Ë ~+ +v3Ë^ ^  5nG\^G <0r"<9ww\,0ȍ^CЀPr38*s+ËW^րuuPrP:w(rw(֊G^dJ.fJ.hJ.^J.`J.6bJ.>dJ.fJ.hJÀs +ۊ㋟<gGJtt>3uu uGt5ătGH3eăt GHGnăt GHGGdH8O-O'OuGdHGt8OtQ RYOÀs O G s<u逊S-[G S[G V逊S[G S[G ;Ãt#u G G -G G uG G  u h?c s O :O Qo +O BGt76GuG S][!G S[G S}[ÏGS[S>3u?t:tC[@LX6> uqGpGsGGt W u  uGlpP@O,SKOGO6PGOGOÍ6Z5u6X5DT‹46Xô6P u(=s 8,u SGt4W3ہt غt !!!t *  5 t23ہt ؋5t !!tB>(u &tp5s5>(u rr t tUE <|t5D54 tw>5t56t&ߋ? tGG;EuEGX>X[X>6t 66%G GO +(++󫿀6>66+ҋO +G&u6Ës"( u Vn ^tt 6SQRVWڎ33t!3tӹQY;t2_^ZY[323۹WQ&%&;аsH3Uu &33 pq&P&&:X&uGGİpqY_+ҹ RtY0+|ͬV^uÊȲiS@G332Ҿ`5p5[åë«úYGGi +4+fE& !t&M!P !!!X!PX3&5GG ϴu du`+d$`Ȏ^vBr6@ۋ^\^ f^f[f]fSRG -/Z[f+ۊݱff&%? &o-@V&:lu &\&|*@u @=r^ËhghGÀ>tRU ZugTRSVU  ]hW ^G &@tCՋ^vGt gGtgGt::zD&%++vg@tVNN@Pđ&t&EVPv^MXPX< s<u PvXvDD^G &@tuB7tO GBG,&2 t+tyWRQ&@ FFFFYZ_uǻ.&7Ru+DuOD uDuCDt;0ddtEuDu0ddL><u&Dt 5uddVw\d u<;r|-t|-t|-tD1t&|-tu,S|-uD1u <7u^7;88D t< tD*uD(S|/u?t:tC[Pǀ=t: tG+XS|/u!|0D0u?t:tCBs&47+Às&87RMU nZt3u% < GgG OO tG+Às&<7U tD.tD1tdD$s D$ D tDu$Àus&@7RU Zt~ tvvN RGZ.W>h} s_..TRU [U |ZtVSUURQSP>hU V+xF<w .^GX[YZ]][^_^^ _-_9_>_?_R___K`^^^c``ÀOP + WNO`u :wV:wrw:WrWGËFGFFËVYrVGvVCr@GPnZ~tNVW_^NuN fRW_ZNuÊF*Fr)@+*Fv ~t+ЊF*Fr @VNFË [G&FGuC^5ofNQF< sPXD|Pu dİAYD+FfNPXFNPXGGÊN s u u uuQJYwgGÊGgFFW w:BusSGIuBr"S=_ [,@ء&%C 0&><t#D'><u@'w=G "؎G&0&t[ˆBrS@%C&><u D'+GItN=_ G g 0"؎G&&z&&t[USWR.>Bsq^?tr?tatq.u BG';tBW'( tx tsuPOĀ?P:wsGXatFˌ;tst.BO._&tatQ(M `u:wOgOYxu BGPeu\b?tg?uXatf.u BG'2uBzW'(uB_GЀPr3*s+ËWրuuPrP:wrwG3øTX;uX0PX00tKk.t Requires Intel 80386 to run. Press Ctrl/Alt/Del. b {T%^=6  ] X >(u+ y) B} ,_'.m>%D .m Q7t D+3YCCXXʾkw+C!+ºGB+.mø@+D=s;r+D;r36xR &E،zxRÈD!D!8. .ø&@ء&%CB'D'б$D%@(<u(%(%(s(`u2()(@ً (C)Î4&QY&+u(&QY&+u@+Ã>(t`uyQsZrUC@@ċrCC@@+r,>(t(+sڃ ;(s(Y☃.(GuNuY(ú !tݻ4tÉ)t )+&,S[&S[&9&,!t u3  3x>x xt"(;øGt(+ێ_ttz, |,,,8,tJ.>HJuA.HJ3Ҏڻ~2&ȋG &øvྡྷGuu+@ e@[t&>@Uu+B&&&;u55úP&Xô$;sA6QR+ێ+^ZYB6QRUuUu6;ZYuBPRD&DZR ZX;D+DþfDnDfDnDDTtÃEUuVDËXXWO6D\÷uz,+D D D D!(t (|,8,`t8,utt t u8,<u!tu8,@+D!D !D!X% >Dt%% V^*RV^ZBr8,u>9,t >(u:,8,ta@6;,W_؉>~A,?,.FJ .FJ,QK3A,Yn+S) [;(C;(u+P (QW _WW+_(E_Y+(++( JD>(uGG>%DË 111CCGGË(B+ҴB@Q& t Dž Dž  0GGFFYSG? u[ø@&6c8,@t8,u*^+Ƭ8,@u*F6,譬&cñG +~!t[dt O$2㋷B#T L tD G tCCB#\(GD(G uWG _WG_QR0<0r<9wNhsb0`s1XrR&+VRPFZY++^XYQP&&00&D&&&B&BZYËBrËV^t&À>8,t 6,,SQY[Gnu8 }^,+󪻬,&(gQG+ Yn,yu> t ) 4 L i, C t% 6  . +&6x&&L ]Ȁ> t C ) ?CC> t Kuú 2Ë uP s=tt 5(J/(("((+"(-$( 5"(23&&6'60 (2V6^DË(# SQ7V^DV^D Y[CC&|&E&M S"CuGDG[ûر=r؉4Ë,D4Ìر4 ;,Ds@%4+Ɏ٣z3&L44((( u>%D*DQWЀʀPXs_f 264_ uO4UuCG<t<t')D*Du被4QSWq_[Y uOYIt{4DP>'D4>Du+&T.B&V.B&T.B&VË4G<u>OowQRSW_[4G<t<u)DZYW_뷃ZYWSA.m[6 .m_PDS.m 111W +&E &E E$&EW7^ t _Dž &.m_ߋ6%D+޲ 2*D644GG[Ë.D&M&m&uSWV^_[ uW>4UuK&\&>)Du&E*&GE&GE&G E&G EH&G&Gf+ø eu t@EeȋE+E+M +@@&GE &GM t &G&g:+Dv+DV&GHr拌 D&G&gHu =vFF&GD&G&g&G&G^ù.Dw$?GŊĀG4G_ *DGƈt?"DL*DL ËCZt/G;sG;v+GGuX6X+ҋڊC薝O R@ۇ+ҴZB uD+ұR ZB uY t(R[Zu6ڀCt3I3!$!6!H!ûWt G ttOuÃ>(r(G(@؉tQOGw+SX"T D\"T D|[GGōw >COOWCFWߋCt@C tQRSpJ[GW+GG4G ZYR D  sZËDD~!LJZ! LJl!v"RU J=r = sBZ s ~'s'Ì؎+DJ&5GG$. &. +)& G*(CW t Sc[?@ً-+Ҋ.7++@،Ës#Zw;v;rBƌ+ËոË+ú24#)4+~!tW_~!2㉇5G u+ێ&&_&WÁ> u0 t(V@t"H=uv446644+.>t&& Eu &&M4G=0rI&}r ȫ)@@ûwS(GD5[GE+<t V^&FítPX ìV5^u+60GR*X62G Ę63GP tR 0ZXÊȲ G< u$ێËB  t &4&àD D ú D!B+2`Q`c`{`ۑ``uuvUU`I'?    Setup Buffer ==>CCHELP FM TREE DIR CHKDSK DIR A: FUNCTION WMENU DSKMAINT STOP @;<=>?@ABCDGHIKMOPQRSabcdefghijklmnopqrstuvwxyz{|}~;<=>?@ABCDGHIKMOPQRShijklmnopqTUVWXYZ[\]^_`abcdefgHELP FM TREE DIR CHKDSK DIR A: FUNCTION WMENU DSKMAINT STOP HELP FM TREE DIR CHKDSK DIR A: FUNCTION WMENU DSKMAINT STOP HELP FM TREE DIR CHKDSK DIR A: FUNCTION WMENU DSKMAINT STOP HELP FM  TREE DIR CHKDSK DIR A: FUNCTION WMENU DSKMAINT STOP IP@G7>.5 0:00:00Prn= ____ WinCapsNumPrinter n Out of Paper Retry, Ignore? Out of PaperNot On-Line RIUS F DUKDK S I E N2434kwF- ]enWG<< Uninstalled >>KLFQ\grdHdHdHdHdH~^'`        \}{a{@}\ee}ii~[]E{[o||u|y\]c#\#faiou|\ao]['`@~[|@~[\]{|}᎙ +;K[k{^'`AaOoUueiyaoueiaoueiEaouei1234567890-= qwertyuiop[] asdfghjkl;'`\zxcvbnm,./!@#$%^&*()_+QWERTYUIOP{} ASDFGHJKL:"~|ZXCVBNM<>?    1234567890-= qwertyuiop[] asdfghjkl;'`\zxcvbnm,./`!@#$%^&*()_+QWERTYUIOP{} ASDFGHJKL:"~|ZXCVBNM<>?      1234567890-= qwertyuiop[] asdfghjkl;'`\zxcvbnm,./`!@#$%^&*()_+QWERTYUIOP{} ASDFGHJKL:"~|ZXCVBNM<>?    *Ff*% *PPbParity error from PROCNAME at 0000:0000 **** MACHINE IS HALTED! **** Unexpected Interrupt from PROCNAME at 0000:0000 Type any key to stop process. Division OverflowUnexpectedSeg. BoundBad OpcodeProtectionPage Fault0123456789ABCDEF 0@ 0 D;xx         vvvvvvvvv444444444LLLLLLLLLLLLLLLLLL!!!!";"_"""!!!")"M"q"""{In####$J$v$$$$&%R%~%%%&.&Z&&&& '###   `'j't'~'''''''''~'''''''''(???;?=?oa ?d go((2 )i,DJ aPR 5-.[WWB!!!!Mx#14##%#-#2#9#>#E#L#o#u#}#T###$:$B$a$v$$$$  $$$$$$$$$%r  BV%%(E4 ABCDEHIJKdloLMNYbcefjkpqrstuvwxya:01234567!z[( ^ f /// ////// ///////////8(- dp&aPR + 8(- &,qPZ &qPZ  + ,(-)  )?)ڿɻȼ,---OOOPPd.P0089:;<=>?OOOPPd.P0B089:;<=>?OOOPPd.P0089:;<=>?OOOPPd.P0089:;<=>? Concurrent Error: This program suspended while other program in graphics. Concurrent Error: This program can not run on a serial console.DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD   @ ROS Command Error Bad Address Mark Write-Protected Record Not Found Can't Reset Disk Drive Setup Error DMA Chip Failure DMA Address Error Bad Track Flag Set Uncorrectable Data Data Was Corrected Bad Disk ControllerHead Position Error No Response Read Doesn't Match Can't Sense Status Error Not Defined Disk Error Drive X: Track XXXX Some sort of detail Retry, Ignore, Accept? RIAd 44(CGABCDHfJKkLMmsu=?hlnEEEEEEEEET##F$$(E(EFFFEPPPPPPPPPPPPPPPPy Concurrent Error: copy protected program cannot run with fragmented memory.U\\h]@}]B]N$^fefQfff{efffffffff+g1g9ggUggggggh hhh h?@ABCDEFGHIJKLMNOPQRS!@#$%^&*()_+QWERTYUIOP{} ASDFGHJKL:"~|ZXCVBNM<>?* 789-456+1230.  !"#$%&'()+,-./01234579TUVWXYZ[\]EFGHIJKLMNOPQRS     * -+  !"#$%&'()+,-./01234579^_`abcdefgEFGHIJKLMNOPQRSxyz{|}~ !"#$%&,-./0129hijklmnopq.0.3= YTERG=8 E=8 T::3;i;;; f>>?Y???L@@@?AAA2BPwe aPR Pwe aPR Pwe aPR Pwe aPR Pwe aPR P we aPR P we aPR P we aPR P we aPR P we aPR Pwe aPR Pwe aPR Pwe aPR Pwe aPR  Pwe aPR Pwe aPR Pwe aPR Pwe aPR BFlushPINCC @@@?G-uu7a99BBBͻ Concurrent DOS 386 for Intel 386 based PC's 17-Nov-87 Copyright(C) 1982-87 All Rights Reserved Digital Research, Inc. Monterey, California, USA ͼ Hardware Supported : ( Diskette Drive(s) : ( Hard Disk(s) : ( Parallel Printer Port(s) : ( Serial Port(s) : ( Numeric Data Processor : 6 386 Paged Memory (Kb) : ( MDisk (Kb) : Printer Numbers : EEMS Pagedd  p$y,085B@0DD ;Zx0NPCTmp0 PIN0 Flush1 COMPAQjAROGATEGJ'G(G,G0G4G8G<H@ HDHHHL(HP2HTKHKRK\KfKpKzKKKKKKKKKKKKKKLLL$L.L8LBLLLVL`LjLtL~LLLLLLLLLLLLLM MMM(M2MrTrjrrrrrrrss0sFs\srsssssss t"t8tNtdtztttttttu*u@uVuluuuuuuuvv2vHv^vtvvvvvvvw$w:wPwfw|wwwwwwxx,xBxXxnxx3{ &  &_  &>t  -@Ћظ+؉ Ëʾм P &6h&t(6   &6h &D( &D* =!s <tl< t< t ~<t < t< t G  <;tǻ  ?t3VrGZ < t< t<=u< t< tNW >! ! F< u$ ! !\PS&GtZ t >Z u > u M < v2Ȏ [ ] [ K!s  +&?t &G&. +. GtGtPs&Gt;  =t=u|t4D&&&G"s | u6 s0&&tns G@G JsO0 ! F<u$ ! !   s&> u. . > t Ȏ؎Sa e &G_ &Gc s GGGg Gi G،Ȏ._ .c Ȏ؎Gt[SF ^ DFDFD FF3F^&1svFuZ tX2Ws  DDD؋ތȎ.c Ȏ؎_Gu#. uD@DDD. uD+r<ȋ.  RQ.  *K:t<t - YZ  ?Gt?r:?&E G1r,&EG &G &G&G& ; rQWȡ ; w + _YSQбY=t Y[r ش8!s{ !,Ar<w   !r=r=w   !V^r r+. . _g& G& !ONOFFr  !SQRW 30r wr r F;u_ZY[ u  > u ti ౒. .& +ءH.Z J.\ H^ J.\ t+.Z HJ@ء &k m  k )   k o  +؉q o k H!H! ؉ . À> u k k á  ;v.  ZG< t M;sM;wE+ȉM5ھ< tAU;s6] &U;wډE+ЉUZ? 뽍5\CCONFIG.SYSSCEPTER     & 0 9 C? G L R DEVICEFIXED-DEVICEEMMEEMMCOUNTRYLASTDRIVEENV_SIZEBREAKBUFFERSFCBSFILESNETWORKInvalid command in CCONFIG.SYS... $Bad or missing $Failed to initialise $Insufficient memory to install $CON, CLOCK or NUL device not supported in $Invalid country code $Invalid last drive character (use A..Z) $Invalid environment size (use 128..32750) $Invalid break switch (use ON or OFF) $Invalid number of buffers $Insufficient memory to allocate requested number of buffers $Failed to load SCEPTER.CMD $ $GENSYS [10-Nov-87] S _PP...>S.>.lм66666+66;t6J! +33kP.L! uñ..SA.3ùS CJ3Ɋ>2>#T%!..PSشQ!.;t[X˃ PPPPUVWv~J!r+_^]J!UVWVF.؎F)!.)!K!s+_^]UFË]UVv`6 Z PAOPidVc/F<:t tV (' V#<t<:tV uVPU =PsP,+P^ ? t+ M   u~  P  v6f OF6f PFPPs(FtP6f RN6~u0P6f uF]Uc > t> u:> t) P)+PP% t2 > t9  t t!> t u t>> t7w+P. 6 +P > t PB  뜸P 6 Pp > t  P PM o]UF=w7.FP P *1"P(\%P(ۜVll~ ]UF PZ PyL]UVdžD džFF^?t|?"uDu+DF܃Du^?>u:FFFdžL<>udžLFvV P+PJ"VvNL벋^? uFtt+P,$ u P'6> t NF PFAJ }P$ʸP+PJ+P=J$ > u ~uP# u x> t' APP P'F P P"FFLt Pv +PvJP$ }LtP+PPJPPJPuJ\ > t  +^]UbWVv *Ps t<.u  vFFF*P t^FFN u^FPJ D=tEFP5lJ u,VF}t ؀?uu{ VvU~uFPv+PFPJFPjJ=u~:u FPMCFPFPsF }#=t =t=u P%v" FPvV^_]Uv" t ^*P_*-a Pz ]UfVvFPFPIFPFPI.PFPIF t FFFFF *PvHF t FF~t>F^ヿ t^ vH u^ヿ u FNj^FOPP u$=PH@PF(PvHFFFvvvFPvv]F u vI+D~tF9FF;PvH t DFF~ű^?u^]U4Vv v%H^ :uF v 4H=v#v &H^ 8@t PvWGvvKGPv>GvGFF ~t^ +F΋㋇ Fvv G~t Pv Fvv F PvoF }*=t =t=uE~u0F΋^㋇ F uvFv>Ft ^ FΉ+^] U~u F*F vv(> tL+vF؀?uF6 svFP@FvPFHF@PF^P@PEvvvFP ~}"~uF v  C]UVWËI33&8tH~t >N~ u-UVWt~ u 3_^]UVW^ttۋ3:t uUVW.t-33&:uߋv &t&3&,KC&>mt&>zu & ~ك33Wʋvu_ Y&:u[Y-+r/;r)XZRP+RPQUFr;r]øPZ PCUF= s ]Y+r;rPZ PCU&4^F&2]UV!]ô!UV6!S^^^ ]ø89:;<=UVN!s]U^>ZUN^F?@U^VN!s]ôAUB^VNF !sؙ]U^D!s]UCVNF!s +~u]UVvGv3Z^]XXL!M!UV!VNNUV!OUV!s+]UW؎V~v__]UWF^^ ^!r+~u ^^ ]U*!^WG]U^W+!]U,!^͉W]U^͋W-!]ø7!*ôQ!U.F!]ôT!UV3!]ø3!˜øQD!r%3UVWfV!_^]UV]UZVvFPVP+PFPFP+ u~tPH FPV#^]UDVvAFF: FFPDP0FPP^]U VvVPFP+P tVAP>v|:u&*-a DP"> |> ~ N <=u"F<t4V t7<u%PV@<uv t6 # vPM^]UV^?tSb uYR P! ( Pl : PFFP PL]~tvBFP^]U v5FPFP u^F*PP? uFPFP u^F*PP? tlFPFPv t]l =t=t?FFF FFFFFF=P| =cFlFP uFFFFF+]Uv+Py]UVvtt> Ktt$?  t ^]UWVv+FFVP"P+Pm t<"""t'FPVPP`FPP+P, tPP> AP P*P}> A* P*P=-P @PFPnPna>(n:u;}((n(t(un:u-P(nn @P*PnP@P<Fdžr - "t+&tPPFPJ "uF*%;&tF.PFP<$ tF9$t $$dž$"tXr u "% PW$FPFt * Pr t  APPV e"% P $FP-P7Ft 6P'vv@P~t EPv HP  vS rtP< uFruPpP PFP @P } Po"% PV RP+P Pv!=RP=FV`PRvXPrKPY "% P~t&t~PlP.^_]UWVv~= t= uG<=u DPzVPx;P;vPP+; u MrPP; u 3<u ;t> t WA> trvPVP^_]U> t> t6 +P]UVv V t;6 - t P+$V t=uP  ^]UWVvV<u6WPv t PPWX M<=t<;uFVH:QF;:F@P(PW9V:PW_9W^_]UQP t_PEP+PWF+PPFv+P8ZPP9P[P~u P1]UWVv<uaVv9QFi9F@PVPW,9VW8WG^_]U]UVvVfP`P+Pt tbPV PP{PV PPhbPPP0 tPP+P tjbPb;t;P;u+PPn8bPP PP7bPvFР *Pv7F t+PO8@P?FҠ *Pv7Pv8P*PFP7FPPbPFPv7`tbPdP>P+P tkFPP P7bPP ~tvҍbP6PbPj }  =u P6 FP uS^]UVv V t;6  t P$V t=uPr . ^]UV^?u'Fv%V tVFދv ~=tF^F u^?t;uQF^FV_7V }P ^NF tV t^]UWVvv<tVY uO P~ Pr PeFFP P ~t~CFP^_]U +FFFv FPFP* u^?t3F*PhP5 uFPFP u^?u+FFFFFFFFFP ueb^F*PhP4 tGFPFP t8^?tF*PlP4 tFPFPl t ^?uu+]U ~t uoP H ]U VFF~tPPvF ~kF~t<t< t NF~u9vt+FPvP]vF~t<uFvFFNFv랃~uv,^]UVvFVpPrP+P= tFPVPPE FP3pFPPP tPFP39pt P -FP v *Pv2x t.P]3@PMx *Pv2Px3v tF H zPPFPFPv2FP8P2xtx#P&2 PPt }P# e~t4FP3r%P+FPrP ,r%Ptr%PtazP uN^]U H +PP]UxPvP" t{aPP؎&?t|PZPT ]U4v F uPFP1 AF̸ PFP1PFP06 rAP,P FPPFP( u3FPw1=v~.uFPFP91FPDP  JP 6 t PP ]UvP]UvPpP+PR tFPvP\FPPP' tFPx *Px00z t.P0@Pz *Px0PzY0p% FuQPPx0 u;pP ƆrƆsrP Pt$: t  ~uFP uFP3 u|PPFPFPx/FPP/ztzP/džv~tFPdP P+PvvtP t+ tFPP 6 (|P uZ]UF F FF%?F>} u%Fa~uF ~ |Fp~ ~n F*Pvy PvP5 ]UF P+ҹdVF%FF%Fw *Fl =t=t*RvvvvvvvvvP vvvvv]Uy *FFPF*PFPvFPvFPPr ]UFP%FFF*FFFw FF PP2 l =t=t,vvvvvvvvvvP vvvvv]UPP(]UPP]UP P]UVVv2 uV v^]UV+^?tc tA<0r<8sf,0FN=u F6t F*P^*P+F볋^?\u F^*P t~t F*P}^]U~Ar~ZvF*F* ]U~ar~zvF*F*- ]U~0r ~9w+]UVv< t< uF^]UWVv= t= uG;tWV+ < t < tF<u<u^_]UWV+v 8t<:u+FGF<uvvt+^^_]UWV^ ~t^^F*P t^?t7^-0^^*V uи+^_]UVv <*t t06 PQFvvPvP1vvP]UWVv |Z u}uuu؋㋇:F t PPW!^_]UWVv <ta|:u[*Pq*-a 6 ; t+FWg> | > ~t P+^_]UWVv F^*PF tV!> t > tQ * t > u> u4 tV+P* t<@uDPV > t f ?u<f   *Ƈ P P݃ * f F>f =t!="u~u+F=!u!~uGWf ~t&> t9=|u~u G ҊGF+^_]UWVv G-FP` u  v7 us v2@ G-F /=u~|=%t E8G1tFF^?tǃ~}F^F ?tPsۃ PPvHۃF }   v@ G-ىF w-P  Pv v'#^FG!^^_]UJV> tsvF uP&كFء* G+GGG G G  ^ 8t@FP @P>ڃv~t p PFP P APq PPev AP} PPKPi@P؃^G ؋^GvP [؋F*Pj P t0F^F uF*Pj P u^FF^F uF&P@P׃^?uP׃P׃> u > u F*   ^]U > u]U> t46* ׃* G *  u   ]U* t+d* t8GU * w PK+PP u s  P* w ׃F |* G]U> t"* th w׃* G]Uvv,~t^?:t~u^?:u * tы]UWVF+F* u[= t&=uN=%tJ=|t3}^F؊Fc~ u^* u$?~uF  ҃~tyN^FPtP PtPtPgՉFvFPtPlԃ tw^?ul~|dF^FوF<0r<9v~%u%DFF** G -0FW  tW@FN uW=rWFPW* GF #<u * G * o_^_]U* t>h t3*  9W|#9Grh   * ;WP|;GwI* GW  +PRwwYՃP P* w$Ճh  * Gw* GWGW+ *]U* G ]UVv> u<:uFvdž||sF|^*P u^* +GGGJ#~PP~:uPVP t* t P^]U>WVaӉF+FFvPvP Pvt uFFPPvP PvF uhFPFƉFċ^ĊF*P u ~*t~?uF݋^@PRPvSFPPv ԃ t P Pv uoF P F*P u!FʋFL*-0Fʊ*P u٠ *9Fw+FVPvvv<=tF< wP PVP+ t|VpPi~G= w=uYEPGPvHvv u+F~t~u+F~t vP^_]UVv2P5уF> tvJу})VF|%u^G1< rٸP PVVO uDPF|(uЋ^G-b<)tbЉFF*Pj P u*P u <*t t6 Ѓ  ]UHV> tiϋVP΃ t PVUVs@PcσPV9<$t*F*P*=gttv=$u=_tq=btg=dt=etlFP @PЃFP P AP PF^ PR *APD><|0ܸ$=ht=lt=nt=pt=tuq=vtF t$^]UVvV\<tGV~<=uFrPV u =vPV u &zP> trvPdPe^]UVvV<tDV<=uFrPV u PSЃ6vPVg u+zP ; trvPrP^]UnVdžF 0 @ : J džv)FPjvPPR PX P+P tpvY PX PPoX t v+^auF ^bu F 0 FPFؠ 8tƍFPSL F~vP^ PV PP6L vcH P6H F=u~v+t P6H * u6H a PPPtF t F 0 6H 6H   t >0 uF 6L L x,uSL @~u/+t(6L  t 6L L 6L L ~u5+u.Ɔ L +u  u~u +u6H RL v?FF~u*6H  t6L o t6L  u@ ~r+u ^?,u++u@ >@ t >0 uF 6L  t >0 uF 4 PB P蚾&4 u P͉X t P̃6H PA6L ZP2P'>@ u+2 >@ u P t+PPFPP剆FPP˃F~|FPFPtX u Pf X t~|P dž~} v `P@udžtRZPZP, u+ZP,䉆PFP ZPPd : džutk>> u/>@ t(+PZPPL  tZP@u8PZPP#  uZPPr@u >8 twFP/ʃF uF^?,tF;rL?uDSH P6H F6H d PPPytF t F 0 6H 6H P PuFP PZP⃾t0+PZPP  tP  tjJ cPZPP t\ZPP:>8 tP6D ZP/F^?,tF;rÉF8 F9Fr^?uSߣH P6H <F6H g PPP.tF t F 0 6H 6H P{ PpZPPჾt P< PZPPZPP6>8 u/FF>> t68 6D ZP>8 uFPǃF u%>> t68 6D ZP>8 uJ 6J j P3P)X t >ȃ^]UWVv<=t<,t < vF<+uV DPQދ 8t<+t <=t<,u^DP(<t ^ ^^_]UV^v<uYf~=t~,t~ vF^F<+uvFP݉Fؠ 8t<+t<=t<,u F@P݉F^?t^^]UWVvV F=u 8u+_~u|:tVz =u|:u 8DtVS uΠ ^8@t+PPVŃu |u^_]UVvV uCV` u8V ؊@F<t 8Ft~:t PV) PV^]UVv>> tMV u<tV usV t2 +PVaăD } P> +^]UVvFF FvY tF>> u~uGV tFV tF~tPFPVă>2 tR P6 PVPăVÃ> ~t vÃ<>2 t5N FX ufv؀?tNPvvÃ^]U< , vL u >߸vlP t2 >P t>F u Pʃ>P t > u4  PvƒT }PD< R P6 P6T +PÃ+P6N v?ÃN @ue, +]UV, F64 6B 6T ƒF. *=uv6T xƒZ>F t 6. 6B  t F+B . 4 9. t >P uF~t6T 'ƒ< , +^]UVF>, u>< uvr@u )@t>> u.~t:PvD > P+PP6D X t=6B F*v8 tރ>< t6T z늀$FF. 9Fr6. 6B 6D y;. tP8 , >< t>: t6D !> F>< t>@ u&68 6D v>8 uJ >8 t+^]U WVvV u ܸVPVD } P> >F ty+FFF64 6B 6D F*=uWW6B F t F+>B 9>4 tF+~F9FtPvv6D X }$R+FFP+PP6D 7 }1+^_]UWV+n v u#v~O=:u F |+^_]UWVv~ <uFO u+^_]UWVv~ aFF<tV]؀x.u VN@=tW<؀y.u W-AV =v|:uFW=v}:uFF8Ft+@ tHzPރ>< t 6T 裾^_]UWVv~ aFFV=v |:uFWn=v }:uF~bw~bwF8Fu+^_]UVvV 8u AP Ps݃V Ph݃V ^]UVvVVdP@݃P+PىFVF^]UVvV^]U VvFPFPᾃF V*ŠN*-xR F* V*ŠN6 PV/F |"R P6 PvP$v+ vX^]UVv<t 8uF^]Ëŋ^wgNO3ËF u@^wgON/UVW~3O~߹  Aً_^]UW~3AيFO8t3_]UWVv~3AًD3:ErtIIы^_]UWV~3Aً~^_]UW~3@@_]UVvַAZ 3Ɋ :r:wȈ F^]UWVN&ً~3ˋvD3:EwtIIы^_]UWVv~N=AZ $ t tFG:r:w:r:w:u3:t rIIы^_]UVvַaz 2 :r:w*Ȉ F^]UW~F ^Nt f_]U^WN^W]2pc!exit!echo on Unknown LONGJMP Error %c:\. %s a.b l v /.-dsawlprcnd:d:%c:%c%-9s%-3s%-9s%-3s %9ld %9d %s%10ld %s %*s $n$gc:..,p%s:VER=386XMx:*.* (%s)c*.*%2d%c%02d%c*?\.:;,=+<>|/"[]%2d%c%02d%c%02d%2d%c%02d%c%04d%2d%c%02d%c%02d.%02d%s E*****$CLS=p*****$ON=q*****$OFF= %sInternal Error Code %02xh . B ^ t *.**.*batchbreakcallchdircdcopydatedeldirdelqeraeraqerasemkdirmdmorepathpromptrenamerenrmdirrdtimetypeververifyvolclsechoexitforgotoifpauseremsetshiftj p=v {oow> "p  p  p   dx     >#<:788  +80123456789abcdef000000001000000000 Volume in drive %c is %shas no labelFile(s)bytes free%s files exist SystemDirectoryInvalid option: `%c%c' Disk full Syntax ErrorBad command or file nameTerminate batch job (Y/N) ? Batch file %s missing retry (Y/N) ? Batch files nested too deep Directory of %s\%s ECHO is %s %s (Y/N) ? Are you sure (Y/N) ? File not erased: %s - Label not foundUnable to create directoryNo APPEND PathAPPEND=No PathPATH=Strike a key when ready . . . PROMPT=File already exists Invalid path, not directory, or directory not emptyBREAK is %s VERIFY is %s Auxiliary is %d Printer is %d Invalid Process Name or Console Number 8087 is %s BANK is %s SUSPEND is %s MEMSIZE is %d KiloBytes LIMSIZE is %d KiloBytes Copyright Digital Research (c) 1985,86,87 Concurrent DOS %s Release %s File cannot be copied onto itself File(s) copied Copy:- Out of environment spaceEnvironment errorIncorrect version of DOS Invalid number of parameters Cannot do binary reads from a device Content of destination lost before copy onoffMust specify ON or OFF Illegal operation on CP/M MediaIllegal drive in Path SpecificationFilename too longFile not foundInvalid directoryToo many files openAccess deniedInsufficient MemoryInvalid drive specificationFile Sharing ConflictPhysical Media ErrorInvalid PasswordLoading ConflictYNPath requiredFilename(s) requiredSunMonTueWedThuFriSatCurrent time is Enter new time: Invalid timeCurrent date is Enter new date (%s): Invalid date mm-dd-yydd-mm-yyyy-mm-ddInvalid Number CP/M MediaInput Redirection Already ActiveOutput Redirection Already Active ;,=%c:%s%s%s%s%c:%s=notexisterrorlevel==indo$n$g%c:%s%scmdcomexebat\;/P  concon:prnprn:lpt1lpt1:auxaux:com1com1:nulnul:vszcabvszcabababab%8d  ! % * / 5 9 > C I M *.*%c:%s ++a  6 >t$ P>P63P %< t 6&tu'.+~&  >2P">X& y> $&  Ċ& p Ģ u t $<t &  T L6 @6 4X6& uu $ Ģ  uP]X6& uju $ Ģ +63&&6& >Q~q>t$ & >(~G>ùu%:W_êV38t2Ǿd^& ddE eJ󤱙2P  u5 @u GA >t 09- .W$uYHJ xCMLu(=t!uб33ұ,ຐIú"BR.Z ucRZÿA&FtG G3duAQYt  @ãMu4wZ3,Mu& !tPRlnZXáw /u"sw,3ұs3ຐuHQCCq3; IH2 ÊI* Ã>t 63P 6qP.W>t63@P Xu>t 6> G28FFut O t OI:JtJUtà .W.W.W ^ P.W.WX>yNu<uÀ>zNu< u:r:w>u>t]Zs_} s ]ms!OXJúJ.O\td\ 3&]>|Yusq >{Yum 3_ÿ5L=tW=t=t=u=u?Êt5E<:uE^t&^>`b^q}h=?:Et*t  tru" ñ&_&Wʱ౒ȱÊ t&==uGvr u ౤2X{XiW Z Ê t&==uGF!r u# ౩2X&XW Z OG)tôF.W  t.W .W |.W .W бmËKm @бmúmKú26  \ R.W .WZ WOGXtu>un2ౣ<`} F-m бmౚ&AÏ02؎Ћ6260.0 a Q U n Y ] C H  M R o W `  >Q& t1CãNWSގƾ<u[_2K>MtK sыSrC+ӃuRPP9NtX>QI8&Dt7I2& t;6Eu &;Gt'.G t3&G&.E t3uI&׊YQR>NOu` Q6ZY_Á>NOt O>OPrON>NrNR >Q& uZZ tWS&uYW6UoU[_&&Pެ؊P(YWX '>QG t 1G8Dt W>Q_È&D2& t1pW_À>JuSàP[`< r 0C0[u` [u#[u|R,Xࣃ=uS33ұ[tߎǿ6Q=PCu& u ǎl02 Aw󤿛&&6Q t02 Awǎ߻tM'Ș؋Kt ؊PJS>u P[XU FPPv+PVFPPv+PBFP Pv+P.vF2[vF%[~u~Ou^P^]UFP*Pv+PvF2@[vF%@[]UFPFPFPhF9FucFPFPvFPFPv~u;~Pu5~u/~u)F+FFFFFPFPFPFP]U FPPv+PFPPv+PFFFFPFPFPFPj]UFPPv+P~t ~t+FPPv+PvDDF]ñú û?wӱt3ۊ t< v,0r< w Ó0 ح t3ғ t00' 2E+2ò  'UVW^^^ ^S^X^^^ v_^]UVW&^F^&^&v_^]UVWiVwF^ F=u&&v_^]UVW/V<؋F=t &G4 &G4).>.lм66666+66;t6J!` +33kP.L! uñ..)A.3ù)` CJ3Ɋ>2>#T%!..PSشQ!.;t[X˃ PPPPUVWv~J!r+_^]J!UVWVF.؎F)!.)!K!s+_^]UFË]UVF~F P$% t PvDFP% tv+P<P FP PFPFvBv% u +P vHU=`spPM Ph?:  ]UF P PY$]U&4^F&2]UV!]ô!UV6!S^^^ ]ø89:;<=UVN!s]U^>ZUN^F?@U^VN!s]ôAUB^VNF !sؙ]U^D!s]UCVNF!s +~u]UVvGv3Z^]XXL!M!UV!VNNUV!OUV!s+]UW؎V~v__]UWF^^ ^!r+~u ^^ ]U*!^WG]U^W+!]U,!^͉W]U^͋W-!]ø7!*ôQ!U.F!]ôT!UV3!]ø3!˜øQD!r%3UVWfV!_^]UV]UF F FF%?F> u%Fa~uF ~ |Fp~ ~n F*Pv  PvP5 ]UF P+ҹdVF%FF%F *F =t=t*RvvvvvvvvvP vvvvv]U *FFPkF*PFPvFPvFPPr ]UFPFFF*FFF FFbPP2  =t=t,vvvvvvvvvvP vvvvv]UPP(]U-P$P]U;P2P]UVVvS uV v^]UV+^?tc tA<0r<8sf,0FN=u F6t F*P^*P+F볋^?\u F^*P t~t F*P}^]U~Ar~ZvF*F* ]U~ar~zvF*F*- ]U~0r ~9w+]UVv< t< uF^]UWVv= t= uG;tWVW < t < tF<u<u^_]UWV+v6 8t<:u+FGF<uvv^^_]UWV^ ~t^^F*P t^?t7^-0^^*V uи+^_]UVv <*t t06 P:FvvPvPvvP]UWVv |Z u}uuu؋㋇`F t PDPWG^_]UWVv <ta|:u[*Pq*-a 6 jq; t+FWP> | > ~t P+^_]UWVv F^*PFd uz 6  x,uS @~u/+t(6  t 6 6 \ ~u5+u.Ɔ +u  u~u +u6| vFF~u*6| K t6 o t6 2 ut ~r+u ^?,u++ut >t t >d uz 6  t >d uz h Pv Pz&h u P!0 t P6| P6 ZPP'>t u+f >t u PK t+PPFPP5FPPF~|FPjFPt u Pf  t~|P dž~} v `P@udžtRZPZP[ u+ZP[PFPZPPd n džutk>r u/>t t(+PZPPL  tZP@u8PZPP#  uZPPr@u >l twFPGF uF^?,tF;rL?uDSI| P6| F6| PPPtz t z d 6| 6| PPuFP^PZPt0+PZPP  tP  tj~ cPZPP t\ZPP:>l tP6x ZP/F^?,tF;rÉFl F9Fr^?uS| P6| <F6| PPP]tz t z d 6| 6| P9 PpZPPt P< PZPPZPP6>l u/FF>r t6l 6x ZP>l uFPF u%>r t6l 6x ZP>l u~ 6~ Pb*PX t V^]UWVv<=t<,t < vF<+uV DP: 8t<+t <=t<,u^DPW<t ^ ^^_]UV^v<uYf~=t~,t~ vF^F<+uvFPFؠ: 8t<+t<=t<,u F@PF^?t^^]UWVvV^ F=u 6 8u+_~u|:tV8 =u|:u6 8DtV uΠ6 ^8@t+PPVu |u^_]UVvV9 uCV` u8V ؊@F<t6 8Ft~:t 6 PV PV ^]UVv>r tMV u<tV uV tf +PVyx } Pr +^]UVvFz FvY tF>r u~uG tF tF~tPFPV5>f t Pj PVPVr ~t v<>f t5 F ufv؀?tNPvv ^]Up ` v{ u mvl tf > t>z u Pʃ> t > uh  Pv }PDp  Pj P6 +P+P6 vW @ue` +]UV` F6h 6v 6 Fb *=uv6 Z>z t 6b 6v  t F+v b h 9b t > uF~t6 ?p ` +^]UVF>` u>p uvr@u )@t>r u.~t:Pvx r P+PP6x  t=6v F*vl tރ>p t6 늀$FFb 9Fr6b 6v 6x ;b t4Pl ` >p t>n t6x 9r F>p t>t u&6l 6x v>l u~ >l t+^]U WVvV u VPVx } Pr >z ty+FFF6h 6v 6x F*=uWW6v F t F+>v 9>h tF+~F9FtPvv6x p }$R+FFP+PP6x O }1+^_]UWV+v? u#v~O=:u F |+^_]UWVv~ <uFO u+^_]UWVv~aFF<tV؀x.u V @=tW؀y.u WAV=v|:uFW=v}:uFF8Ft+t tPJ>p t  6 ߃^_]UWVv~aFFVC=v |:uFW,=v }:uF~bw~bwF8Fu+^_]UVvV36 8uAPPVPV^]UVvVVPoP+P1FVF^]UVvVN^]U VvFP߃FP߃F V*ŠN*-x F* V*ŠNj PVGރF |" Pj PvP<߃v7ރ+ vX^]UVv<t8 8uF^]UVWËI33&8tH~t >N~ u-UVWt~ u 3_^]UVW^ttۋ3:t uUVW.t-33&:uߋv &t&3&,KC&>mt&>zu & ~ك33Wʋvu_ Y&:u[Y-+r/;P r)XZRP+RPQUP Fr;rP ]øP PTP UF= s P ]Y+r;P rP Pŋ^wgNO3ËF u@^wgON/UVW~3O~߹Aً_^]UW~3AيFO8t3_]UWVv~3AًD3:ErtIIы^_]UWV~3Aً~^_]UW~3@@_]UVvַAZ 3Ɋ :r:wȈ F^]UVvַaz 2 :r:w*Ȉ F^]U^WN^W]2%2d%c%02d%c*?\.:;,=+<>|/"[]%2d%c%02d%c%02d%2d%c%02d%c%04d%2d%c%02d%c%02d.%02d%s E*****$CLS=p*****$ON=q*****$OFF= %sInternal Error Code %02xhv^(*.**.*0123456789abcdef000000001000000000 Volume in drive %c is %shas no labelFile(s)bytes free%s files exist SystemDirectoryInvalid option: `%c%c' Disk full Syntax ErrorBad command or file nameTerminate batch job (Y/N) ? Batch file %s missing retry (Y/N) ? Batch files nested too deep Directory of %s\%s ECHO is %s %s (Y/N) ? Are you sure (Y/N) ? File not erased: %s - Label not foundUnable to create directoryNo APPEND PathAPPEND=No PathPATH=Strike a key when ready . . . PROMPT=File already exists Invalid path, not directory, or directory not emptyBREAK is %s VERIFY is %s Auxiliary is %d Printer is %d Invalid Process Name or Console Number 8087 is %s BANK is %s SUSPEND is %s MEMSIZE is %d KiloBytes LIMSIZE is %d KiloBytes Copyright Digital Research (c) 1985,86,87 Concurrent DOS %s Release %s File cannot be copied onto itself File(s) copied Copy:- Out of environment spaceEnvironment errorIncorrect version of DOS Invalid number of parameters Cannot do binary reads from a device Content of destination lost before copy onoffMust specify ON or OFF Illegal operation on CP/M MediaIllegal drive in Path SpecificationFilename too longFile not foundInvalid directoryToo many files openAccess deniedInsufficient MemoryInvalid drive specificationFile Sharing ConflictPhysical Media ErrorInvalid PasswordLoading ConflictYNPath requiredFilename(s) requiredSunMonTueWedThuFriSatCurrent time is Enter new time: Invalid timeCurrent date is Enter new date (%s): Invalid date mm-dd-yydd-mm-yyyy-mm-ddInvalid Number CP/M MediaInput Redirection Already ActiveOutput Redirection Already Activeconcon:prnprn:lpt1lpt1:auxaux:com1com1:nulnul:vszcabvszcabababab%8dnrw{*.*%c:%s cmdcomexebat\;/P  ࢳд!T!!2ㆠ3+u ub t/<+tHu^GtG3Ҡ.!3|uVGOr dursuy  CONCURRENT DOS 386 Release 2.0 Documentation Addenda November 1987 INSTALLATION GUIDE Using the IBM Enhanced Graphics Adapter (EGA): 1) With Serial Communications Applications: If you run an application that receives data over one or both serial ports, you should not concurrently run any program that uses colors. Any change in colors, whether commanded by the application itself or by Concurrent when you switch windows, can result in data loss at the serial port for the following reason: Concurrent uses "interrupts" to maximize the performance (speed) of programs running in background windows while data is being received from one or both serial ports. Using interrupts, Concurrent runs background programs without pausing to check the serial port to see if a cha racter has been received. Instead, the serial port signals Concurrent when a character has been received, and only then does Concurrent pause to get the character and pass it to the receiving program. Application programs may command your system's microprocessor to ignore interrupts for any length of time, and if one program does this while another program is receiving characters from a serial port, it is possible for one or more characters to be missed. Specifically, when the EGA has been commanded to change background or border colors, it causes the microprocessor to ignore interrupts for up to 1/60 of a second. At a transfer rate of 9600 BAUD, a maximum of 16 characters may be missed while interrupt recognition is disabled. Fewer characters are missed at slower BAUD rates. Most communications programs are able to properly handle missing characters, but some are not. It is for this reason that color-changing on the EGA and serial communications are incompatible. RUNNING APPLICATIONS GUIDE Borland Sidekick v1.56A Ensure that the following settings are used: Memsize 128 Uses LIM memory : No Bank ON Suspend ON Before loading Sidekick it is necessary to create an environment which will allow Terminate-And-Stay-Resident programs to remain resident. This is done by loading the command interpreter with the CDOS command. The MEMSIZE setting shown is the minimum required to run Sidekick and includes the amount required for the command interpreter. This setting must be made before loading the command interpreter as the MEMSIZE command cannot be used from within the  command interpreter. Since you are likely to run more programs at this window while using Sidekick, you should ensure that the MEMSIZE setting is large enough to accommodate both Sidekick and the largest of those programs. After the CDOS command interpreter has been loaded it is possible to run Sidekick as described in the Sidekick documentation, by loading the appropriate version of Sidekick. e.g SKC.COM , and  then using the "Ctrl" and "Alt" keys to invoke it while running subsequent programs, which have also been loaded from within this command interpreter. Sidekick will be removed from memory when the command interpreter EXIT command is used to go back to the outer level. Note that Sidekick can be run on a Serial PC console if you have a multiuser system, and that 1 copy of sidekick per window can be run.  Lotus 123 v2.0 When status is requested (/WS), the "Expanded Memory %free" number may be incorrectly reported by Lotus. This is because Lotus assumes it has complete control of your Expanded memory board. Under Concurrent, other concurrently-running EMS applications, as well as the operating system, may also allocate and deallocate memory from your board, and Lotus gets mixed up performing its arithmetic. The application's actual use of the EMS board operates properly under Concurrent. Framework II Under Concurrent DOS the Scroll-Lock key is not recognised as the "SHUTTLE" key by Framework. A Framework macro can be defined to perform this function. For example, to define ALT-S as the shuttle key you need to do the following :- On entering Framework, "LIBRARY" is highlighted.  Press "DOWN LEVEL" (number pad "+") to enter Library. Press {CTRL-C} E to make a new library frame. Type {ALT-S} followed by enter key (that's 8 characters in total) to name the macro. Press F9 "ZOOM" to enter the frame Type {SCROLL-LOCK} Press "UP LEVEL" (number pad "-") twice followed by enter key to tidy the screen. You can now use ALT-S as the shuttle key. On exiting Framework, answer Y to "Save Library Modifications" RUNNING COPY PROTECTED PROGRAMS On Concurrent DOS 386 when high memory is enabled to give a larger amount of program memory (Transient Program Area) you might encounter difficulties with running the installation procedures for some copy-protected programs. For Lotus Symphony v1.2 and Lotus 123 v2.01 if errors occur during the installation to the hard disk or on the removal of the program from hard-disk then it is necessary to complete the process manually using the COPYHARD program supplied by Lotus. Use the command "COPYHARD" to install from the floppy disk to the hard disk, while logged into the program subdirectory on the hard disk. When prompted for the "System Diskette Drive", enter a or b according to the floppy drive required. When prompted for the "Hard Disk Drive", enter c or other drive letter as required for your hard disk. To un-install (remove program from hard disk) use the command "COPYHARD /U" and enter the drive-id's as described for the install above. REFERENCE GUIDE SID86 SID86 is a Symbolic Instruction Debugger. This program is a tool with which you may install software "patches" from Digital Research, should it ever become necessary to correct programs in the operating system or utilities. Instructions for installing patches would be available from the DRI Technical Support Department. FIXCB86 This utility is for patching CBASIC programs compiled with the Digital Research basic compiler CB86. The patch will stop the compiled program assigning a random password to files that it creates. Just type the drive and pathname of the program to be patched, along with the optional /S parameter to patch all programs within subdirectories. USER GUIDE CARDFILE The User's Guide references the files CARDFILE.DAT and several files with an IDX extension. These files are created by the CARDFILE program when you first enter data. They are not included on any of the Concurrent diskettes and are not required to be present before running CARDFILE. PRINTER MANAGER This utility does not accept paths to files. Use Concurrent's "floating drives" for equivalent functionality.  t/<+tHu^GtG3Ҡ.!3|uVGOr dursuy  echo off prompt $p$g if "%os%"=="" loadsys ask if "%os%"=="os%%" loadsys ask path %bootdrv%\cdos if "%os%"=="CDOS386" echo Operating environment is Concurrent DOS 386 Release %ver% if "%os%"=="CDOS386" echo current path is %path% if "%1"=="1" runmenu hdmenu.dat if "%os%"=="CDOS386" exit rem Existing autoexec.bat starts here.  t/<+tHu^GtG3Ҡ.!3|uVGOr dursuy eemm=remm.sys &.2ұn-N% ࢵ&G> udXш&& ôP!3 ࢳд!T!!2ㆠ3+u ub t/<+tHu^GtG3Ҡ.!3|uVGOr dursuy RunMenu prepmenu.dat Main &.2ұn-N% ࢵ&G> udXш&& ôP!3 ࢳд!T!!2ㆠ3+u ub t/<+tHu^GtG3Ҡ.!3|uVGOr dursuy  &.2ұn-N% ࢵ&G> udXш&& ôP!3 ࢳд!T!!2ㆠ3+u ub t/<+tHu^GtG3Ҡ.!3|uVGOr dursuy MZ! P0/  h.0 $U~u08;~|u^ÓFu=:u.P*-A8Y#|=~h P:P YYF#08^:t PPYY^"u:u tF^PIY*䓃1u4u8uBw.m||||||||||||||A|}umF^?:tPF~uDFP!F^?:t-F~u!FPPYY# FG>tlBP*PP*PP*PDP*PP*PP*PP*P P+PcY68JY#t>WuPpP?YY#u P\P+YY68P6 YYF#t P;P YY>u/ #u|60Y#th>uYHP8APP>uQtuPY68Y#urPY렸DPY>uhP8APvPo>u;uP(YPJPC8P'#tP(PYY8PY68YY#u PY>tAF#t78PY#tPPYYv8PYY>t68Y#tPY8@P>DFPx6B6@PiPb >t PQ6J6HPB@P; P16F6DP"VPP pPY*PY>usPS*YuPY *;uDPY- *;u PY+Pw]UPVWP^Y<tt P|PKYYPa3Ҁ>uB]0>u*W6Z 4oPHP~T #~u P PYY_^Y]UVWZ*㋇ F쓋G >W<.>G:.<FGFW*VG FVN B^WV>u>r<.>FFH+:F+;~sM66;<}'PW 6&<6P #u6аPY=uPYG뮸P6PZ P SvH > P Ff@^G FP FFv > +F-FP FP 3҃><uBR P6+PPR68 $Ft^G P PP GP+P ^wFFfƉFP6V+PR68 Ft68 Y#uFfHV ЉV@+6>24,PS6462v68 F uDFF;FsIv+6>24 P66462P68 F t P`+YF믋F F^G+F+ҹ @BO*ٱ KFV!@!BN^##ډHJN^##ډFVHJFV!H!J+;>:sb66;<});~rPW6&<6PX#t6΋&<PY#u+P8Y=uP3 YG똸_^]W PCY>u PY*#~ } GƇ +_U VW~Z*㋇ FPP+REPP+P5+ s GPFYP P+PPyPP+PP+P^G*FW VOAF>>24 P66462P68FtP1Y_^]UVWFan^+qa;t^PPynP ^P*PenP6PZ+P^R YY#}+PnR YY#},>tvqnPBR+PnR #|TP+PPWq "|:+PPPWZ "|*P+PPVG "|+PPPV0 "}+ٹ;$v P P YY "&( + "*,666(6&W.#t666,6*V #t+* _^]UVW~F F tS++F V |F VvvW^ ;t+/+҉FV FVFV)F V W( Y_^]UVWFan^P^P YY#|PnP YY#}+>666(6&V.#t666,6*W #t+* _^]UVW~F F tS++F V |F VvvWt ;t+/+҉FV FVFV)F V W: Y_^]UW~=t=t= t =t=t=t =(t=Pt>u>t>u8>u1>u*>u#>t>u>u>t >t Xtu_>u>u>u>t8 ,=t=PtǢZ=u = uZ>t>u >ut@=t=(t=t =t= tǢZ>t#u]Z>uP>Pu=t=t^>(u=t =t= uEǢZ>(uNZ>uBZ;u&ǢZ>u>u>u>t u +Z+_]Ã>t>u>tÃ>u>t+UVFFP V YY~u+F+҉ "F$^]UVW~WvNP #u~u+44;>}+Pv4>>BRP4̡>>>_^]UW>= } Z*PvvW68^ ߁tt&P+YDZ=upPY+_]UVF6^]UW~NjDZ_]UW~OH|F_]UWP6+Pv>.<P68 ߁u PA+Y_]UWLPvYY_]UVFPH V* ЊF* Y^]UVFPC* V* ЊF* Y^]UVW~vNH|F_^]UVW~vN#t G^F_^]UVW~v<tF=tGF_^]UW~0| 9+*_]UVWFPFPVRv+RP+RPF+RP~RP_^]UNP%PO]øPYUWVU.t].sF.ru&N~`|.sd&G.v^_]ø  UWV^~Svv vv .st (t.v.t(.stPX ^_]UWVN.st t3Y.v.tU (].stPX^.rt tG~w!s+]U*!^WG]U^W+!]U,!^͉W]U^͋W-!]UVW~v*F u'*F t Ӄ0Љ+_^]UV!u]ô!ô!UB^VNF !sؙ]U +YY#tWVP+_^]UVW8 VRv@> +YY#t WVv+_^]UW~> FPv +YY_]U>VW~GF"ur<%t<+FFF FV-u FGF~0uF0=*u^FFGGF*FGF<0r<9wF V*Ѓ0Vۀ~.uD=*u^FFGGF*FGF<0r<9wF V*Ѓ0V3Ҁ~luBV#tGF^*Xt#dt utxt6~u^F/~tFFƒFWFVF‰F^F+҉FV^*Xt9ct^dtst:utxt Nvv vvPFP vvFP(+vWuA+_VFFFvшF+ƉFF;F}F~tFN;F~F  F"t'V;V}< u      FӃ~tFN;F   ~ u      F   _^]UVW~F F uO0s~ uFv vFP+WuA+_ڋNWuA+_AvW_'^ OFV FV uً_^]UW~^ OFVFV uً_]UVW+vFFF~t$Nj^,0<9v, +NNN_^]UVW+& WuA+_AV W~_^: WuA+_AV0 W~_^#t*F Ft"Ft FPFPBFPP:~^Nҍ~=0uG+WuA+_A^VW_^WuA+__^]?@U^VN!s]Uv]UPvY]initPP P .&X &;v+ر&+شJ!+یЋ;s+ر.TX+@("tPX%t)3*>*&*?>*?u>**u..b *&,&3&"@$+>R0!1&33&=NOuL&}87uD&}=u=PW>*t2* O&=t&"t!G ! !_X&=u>1s 3R&-&+G+&-ϋ&"@@@+&.6^ +P>j t>s ͫuw ;u u w ! ı=@r-@ =r--UFF]ÌU^F㑋Fʖf ֒]U t6| d6~ d6| L@6~ L@ t 6 d6 L@]UP 6 K 6 vD VY> uY]U+FFFFm 6^ +FFFFF;b v6Z ^@FF< t< u~tւ~uK`~"u~u~u~uHFF묂~\u!~tF;b w6Z x"uF"FF6Z ^@FFn~t$6Z ^@FF~^@6^ ߉F;b w*v^ @F@]HEAPCODEeach_item U 9v^#t!;wtVP v^Vv^Vv^VFF~u]each_free_itemU FF`vv| Ut VP JvD ;FtvP| F.v#t ;wtVP_ v^VFFvD F~u]remove_from_free_chainUv|r*| uD vD t D v\ #tD G ]USY]insert_into_free_chainUPv^#t/ Uu); u6 vvD^G47v\SCv\#t>^ Uu5;6 u vDvD^G47^v#t\v{&v|r ^\ #tw vD 6 Y]search_free_chainUPU%P@FfFY]USvD^;GrwY]set_limits U졒 P P]sysallocU> ut +ҋN+NvX+;Vw u;Fs+ FV F]add_new_chunk UPV;rЉVwDvxF#t7+v \D UVTD;t7F > u v Y]malloc2U> t FsF~v+F vF#uv[vF~uvPvD+FF= w DFFFvDD D TVT vV^ VF#vDvvv^7\DD UD TƗu; u6 v#F> t/F]zUSY]hmallocUPU!'PvvF> t#tV#v ʋ~FY]mallocUPv6 FY]errUSvtPUnfreeUP~uvFFF> t|v| Duv#t ;wtvD UV86 | Uu$v|> t6 #tv> tfY]check_heap_integrityUUY(P]USY]UU *P]U> t *P F ]UvDDD]U츰 P]PQRSPPVWU~r6 6 FPuFP P<6 #]_^[ZYXPQRSPPVWUFPnnv&<u@ P6 []_^[ZYXPQRSPPVWU6 6 FPs]_^[ZYXUPVRFV  +PVRFV  #PVRFV  +P(RR+P)RP+Pk)P#P]U6 6 P6 6 +P6 6 #P]UvvDu  FvDtv|tDt+vvDte|}^DtP+PPDPv+DPtDP$Fv+T;uF FvL vDDFF]U+F +ɋv++ًƋӹ F#|Z=Uv|tLvDt/Dt VFY vDt*vDu DutQYvDPvD  FF]UPFF t ; tPFYF=sF6 1YY]U]UP FV Y]U졼 +;t  ]UF  s + ]UFFF ^Vvv]Uv P P]UF* >P]UF LPv]Uvvc]UPF* u  Y]U+PFPF*P]UPF*  DP uF tF tFFFY]UF* F F F BP] F FFV]U    6 > 6 6 !]ݏ     6 >  ]Copyright (c) 1987 Digital Research Inc.MEDIA=@h p ` p @ @@pa:\a:\COMSPEC=a: 'DIGITAL p  +"&6x&>x&z.|-@|**IF{|P^}w}w++QR|CCPM SYSDOSPLUS SYS^> |9 t}t~ts@;tX}> |AQ6|@@P>"|AV}&|+$|XZYP.|ݱSx[+Q|&|Y.&|XHPu* LoadingCCPM SYSDOSPLUS SYSUse another boot disk CCPM.SYS not 1st file *P|Xsu CCPM.SYS read error |26(|uŰ.ìt%10ld%10ld%10ldccpm.syscdos.comdosplus.syscommand.comdosplus.comHead: %d Cylinder: %d Insert new diskette for drive and press any key when ready Volume label (11 characters, ENTER for none)? System Transferred Error writing System files Format Complete Format Another? (Y/N) Floppy diskette format V1.2 Digital Research (UK) Ltd (c) 1987. format [d:] [options] d: drive containing diskette to be formatted Valid options are... %cV volume label to be written %cB leave space for OS system files (5.25 inch drives only) %c8 set sectors per track to 8 (5.25 inch drives only) %c1 set to single sided (5.25 inch drives only) %c4 reduce format to 8/9 sectors (hyperdrives only) %cN:8 set sectors per track %cT:40 set tracks to be formatted (40 or 80 only) Insert Disk with System files in DRIVE System files not found. FORMAT failed to lock disk system You cannot format a FIXED disk with this utility. Use the FDISK utility to prepare fixed disks. bytes total disk space bytes ???? bad ??? bytes used by system bytes available on disk Format Failure TARGET diskette is write protected Verify error Write error Drive not ready Invalid Parameter Parameters not compatible Parameters not supported for drive Read error Invalid drive specification FORMAT is not supported on this operating system. Insufficient memory to copy System Insufficient memoryYN0123456789abcdef0123456789ABCDEF000000001000000001000000000000000000S ((((( AAAAAABBBBBB   , ***RANGE OR NIL CHECK ERROR***!***QUOTIENT OVERFLOW ON DIVIDE***HEAPMGMT - heap error Aborting...)*** Cheap-heap linked in => no heap dump.&Cheap stack dump linked in => no dump.***Program aborted.******STACK/HEAP OVERFLOW***+MetaWare High C Run-time Library Copyright (C) 1983-1986 Metaware Incorporated..&.2ұn-N% ࢵ&G> udXш&& ôP!3 ࢳд!T!!2ㆠ3+u ub t/<+tHu^GtG3Ҡ.!3|uVGOr dursuy MZ P) ))!)l)2)2jjj $U +FF;F}A^0"t.:u#u#tP Y~uB>u*W6 P _^UVW3ҡ;uBV#u H^t+FFF~t.]~uKFPFPFP6U~uwFfF+vF#u~P PYYF+F;FsFF~FF;vMv+PPWv6H u 6hY#t.P Y=uPYFFG멃~t|~tyFPVRNQ6F;FuF;FuF;FtK~u 6Y=u~u6Y=tP 6YY#t"P Y~F~FF;wv+PPWv6Y u 6tYڋ*=u6#t.-v+PPWv6 u 67Y#t \PW Y,PY=uPSYFFGd~F;~s_^]UVW~PWYY#uA6+PPPPW uWY#t .PFPW@YY_^]UVW~FP~P+PPPW? uWbYۍFPWFYY#u#u ^;F^F@V*N*+FFH+vF^N^ _^]U츼P$FAPPP6]øPA$$PYYøPA$$PYYUPPzFY<uPY"P]UPUPFY<t<uPYF:t:uָ"Pj3ҊF:uBYY]UVFFPVYY~u+FF^]UVWF^G W.G+;>},+;6}!VW&.Rw#u+ FGθ_^]UVW~u~u+|4+;6}'vvƙ>BRPxFӡ>_^]UW64Pv66 ߁tt&P+YDZ=uPY+_]UVF6||^]UW~OH|F||_]UNP%PO]øPYUWVU. ]. F. u&N~`|. d&G. ^_]ø  UWV^~Svv vv . t (t. . (. tPX ^_]UWVN. t t3Y. . U (]. tPX^. t tG~w+YY#tWVP+_^]UVW8VRv@>+YY#t WVv+_^]UW~>FPv  +YY_]U>VW~GF"ur<%t<+FFF FV-u FGF~0uF0=*u^FFGGF*FGF<0r<9wF V*Ѓ0Vۀ~.uD=*u^FFGGF*FGF<0r<9wF V*Ѓ0V3Ҁ~luBV#tGF^*Xt#dt utxt6~u^F/~tFFƒFWFVF‰F^F+҉FV^*Xt9ct^dtst:utxt Nvv vvPFP vvFP(+vWuA+_VFFFvшF+ƉFF;F}F~tFN;F~FF"t'V;V}< u  FӃ~tFN;F ~ u  F_^]UVW~F F uO0s~ uFv vFP+WuA+_ڋNWuA+_AvW_'^OFV FV uً_^]UW~^OFVFV uً_]UVW+vFFF~t$Nj^,0<9v, +NNN_^]UVW+WuA+_AVW~_^WuA+_AV W~_^#t*F Ft"Ft FPFPBFPP:~^Nҍ~=0uG+WuA+_A^VW_^WuA+__^]?@U^VN!s]init<PP SP.&2&;v+ر&+شJ!+یЋ ;s+ر .TX+@""tPX%t#3$>$&$?>$?u>$$u..&$&, 3&@$+>R0!+ 33&=NOuL&}87uD&}=u=PW>$t2$ O&=t&"t!G ! !_X&=u>+s 3R&'&+G+&'ϋ @@@+&.:v68+P>Dt>MͫuQ;Ou Q ! ı=@r-@ =r--<UFF ]ÌUt6Vd6Xd6VL@6XL@t 6Zd6ZL@]UPb6\6\vD \VY>\uY]U+FFFFG68+FFFFF;<v64^@FF< t< u~tւ~uK`~"u~u~u~uHFF묂~\u!~tF;<w64x"uF"FF64^@FFn~t$64^@FF~^@68߉F;<w*v8@F@]U`*P]U>at `*PaF`]UvDDD]UbP~]PQRSPPVW<U~r6X6VFPSFPdP6f]_^[ZYXPQRSPPVW<UFPnnv&<u P6f[]_^[ZYXPQRSPPVW<U6`6^FPQ]_^[ZYXUPVRFVVX+PVRFVZ\#PVRFV^`+PRR+PRP+PmP#P]U6X6VP6\6Z+P6`6^#P]UvvDu FvDtv|tDt+vvDte|}^DtP+PPDPU v+DPtDP Fv+T;uFFvL vDDFF]U+F+ɋv++ًƋӹ F#|Z=Uv|tLvDt/Dt VFY vDt*vDu DuteYvDPvD FF]UPFF t;ZtPFYF=sF6Z1YY]Uvy]UPv7Y]U]UPnFVnY]Un;t nn]UFq sp+ptv]UFFFp^Vvv]UvvP|P]UF*r>P]UFpLPv]Uvvc]UPF*t^ Uu5;6uvDvD^G47^v#t\v{&v|r^\ #tw vD 6Y]search_free_chainUPUP@FfFY]USvD^;GrwY]set_limits UPP]sysallocU>u+ҋN+Nvp+;Vw u;Fs+FVF]add_new_chunk UPV;rЉVwDvxF#t7+v\D UVTD;t7F>uv Y]malloc2U>t FsF~v+F vF#uv[vF~uvPvD+FF= w DFFFvDD DTVT vV^ VF#vDvvv^7\DD UDTƗu;u6v#F>t/F]zUSY]hmallocUPU PvvF>t#tV#v ʋ~FY]mallocUPv6FY]errUSvtPInfreeUP~uvFFF>t|v| Duv#t ;wtvD UV86| Uu$v|>t6#tv>tfY]check_heap_integrityUU"P]USY]Uv4FFVP?]U6$&PP)]UPv)FtF*r?PpY]UPvFtV*r@Rp;Fs >upY]U+PFPF*P]UPF*rpDPQvuFvtFvtFFFY]UF*rF pFtFvBPvFpFFV]Uprtv6x>z6~6|!]ݏ|~prtv6x>z]UPr6ffPatP]U*PI\]YN Copy another (Y/N)? Insert SOURCE diskette in drive Insert TARGET diskette in drive Strike any key when ready Invalid drive specification. Requires Concurrent DOS or Dos Plus DISKCOPY failed to lock disk system. Insufficient memory for diskcopy. Incompatible format for drive Formatting diskette TARGET diskette is write protected ! Unrecoverable read error on SOURCE diskette Unrecoverable write error on TARGET diskette Unrecoverable verify error on TARGET diskette Unrecoverable format error on TARGET diskette Drive a: not ready. Make sure a diskette is inserted into the drive and the door is closed. a: Floppy diskette image copy V1.2 Digital Research (UK) Ltd (c) 1987 diskcopy [s:] [d:] s: drive containing source diskette d: drive containing target diskette 0123456789abcdef0123456789ABCDEF000000001000000001000000000000000000S  &***RANGE OR NIL CHECK ERROR***!***QUOTIENT OVERFLOW ON DIVIDE***&Cheap stack dump linked in => no dump.***Program aborted.******STACK/HEAP OVERFLOW***HEAPMGMT - heap error Aborting...)*** Cheap-heap linked in => no heap dump. MetaWare High C Run-time Library Copyright (C) 1983-1986 Metaware Incorporated.. ࢳд!T!!2ㆠ3+u ub t/<+tHu^GtG3Ҡ.!3|uVGOr dursuy MZ @ _F Copyright (C) 1986,87 Digital Research, Inc. All Rights Reserved +ۋW+Ёr⸽Ћ؎P|L!-+Ë6GUF f؋NF؋F]UFVN++]UFVN++]UVW+vFFF ~t$Nj^,0<9v, +NNN_^]UVWVW~_^V"W~_^#t.F Ft&Ft FPFPlYYFPPb~^NYY΍~=0uGWv;YY_^]UVW~ F FuO0T~ u'FPvv]VؖFPWǃ )^OFVFV uً_^]U8VW^FF"u<%t+FFF ^V-u FFF~0uF0F^FF<0r<9wF V*Ѓ0Vր~.u)+^FF<0r<9w V*Ѓ0ـ~lu^FF^WFVF^FFV^*Xt$ctCdtst,utxt 3FP FPPvvcvVoFYFFFvՈF+ƉF;~}~~tFN;F~FF<tF;~FF~tcFN;FU F8_^]UVFVRvYY;t+PVP^]UFFPv]UVW~v#t ^FN_^]UVW~v#tFN_^]UVW~vF#t :uFGN~t:s :v+_^]UVW~<tF+_^]UW~W@PWvX_]UW~vWYPYY_]UW~W@PvW]_]bP+PP<P+PP UVWRPvvkPWP P _^]UVW664.8RP6RPRPYYP>0uPpP+PRDFF F=|F}u~uP+PPFE*U*ЉVE*U*ЉV]*ttt't't&)V'Z++E U}bp x~V=uNAPuu YYPvvvP+PFPLF ~uP+PP/_^]UVW+FFF=}NFuDT +EU }+FVW_^VW_^VW_^FF몃~u_^]UVW~PP+RR6FW #tP+PPPWYFUt#W_LJUPP+PPSW _^]UVW~WWYVYY#u_^]5+P/Y>2u(P+PR+PP]PK PFPH PJ PL60 UVWP+YF< uW~uL#t~uN(PT+ҹ ɊF<0r<9w;v}F*P,RF+ ~0Y_^]W!P+P RP0P4P8P>0u FP@PYY>2u `PHPYY|P+PPP߃t01t2t3t4u>0u-0>2u_UVW+FW_F}YDZF|tAD*T*ЉVD*\*ȉN+AځFW_G_^]U VW~ 6T ƙRPvvv~_PRFVFn8RPvv~p@F>4V4.8RPvv8FvvvPv60 _^]U VW~ 6T ƙRPvvv~PRFVFn8RPvv~@F>4V4.8RPvvFvvvPv60F _^]UVW~<;tj>>tDHG+҉FVG*#t&Pvv6J/HG+FVN>PNjHG+RP6Jo><_^]Ã><u+PlYUVW+?:Dt%TF+WFJBYvF+6TWY@T;u,?JӋڊG@@PJAB@Y JBFu B B_^]UVW~vWB>Y>DtB7RtB'Ʊ  B' 7>?t%AJ<HPY@JTG>Y_^]UVW>LHw #t mGGNPvv6L#uTPvv6J#u<+LW_RvvSG#uPvv6J#t+_^]UVW~+W_ED6HW_VW_^PTVW_^D TFRP4.8RPv~FV-v~|>^GD^G ++FV}&T~^>TvD *D ՋF+҉FVNLTL DDDL8L4L8.4nD0D`+6TD DŽUD+)FVDH+6T@+)FVD *RPvvv~@@Nv~NF>Du HN+6T@DD *RPD*d+ҋN^+SQv~~N;Fv~u+EVBUVU4IMFFH$8EVJU4.8RPFRPv~^GW 4.8RPFRP^G WGW PR+LW_^G*gFGH+w @FG+҉FVv~~tRvvYY#t6 2P+PR `P+PR +W_  [NFVP+RRV)#u5P+RR6L#uPP+PP6F60 #u+_^]UW>HE+҉FVE*e+FVEH+u @+FVE *RPFHH+RP~FV^G *Pvv6L_]UVW6Hvv~F +Ȱ ^^W_D *Fd FD*dD+҉FV\K+t +FVFVPvv6L`6L^G F <tF#t N~u[+W_VVW _^VT FFH+vF#t`FփVW_^FvY#tFFփVW_^^W *+QRFHHRPv~*FVv~DPP Pvv6L ~~ ~~GWY#uWvp~FRP+ǙRPv~|FVYYv~nPv<RPPPPN@@PPbPN@;r WxPW#t PWcYYGظPP︈PFP PR`Q'QS+PPR'RQ PPP'PP&+PPPRV,+ _^]UVW+F}DZFÓtFG~uF+FF;>6}.Fu$;66} FuF+;F~~FOG̃~ }%4P+P R P+P P FRP8.4RPv~JFVRPPFFHPvfP+P P *;Ћv~uFFFF+FF;>6}Fu ~~u~Gn vvP+P R;PF #};F|;FΓFuƓF;>6} Fu~GvF PR+R QFP. F#}|+F@FF;F|;F~FF;~ Ft+G+Fꗃ}DZFÓuFG݋F#tvvP#u #u:_^]UVW+F}$DZFD<t<t0uу>2uʸ+00P!Y빃>:t(P+PRP+PPG +PR +PtUvV]UJ]UVvN< s*< u*3< u+<u#<u%<u" .QY´^] ..Ï,l&, tUVʀKs*Ҋ´2@4$?8ŀA6]ôUVʀ^N N v FrĴ]UFF].>u@r4QD!s:T!P.4!T![:t$.!++ۋGL.GN.+ñ% u!.N(5u?<`rZ.&G(..+øÜ.U,!Ɗٷ Ë^*!- ޷ ‹^]0123456789ABCDEF000000001000000000DOSDOS 3.xDOS (>32 Mb)DOS 3.3OS/2CP/M(other)+и|+ؾ|`+$`Ȏعt uP  |t. |& |&|&||&|X|ƃPЋΰ}{rjV}+* D &2E &2 Gt2}F^ &|6 |ZƒPЋϠ |})r%t@@[.}} tP6|Š36||̀ X NO SYSTEM or BAD SYSTEM on boot disk! ...Install a system diskette then press CTRL/ALT/DEL. Can't read from Boot disk!IBMBIO COMIBMDOS COMpP(C)1986 DIGITAL RESEARCHUDIGITAL RESEARCH €u rʀ%(H+ã +.ȎЎ8_<tE "{N<t && 2+<uu.+м|..& :&4Ȼ+۲ +F<uu.p+м|:&425؋޾ +.. <t> t++ ؋ > t> t+ @;r+& u<tu..w ..&> u%< t.< t <t> u> u졦  І蘨tAPQ&  YXPQ<tu.YXթt"+Q3 ->X ؙ  ҆tAPQ/<tOu.~YXQ .. +&6x"&>x&z &&u+>ta 1 SQt( 󤾌Db>9v 10Y[CCȾ <u;r:&suCCtCCꋷ> ËF:&4ȋ5QRV((s^ZY^Z((;r+VWQ Y_^t Yu3@YNEUeEDEDEDEDD D3ËD d;TrwY;DwT1HD uL uLr5L V^^s*L1*H#D dD ((>+3@tSYrStIwO$r7>"Uu*>/t./&1&2&:>ukr 3+$ r1Uu6?t tt7 3G$G &3ۻ+(:+$.&2QR6<+6> ̊XPYZVWsu3 3s^_Ã1ȡ:&45Ãȋ$.&2((1gRS>t/:.tQV͵(6^Y.ٷ㋏(s$"닟(sˁ}[Zpp CCPM SYS)4?JU`kv{{{{{{ddDOSPLUS SYSNETPLUS SYSCCPM SYSCCPMNET SYSCPCDOS SYSCDOS SYSDOS SYSOS2BIO COMFLEX286 SYSFLEX386 SYS F1 = Select operating system: Disk error reading DOS file: Not enough memory for DOS file: Defective DOS file: Can't find DOS file: Loading from DOS 2 partition: Can't find DOS partition. Insert a boot diskette in A: then press Ctrl/Alt/Del... .tUse the SYS command to write DOS to this disk. Press Ctrl/Alt/Del to reset the machine.%d.%01d  %c 1) %s 2) %s 3) %s 4) %sIBM 3.0_%c %s: %u %s: 00000%5u %s___________IBMBIO COMIBMDOS COMDRILDR SYS%c%cThis program requires a fixed disk.Error reading system area - can't continue.Fixed Disk Maintenance UtilityVersion 1.20 (C)Copyright Digital Research 1986,87Partitions on %s hard disk (%s Mb, %d cylinders):1st2ndNo Start End MB Status Type %d %4d %4d %5s %c %s(No partitions defined yet.)Select options:Create DOS partitionDelete partitionSelect bootable partitionSelect alternate fixed diskEnter desired option: Enter number of partition to delete: Do you really want to erase all data (Y/N)? All partitions are already in use.Press any key to return to main menu. There is not enough space to create a partition.Use cylinders %d - %d for DOS (%s Mb) (Y/N)? Enter starting cylinder (%d-%d): Enter ending cylinder (%d-%d): The operating system needs to be reloaded.Insert a system disk into A: and press any key.System area defective, partition not created.Try again on different starting cylinder.Total blocksTesting blockEnter disk label (11 characters): Select partition to make bootable: (ESC = exit) [?]ynSMZ |P'O !l22TTT $ U ~~;^_:u-^__*>t^__* hucPwYF/+VFF;F|{^9:u]"u\:uG*>t* ptst  $pPF^Ó7*PG룊<+t<-t3G}+uB=uPF^Ó7+Pm=u*>t* athtrtst 1*#PF^Ó7*PG땃~tPF^Ó7+PFfPVPPP PF^Ó7^ #tP^7+PFztPP+P}>u(P P6.F#}dRRPN>Vu$+WuA+_AVWV_^vP P6 F#}dRRP F>pt FtPP6r RvVRPd Ft tt#PVPgPP+PF#t =t=uO~u PsY-t#t&*R*RPP FtPP FYY렡 u PYYPY~tPY+P]VWvtP7}PK#>/t/\ P Pr#u PY_^UjVW~PG+EFY:Fu :F uvF FV "ЈV:Uta+MWuA+_A]FVW_^^FF:fPFPn PF*PFPv$ #}EFPFY>pt4+NWuA+_A^VW~_^vFPYYn+WuA+_AVW~_^^VNWuA+_σWNuA+_AF݃NVW_^F*P7FPP>#}tfPPV$3#}B_^]UW+}C-G+FFtFrFtFsF tFaFtFhFP Y_]UVW~+WuA+_:t^:t :Qt ވވA+WuA+_NWuA+_AFVW_^_^]U #t$ V;}`P5 W P+  YY]øP  YøPYøPYUVW~v^wtMut9t-tXt:dueufugtVvVP#t V*PheVPt Y#t*PPc YYVVPS *PPPXPD eu *APMP*APP :P Y߃tt u,<P PNP YY~ftPY_^]UW~߃ t t ctsP Yd P *PPPXP P P{ Pt BPm tPf P_ PX *PPK *P<P> uP YPY_]U>vtvPY6?FP ]U!]U;V!s+]UVGVv!s+^]ø7!*UF.t %# !]UF.r 5$!.v .x %$0 !]l %$!l %#!ӎ.t .z .| .v .6| .6z <ul %$!l %#!ӎ.r ϴL!UVW~v +F:t3}:u-*>tV*>t* -a^F^vv @@PF*PFP #u v Y#uy^ ?tWSY#uN+PPWlF#~<t8+NWNuA+_AVCCVW_^^^ |t^aD:+_^]UPVW+^ ^ ^NWuA+_;uO#t^ߊ<;t:Fu^Ó?;u'v S P#uU#tO#t ^ߊ:FuA};^ߊ:FuG+FF^"t<;t } ^ ވFF |6+^ Ӌڈ;~^ފ^ވF~N+^Ӌڈ_^Y]UVW~+;v}G^F"u+F_^]UVW~+"t<.tFG=tG+=tFG~+_^]UVW~vG"u_^]UVW~vG"u_^]UVW~^*>t'^:u^*>t ^* -a++WuA+_AVW_^a3ҋ^:tB;tSRJ YY#t 9F%V+҉N ;u/^?t +WuA+_AVW_^>tFtFtF RvY#tuvP6P*PP- #udt2>t$>.tP9㉇YY>>tPPYY#t+P Y+_^]UVW~>u>t8#t!㋗;RuP`Y#t㋇;Ru> usRP㉇RTP#t u-vP6#t"PY#utuP*PP  P Y#uYt2>t$>.tP㉇YY>>tPPYY#t+ +_^]UVW~^?u=.u(F.G=.t .F}CG F+}1"t <.t*>t ݈GGG Fʀ=.uGF. },=t*>t ݈GGG Fύ~+ }^t* -aFGGF+WuA+_AVW~_^VV: uGVFVRYF#tX"uL<.u[@}<.t: u ݈GGF<.t: u݊G: uNGFP;YF#t"t: t ݈GGF: uGGFPFY=tpP PvF#}PFPFPpPpP}F ~}\fPpP6gu PyY7fPFPFPqF=u6PKY~uF랋F#|F_^]UW~=t*>t G_]XXL!UVW8VRv~>+YY#tWVP%+_^]UVW8VRv@>+YY#t WVv+_^]UW~>FPv +YY_]U>VW~GF"ur<%t<+FFF FV-u FGF~0uF0=*u^FFGGF*FGF<0r<9wF V*Ѓ0Vۀ~.uD=*u^FFGGF*FGF<0r<9wF V*Ѓ0V3Ҁ~luBV#tGF^*Xt#dt utxt6~u^F/~tFFƒFWFVF‰F^F+҉FV^*Xt9ct^dtst:utxt Nvv vvPFP vvFP(+vWuA+_VFFFvшF+ƉFF;F}F~tFN;F~FF"t'V;V}< u  FӃ~tFN;F ~ u  F_^]UVW~F F uO0s~ uFv vFP+WuA+_ڋNWuA+_AvW_'^OFV FV uً_^]UW~^OFVFV uً_]UVW+vFFF~t$Nj^,0<9v, +NNN_^]UVW+WuA+_AVW~_^WuA+_AVW~_^#t*F Ft"Ft FPFPBFPP:~^Nҍ~=0uG+WuA+_A^VW_^WuA+__^]UfVWv vvt+NWuA+_A^VW~_^^WRVR&PFPFP`+^WuA+_AVW~_^ }YFPFP6~u (PAY7FPFPwv vFP' u6*PYuF뢋_^]UCVNF!s+~t~u]UV!VNN UV!O!s+]UW~"t<*tt F"t<.u <*tq?GF빀<*uF"t<.uXF.GF ~ }9PY#t*>t F<u <*u?GFG<*uF<t+_^Y]ô?@U^VN!s]UPVWvvYY#t8F*䓃t t ~O+ۃ }GF^ӋڈGċ^;Ó_^Y]UW,=t FG:Eu+ 3Ҁ~ vB_]Uv]UPvY]initPP SPm O.&P&;v+ر&+شJ!+یЋ|;s+ر.TX+@ "tPX%t!3">"&"?>"?u>""u..&"&,3 &@$+>R0!)33&=NOuL&}87uD&}=u=PW>"t2" O&=t&"t!G ! !_X&=u>)s 3R&%&+G+&%ϋ@@@+&.v6V+P>bt>kͫuo;mu o !  ı=@r-@ =r--UFF]ÌU t6td6vd6 tL@6vL@ t 6xd6xL@]UP 6zK 6zvD zV6Y>zuY]U+FFFFe6V+FFFFF;Zv6R^@FF< t< u~tւ~uK`~"u~u~u~uHFF묂~\u!~tF;Zw6Rx"uF"FF6R^@FFn~t$6R^@FF~^@6V߉F;Zw*vV@F@]HEAPCODEeach_item U9v^#t!;wtVP v^Vv^Vv^VFF~u]each_free_itemUFF`vv| Ut VP JvD ;FtvP| F.v#t ;wtVP_ v^VFFvD F~u]remove_from_free_chainUv|r*| uD  vD t D v\ #tD G ]USY]insert_into_free_chainUPv^#t/ Uu);u6vvD^G47v\SCv\#t>^ Uu5;6uvDvD^G47^v#t\v{&v|r^\ #tw vD 6Y]search_free_chainUPU!P@FfFY]USvD^;GrwY]set_limits U졊PP]sysallocU>u+ҋN+Nvz+;Vw u;Fs+FVF]add_new_chunk UPV;rЉVwDvxF#t7+v\D UVTD;t7F>uv Y]malloc2U>~t FsF~v+F vF#uv[vF~uvPvD+FF= w DFFFvDD DTVT vV^ VF#vDvvv^7\DD UDTƗu;u6v#F>~t/F]zUSY]hmallocUPU#PvvF>t#tV#v ~FY]mallocUPv6FY]errUSvtPUnfreeUP~uvFFF>~t|v| Duv#t ;wtvD UV86| Uu$v|>t6#tv>~tfY]check_heap_integrityUU$P]USY]UU*P]U>t *PF]UvDDD]U츨P]PQRSPPVWU~r6 6 FPuFPP<6 #]_^[ZYXPQRSPPVWUFPnnv&<u@ P6 []_^[ZYXPQRSPPVWU6 6 FPs]_^[ZYXUPVRFV  +PVRFV  #PVRFV  +Pg%RR+P%RP+P &P#P]U6 6 P6 6 +P6 6 #P]UvvDu  FvDtv|tDt+vvDte|}^DtP+PPDPv+DPtDP$Fv+T;uF FvL vDDFF]U+F +ɋv++ًƋӹ F#|Z=Uv|tLvDt/Dt VFY vDt*vDu DutsYvDPvD  FF]UPFF t ;xtPFYF=sF6x1YY]U]UP FV Y]U존 r(;t  ]UF  s + ]UFFF ^Vvv]Uv P P]UF*䣸 >P]UF LPv]Uvvc]UPF*䣺 u  Y]U+PFPF*P]UPF*䣸  DP uF tF tFFFY]UF*䣸 F F F BP] F FFV]U    6 > 6 6 !]ݏ     6 >  ]*.**.*a:a: %s "%s" ...Invalid password Drive %c: not ready Failed to get current path on drive %c: (OS error code %d) Invalid path or path not found "%s" Invalid file name "%s" Invalid option '%c' in parameter Invalid parameter "%s" Invalid number of parameters File not found Insufficient memory Path too long access denieddrive not readyfile already openOS error code %dmore...Invalid attribute '%c' in parameter "%s" (use A,H,R or S) Attribute A,H,R or S expected to follow "%s" Invalid attempt to both set and reset the same attribute Display or change file attributes V1.2 Digital Research (UK) Ltd (c)1987. attrib [%cHelp] [+|-A] [+|-H] [+|-R] [+|-S] [d:][path]filename[.ext] [%cP] [%cS] +A turn on archive attribute (-A turn it off) +H turn on hidden attribute (-H turn it off) +R make file read-only (-R make it read-write) +S turn on system attribute (-S turn it off) d: drive which attrib is to search path directory where search is to begin filename.ext file for which attributes are to be displayed or changed %cP page mode: pause after each page %cS sub-directory: set file attributes in sub-directories ...attrib failed%s ...path password? %s ...file password?  d:..d:pathname.exta:*.*a:*.*a:a: 0123456789abcdef0123456789ABCDEF000000001000000001000000000000000000 *."/\[]:|<>+=;,S (((((  AAAAAABBBBBB   $O ***RANGE OR NIL CHECK ERROR***!***QUOTIENT OVERFLOW ON DIVIDE***HEAPMGMT - heap error Aborting...)*** Cheap-heap linked in => no heap dump.&Cheap stack dump linked in => no dump.***Program aborted.******STACK/HEAP OVERFLOW***r(MetaWare High C Run-time Library Copyright (C) 1983-1986 Metaware Incorporated.. ࢳд!T!!2ㆠ3+u ub t/<+tHu^GtG3Ҡ.!3|uVGOr dursuy echo off cls If "%2"=="" goto ERROR If "%1"=="xmcopy" goto DISKCOPY If "%1"=="XMCOPY" goto DISKCOPY If "%1"=="xm" goto PREPARE If "%1"=="XM" goto PREPARE goto ERROR :PREPARE md %2:\cdos >nul a:attrib -r %2:\cdos\*.* >nul md %2:\dredix >nul a:attrib -r %2:\dredix\*.* >nul cd %2:\cdos a:attrib -r %2:cdos$$$.bat >nul a:copy a:installh.bat %2:cdos$$$.bat >nul :LOOKDSK if exist A:FM.CMD goto 2DISKS %2: cdos$$$ xmcopy %2 4 :2DISKS if exist A:EDITMENU.CMD goto 1DISK %2: cdos$$$ xmcopy %2  2 :1DISK %2: cdos$$$ xmcopy %2 1 . :ERROR Echo Echo Reboot your system to execute the installation procedure for Concurrent. Echo Exit . :DISKCOPY Echo if "%os%"=="CDOS" Echo This procedure will install Concurrent DOS XM R%ver% on your hard disk drive %2:, if "%os%"=="CDOS386" Echo This procedure will install Concurrent DOS 386 R%ver% on your hard disk drive %2:, Echo in the subdirectory %2:\CDOS from a %3 disk set. Echo If exist A:ATTRIB.EXE goto PAUSE1 :PROMPT1 Echo Echo Insert the Concurrent Startup disk (disk #1 of %3) in drive A. :PAUSE1 Echo Pause If not exist A:ATTRIB.EXE goto PROMPT1 Echo Echo Copying files... a:attrib -r *.* >nul copy a:*.*/s %2: >nul :PROMPT2 if %3==1 goto ENDCOPY if %3==2 goto PROMPT3 Echo Echo Place the next Concurrent Disk (disk #2 of 4) in drive A. Echo Pause If not exist A:FM.CMD goto PROMPT2 Echo Echo Copying files... copy a:*.*/s %2: >nul :PROMPT3 Echo if %3==2 Echo Place the next Concurrent Disk (disk #2 of 2) in drive A. if %3==4 Echo Place the next Concurrent Disk (disk #3 of 4) in drive A. Echo Pause If not exist A:EDITMENU.CMD goto PROMPT3 Echo Echo Copying files... copy a:*.*/s %2: >nul :PROMPT4 if %3==2 goto ENDCOPY Echo Echo Place the next Concurrent Disk (disk #4 of 4) in drive A. Echo Pause If not exist A:CARDFILE.CMD goto PROMPT4 Echo Echo Copying files... copy a:*.*/s %2: >nul echo :ENDCOPY Echo All files copied. Echo Echo Installing system files. Loadsys install nul cd o:=%2:\ attrib -rh o:\ccpm.sys >nul era o:\ccpm.sys >nul ren ccpm.sys \*.* attrib -rh o:\loadsys.com >nul era o:\loadsys.com >nul ren loadsys.com o:\*.* if "%os%"=="CDOS" era o:\cconfig.eem >nul if "%os%"=="CDOS" ren cconfig.eem o:\*.* if not exist N.CMD goto skipn attrib -rh o:\n.cmd >nul era o:\N.CMD >nul ren N.CMD o:\*.* :skipn attrib -rh o:\read.me >nul era o:\read.me >nul ren read.me o:\*.* attrib -rh o:\hdmenu.dat >nul era o:\hdmenu.dat >nul ren hdmenu.dat o:\*.* attrib -rh o:\cdos.com >nul era o:\cdos.com >nul ren cdos.com o:\*.* attrib -rh o:\dredix\text >nul era o:\dredix\text >nul ren text o:\dredix\*.* attrib -rh o:\autoexec.bat >nul ren o:\autoexec.bat o:\autoexec.tmp >nul copy autoexec.new+o:\autoexec.tmp o:\autoexec.bat >nul era o:\autoexec.tmp >nul if "%os%"=="CDOS" copy scepter.cmd \ >nul if "%os%"=="CDOS" attrib +s \scepter.cmd >nul attrib +s dsp.cmd >nul attrib +s spl.cmd >nul era autoexec.new >nul era start001.bat >nul era endins.bat >nul era installh.bat >nul era cr >nul CD %2:\ if not exist N.CMD goto skipnat cls echo The next part of the installation procedure will set the system echo for use with your local language keyboard and printer. pause N.CMD :skipnat cls Echo Echo Installation complete. . :ask99 if exist A:ENDINS.BAT goto done echo Insert final Concurrent disk in drive A: pause goto ask99 :done a:endins.bat %2  ࢳд!T!!2ㆠ3+u ub t/<+tHu^GtG3Ҡ.!3|uVGOr dursuy RCOPYRIGHT 1984,1985,1986,1987 (C) DIGITAL RESEARCH Concurrent DOS loader 18-Feb-87[..&S...33CB.....[ڎҼr S t>]INu&>]INu >t t0!<s&v.!AG G =!S sHPع ?!r;ti8 ti+ t ti1 !6.n !!P'VW_^uGr3Á>]ASu ! ! u1> t> u# .. ..  .3Ì  ;p r Ë  QUS rȺݴ?!]Yr;t w++p +p ñ%=`tU &C< tFb GF != ! ! !j &h&Gl j -(6h !"& n U n$ô !Load Concurrent DOS (Y or N)? $Concurrent DOS is already loaded.$ Can't find DOS file: CCPM.SYS$ Defective DOS file: CCPM.SYS$ Not Enough Memory for DOS file: CCPM.SYS$ $ This program cannot be installed under this version of Concurrent DOS.$ Installation: Type any key to permanently install the $ file in the current directory. This installation is specific to the machine which you are now running, so the installed version of $ may not work properly on other computers. You may type Ctrl-C to abort this installation...$ is now installed for this machine.$ not found in default directory, or is set to Read-Only.$ Can't read or write $ This program has not been installed. Boot Concurrent from a floppy disk, then type "LOADSYS INSTALL".$ This program must be installed under Concurrent DOS.$A:\CCPM.SYSLOADSYS .COM.COM t/<+tHu^GtG3Ҡ.!3|uVGOr dursuy __.COPYRIGHT(C) 1986,87 DIGITAL RESEARCH, INC. +یЋgPUNV]Ë-+Ë6GUF f؋NF؋F]UFVN++]UFVN++]UVWvvԱo_^]UVW~v#t ^FN_^]UVW~v#tFN_^]UVW~vF#t :uFGN~t:s :v+_^]UVW~<tF+_^]UW~W@PWvX_]UW~vWYPYY_]UW~W@PvW]_] Nø PY=u&*0t/1u; 7< /=ujpP P+PPz>t%+PRYY=|P Pp+PPN+PnPAPmP6 PmP)6PjUVW~vG^FN#u_^]UVW~vFN#u_^]UvPp]Uv P`]ø PYUPPFF*PP:]UYPF* PPF* PP]URVW~v#t FFOFP PYY_^]øEPYøpPwYøqPnYøvPeYøwP\YøePSYøfPJYUW~W(+RF*PIW_]UPv2NP PS]UP{vPw]øPP1YYVP7Pap+PP>xt'6 P PP PP +PPCYY^U>t C=} P>Y>tPPYYv4Y]+PPMYY<s3+R*P3PRTNP PIPR>+PRPR NPRPR +PPPRNPRPR +PPPRNPP PPøP4  YWPPPPPPP"P.P6P@P+P RP u x%㋇_UVdv拄R^]UF2PY]UVv96L+PRx^]UVW%P+P RF P PvFPFFF+ s%#t!݊G  PPYY=t+F#tE~t *䨀u+2 PR& PR PP3=uB _^]UPVW~ǀ+F ;~Wǀ4FY~wuVPvE6 Vvv3)v v~ _^Y]UvvvrP]UvvvrPt]UvvvwP]]UW~ ;>8t(WY_]UW~W8>8 P!P _]Ã>6t668 P"P U64P P,Pu r+ҹFVF+ҹ FVFVFVP-PFP]UV>tPRYY#t8PPRYY#tPPYY#t P)PNYYPtRQF$rF%vv8>< u4RQzPI$=`rPPvR)PPvR=JWt=EHt=PCt PPYY>PCuPVRvP8P:PvP F=}$拄:#t v: vDŽ:FԸ7PP6Nv=}! ꖋ㊄*䉇zƄPR6>/>JWtPP6^^]W+PPP|PPtYPPkYPPbYPWP#t tt?`_W+>JWuJ&PP{PP(PYP'PYPWP#tKt M_W'PP.YYPP*PYP)PYP6P #tKu>_UFVWPyPPnPFPPZPVVPPFP P>YP P5YP P,YPP#YPPYP6P>&t>_^]W+ PPXPPPYPPYPPYPPYP PYPWPt GPY_U>VW~PPFP PwPFPFP㋷zPYPFP^CPFPFPPP&P6YP6YP6 YP6YP6YP6YPVPt^‰z_^]UFVWPP*PPFPPPV(VPA+PPV)PPV VPPiP P + }J PLP#+R PGV3P (P㋟zPG뱸PP+PP,_^]UVW~v;~} ;}F_^]U VW~~~(> t!$PPPS%PP PD FF~~F F~ ~F+F;v}^Ó7FY;F~FF+;v}&v3;uBR^Ó7FPFՉ~F;tuC+PFPP_PR+RvP6ƌVPcPRRT>t6P+RYPP46PRYPP 6PPYPP PP P>uq7P RYPP7PRYPP7PRYPPPP|YPP7PRhYPP7PPQYPPuPAPPA 7P R(YPPL7PRYPP87PRYPP$PPYPP7PRYPP7PPYPPPP P >tM6P+RYPP6PRYPP6PPmYPPP]PP]PKPPKPEspaolItalianoSvensk/SuomiNorskDanskEnglish, UKDeutschFranaisEnglish, US^lAbort ProgramTerminer programmeProgramm beendenAbort ProgramProgramkrsel afbrudtAvbryt programUscireAbortar el ProgramaProgramkrsel afbrudtCCPM SYSCDOS SYSDOSPLUS SYSCPM3 SYS = o Missing table in file CCPM.SYSZ } $0<Si{.:_%@YNy7JgL'O AxX>bx.ATgv 6d1Ur"+Cq)7I- 3 8 A J !!!!>>>>Q>>>>>>??(???@@@@@@@@@@@@@@@@@@@@@@@@@@5@H@f@y@@@@@@@ A)A=APAcAvAAAAAABB6B\BwBBBBBB C&CA!BICCCCD0DKDnDDXEEEF$FF&G\GGGGGGGHH#H,H5HlHHHHHI"I+IKIIJ=J=J=J=J=J=J=J=J=J=J=J=J=J=J=J=J=J=J=J=J=J=J=J=J=J>JYJtJJJJJK%K5KAKQKoKKKKKKKKL.LdLuLLLLL/MLMqMMMMFLLM8NoNNNNN O,OBPQQ7QXQ8RnRRRRRRRSLSNSSS\SeSSS T TTTT!TATTT3U3U3U3U3U3U3U3U3U3U3U3U3U3U3U3U3U3U3U3U3U3U3U3U3U4UIUaUUUUUU VV)V9VVVmVVVVVVVV W5WAWiWWWWWW$XJXiXXWXWXX7YOY}YYYYY[[[\1\]H]]]]]]]]/^1^6^?^H^^^^^^___6___(`(`(`(`(`(`(`(`(`(`(`(`(`(`(`(`(`(`(`(`(`(`(`(`(`)`=`Q`l`````````aa2aEaXaiazaaaaaab6bJb^bwbbbbbbab c:ccctccccccdOeWeteeRffffggggMg~ggggggh?    # CueaaeaceeeiiiAAEaAooouuyOUc#YPfaiouNnao?!"" ' 1234567890-= qwertyuiop[] asdfghjkl;'`\zxcvbnm,./!@#$%^&*()_+QWERTYUIOP{} ASDFGHJKL:"~|ZXCVBNM<>?    $,.-:,^'`AaOoUueiyaoueiaoueiEaouei  Franais, F. (25/9/83) $Installation du SystmeInstallation du clavier et de lcranInstallation de l'imprimante(s)Affichage des options slectionnesFin de l'installationJeu de caractres du clavier et de lcranUS (QWERTY), 8 BitsFR (AZERTY), 8 BitsUS (QWERTY), 7 BitsFR (AZERTY), 7 BitsFR (AZERTY), ASCII USA 7 BitsSelectionnez vos imprimantes:Parallle 0 (LPT1)Parallle 1 (LPT2)Parallle 2 (LPT3)Srie 0 (COM1)Srie 1 (COM2)Retour au menu principalSlectionnez votre type d'imprimante: Graphique IBMEpson MX-80/MX-100Epson MX-80 avec GraftraxEpson FX-80Imprimante Marguerite(Pas de traduction)Slection actuelle pour le clavier & lcran: Slection actuelle pour l'imprimante: Valeur actuelle: Sauvegarde de la nouvelle installation, en cours ...ERREUR: Disquette PleineERREUR: Absence de fichier systmeERREUR: Version systme incorrecteSauver les modifications sur disqueAbandonner les modificationsInstaller les modifications dans le systmeSlectionnez les Options avec les touches flches ( et ) ou labarre espace. Frappez  pour accepter, ESC pour annuler votre slection.Installation du clavierSlection du type de Clavier (84/102 touches)Slection du mode Clavier (7 bit/8 bit)Clavier (84 touches)Clavier Etendu (102 touches)La configuration actuelle du clavier est: Chargement impossible du programme $ Chargement impossible du CCP $USER$ Erreur CP/M en $ Fonction BDOS = $ Fichier = $Lecture/Ecriture sur disque: Erreur$Le disque peut seulement tre lu$Le fichier peut seulement tre lu$Mauvais Drive$Mot de passe: Erreur$Fichier existant$? dans le Nom du fichier$ lecture de$ criture de$ drive $Abandonner ou Recommencer? $ARI$Protection en criture: erreur$erreur Pas prt$erreur en E/S$erreur de donnes$erreur de recherche$Mauvais support$Secteur introuvable$CapsNum Insrez un disque dans le drive Puis tapez une touche Chargement de COMMAND.COM impossible$ Mmoire insuffisante pour charger COMMAND.COM$ Version incorrecte de COMMAND.COM$ Insrez un Disque SYSTEM - Puis tapez une touche $ Ne peut librer mmoire pour COMMAND.COM$&"'(!)- azertyuiop^$ qsdfghjklmWXCVBN?./+   @\]{|}[     \u{aa@acee}iiiAAEaAooou}yOUc#YPfaiouNnao?!""@~^' &"'(-_)= azertyuiop^$ qsdfghjklm*WXCVBN?./    +@#^[]\@#^[]\ (@#^^F ,/:;!^'`AaOoUueiyaoueiaoueiEaouei~#{[|`\^@]}  ~#{[|`\^@]}  Deutsch (18.4.1986) $SysteminstallationTastatur und Bildschirm installierenDrucker installierenAnzeige der momentanen WerteEnde der InstallationZeichensatz von Tastatur und BildschirmU.S., 8 BitDeutsch, 8 BitU.S., 7 BitDeutsch, 7 BitDeutsche Tastatur, US BildschirmDrucker auswhlen:Parallel 0 (LPT1)Parallel 1 (LPT2)Parallel 2 (LPT3)Seriell 0 (COM1)Seriell 1 (COM2)Zurck zum Hauptmen Druckertyp auswhlen: IBM Graphik DruckerEpson MX-80/MX-100Epson MX-80 mit GraftraxEpson FX-80Typenraddrucker(Keine bersetzung)Momentane Tastatur- & Bildschirm-Selektion: Momentane Drucker-selektion: Momentaner Wert: Abspeichern des installierten Systems ...FEHLER: Diskette ist vollFEHLER: Systemdatei nicht gefundenFEHLER: Falsche Systemversionnderungen auf Diskette abspeichernKeine nderungennderungen im System installierenWhlen Sie mit den Cursortasten ( und ) oder Leertaste.Drcken Sie  zur Besttigung, ESC zum Abbruch Ihrer Auswahl.Tastatur installierenWhlen Sie den Tastaturtyp (84/102 Tasten)Whlen Sie den Tastaturmodus (7 Bit/8 Bit)Tastatur (84 Tasten)Erweiterte Tastatur (102 Tasten)Momentaner Tastaturtyp ist: Programm kann nicht geladen werden $ CCP kann nicht geladen werden $USER$ CP/M Fehler bei $ BDOS Funktion = $ Datei = $Disk Schreib/Lese Fehler$Read-Only Disk$Read-Only Datei$Ungltiges Laufwerk$Passwort Fehler$Datei existiert$? in Dateiname$ liest$ schreibt$ Laufwerk$Abbrechen oder Wiederholen? $AWI$Schreibschutz-Fehler$Nicht-bereit-Fehler$I/O Fehler$Daten-Fehler$Such-Fehler$Diskettentyp nicht geeignet$Sektor nicht gefunden$CapsNum Bitte Diskette fr Laufwerkeinlegen und beliebige Taste drcken COMMAND.COM kann nicht geladen werden$ Nicht genug Speicher, um COMMAND.COM zu laden$ Falsche Version von COMMAND.COM$ SYSTEM-Diskette einlegen - dann irgendeine Taste drcken $ Es kann kein Speicher frei gemacht werden fr COMMAND.COM$1234567890' qwertzuiop+ asdfghjkl#YXCVBNM;:_    @~[\]{|}᎙      C}ea{eaceeeiii[AEaAo|ouuy\]c#YPfaiouNnao?!""@~o"^'`1234567890' qwertzuiop+ asdfghjkl#YXCVBNM;:_     ) +@[]\@[]\@DM.,..;1^'`AaOoUueiyaoueiaoueiEaouei{[]}\ @~ |{[]}\ @~ |English, U.K. (25/9/83) $System InstallationSetup Keyboard & ScreenSetup Printer(s)Display Selected ValuesExit from InstallationCharacter Set of Keyboard & ScreenU.S., 8 BitU.K., 8 BitU.S., 7 BitU.K., 7 BitUK Keyboard, US ScreenSelect Your Printers:Parallel 0 (LPT1)Parallel 1 (LPT2)Parallel 2 (LPT3)Serial 0 (COM1)Serial 1 (COM2)Back to main menuSelect Your Printer Type: IBM Graphics PrinterEpson MX-80/MX-100Epson MX-80 with GraftraxEpson FX-80Daisy Wheel Printer(No Translation)Current Keyboard & Screen Selection: Current Printer Selection: Current Value: Saving installed system ...ERROR: Diskette is fullERROR: Can't find system fileERROR: Incorrect system versionSave modifications on diskThrow away modificationsInstall modifications in systemSelect option using cursor keys ( and ) or space bar.Hit  to accept, ESC to reject your selection.Setup KeyboardSelect keyboard type (84/102 keys)Select keyboard mode (7 bit/8 bit)Keyboard (84 keys)Extended keyboard (102 keys)Current keyboard type is: Cannot Load Program $ Cannot Load CCP $USER$ CP/M Error On $ BDOS Function = $ File = $Disk Read/Write Error$Read-Only Disk$Read-Only File$Invalid Drive$Password Error$File Exists$? in Filename$ reading$ writing$ drive $Abort or Retry? $ARI$Write protect error$Not ready error$I/O error$Data error$Seek error$Bad media type$Sector not found$CapsNum Insert diskette for drive and press any key when ready Unable to load COMMAND.COM$ Not enough memory to load COMMAND.COM$ Incorrect version of COMMAND.COM$ Insert a SYSTEM disk - Then press any key $ Cannot free memory for COMMAND.COM$1234567890-= qwertyuiop[] asdfghjkl;'#\zxcvbnm,./!"$%^&*()_+QWERTYUIOP{} ASDFGHJKL:@~|ZXCVBNM<>?   \ # CueaaeaceeeiiiAAEaAooouuyOUc#YPfaiouNnao?!"" ' 1234567890-= qwertyuiop[] asdfghjkl;'#\zxcvbnm,./`!"$%^&*()_+QWERTYUIOP{} ASDFGHJKL:@~|ZXCVBNM<>?    ##,.-:,,^'`AaOoUueiyaoueiaoueiEaouei  Dansk, DK (25/9/83) $System installationVlg tastatur og skrmVlg printer(e)Vis nuvrende valgUdgang fra installationTegnst for tastatur og skrmU.S., 8 BitDansk, 8 BitU.S., 7 BitDansk, 7 BitDansk tastatur, US skrmVlg printer(e):Parallel 0 (LPT1)Parallel 1 (LPT2)Parallel 2 (LPT3)Seriel 0 (COM1)Seriel 1 (COM2)Tilbage til hovedmenuenVlg printertype: IBM Grafik-printerEpson MX-80/MX-100Epson MX-80 med GraftraxEpson FX-80Typehjulsprinter(No Translation)Nuvrende tastatur og skrmvalg: Nuvrende printer valg: Nuvrende valg: Gemmer installeret system ...FEJL: disketten er fyldtFEJL: Kan ikke finde system-filenFEJL: Forkert system-versionGemmer rettelser p diskFjerner rettelserInstallerer rettelser i systemetVlg ved at bruge piletaster ( og ) eller mellemrums-tast.Tryk  for accept, ESC hvis valg fortrydes.Vlg tastaturVlg tastaturtype (84/102 taster)Vlg tegnstandard for tastatur (7 bit/8 bit)Tastatur (84 taster)Udvidet tastatur (102 taster)Nuvrende tastaturtype er: Kan ikke indlse program $ Kan ikke indlse CCP $BRUGER$ CP/M fejl slet til $ BDOS funktion = $ Fil = $Disk lse/skrive fejl$Skrivebeskyttet disk$Skrivebeskyttet fil$Forkert drev$Fejl i kodeord$Fil eksisterer$? i filnavn$ lser fra$ skriver til$ drev $Annuler eller Prv igen? $ARI$Fejl skrivebeskyttelse$Fejl ikke parat$I/O fejl$Data fejl$Sge fejl$forkert diskettetype$Sektor er ikke fundet$CapsNum Inst diskette i drevog tryk p en tast Kan ikke indlse COMMAND.COM$ Ikke nok lager til at indlse OMMAND.COM$ Frokert version af COMMAND.COM$ Indst systemdisk og tryk p en tast $ Kan ikke frigive lager til COMMAND.COM$1234567890+' qwertyuiop~ asdfghjkl'ZXCVBNM;:_    < [{\|]}[\]^{|}~^ CueaaeaceeeiiiAAEaAooouuyOUc#YPfaiouNnao?!"" ' 1234567890+' qwertyuiop~ asdfghjkl'ZXCVBNM;:_    <   '()+345@$^&*()-_=+[{]};:'"`~\|<>/?##DKR.,/.;-^'`AaOoUueiyaoueiaoueiEaouei@${[]}| ~ \@${[]}| ~ \Svensk/Suomi (25/9/83) $SysteminstallationDefiniera Tangentbord & SkrmDefiniera SkrivareVisa instllda vrdenverge installationTeckenuppsttning fr tangentbord & skrmU.S., 8 bitarSvenskt, 8 bitarU.S., 7 bitarSvenskt, 7 bitarSvenskt tangentbord, US skrmVlj dina skrivare:Parallell 0 (LPT1)Parallell 1 (LPT2)Parallell 2 (LPT3)Seriell 0 (COM1)Seriell 1 (COM2)ter till huvudmenynVlj din skrivartyp: IBM Graphics PrinterEpson MX-80/MX-100Epson MX-80 med GraftraxEpson FX-80Typhjulsskrivare(ingen konvertering)Aktuellt val av tangentbord & skrm: Aktuellt val av skrivare: Aktuellt vrde: Sparar installerat system ...FEL: Disketten r fullFEL: Systemfil saknasFEL: Felaktig systemversionSpara frndringar p diskettBortse frn frndringarInstallera frndringar i systemetVlj alternativ med markrtangenterna ( and ) eller mellanslag.Tryck p  fr att bekrfta, ESC fr att avbryta ditt val.Definiera tangentbordetVlj tangentbordstyp (84/102 tangenter)Vlj tangentbordslge (7 bitar/8 bitar)Tangentbord (84 tangenter)Utkat tangentbord (102 tangenter)Aktuell tangentbordstyp r: Program kan ej laddas $ Kan ej ladda CCP $ANVNDARE$ CP/M fel p $ BDOS funktion = $ Fil = $Disk ls/skriv fel$Endast lsdisk$Endast lsfil$Ogiltig skivenhet$Lsenord fel$Fil existerar$? i Filnamn$ lser$ skriver$ enhet $Avbryt eller Nytt frsk? $ANI$Skrivskyddsfel$Fel: ej frdig$I/O fel$Datafel$Skningsfel$Fel mediatyp$Sektorn hittas ej$CapsNumStt in disk i enheten och tyck p en tangent Kan ej ladda COMMAND.COM$ Fr lite minne fr att ladda COMMAND.COM$ Felaktig version av COMMAND.COM$ Stt i en SYSTEMDISKETT - Tryck drefter ner en tangent $ Kan ej frigra minne fr COMMAND.COM$1234567890+' qwertyuiop' asdfghjkl'ZXCVBNM;:_    \ [{\|]}@[\]`{|} CueaaeaceeeiiiAAEaAooouuyOUc#YPfaiouNnao?!"" ' 1234567890+' qwertyuiop~ asdfghjkl'ZXCVBNM;:_    \   '()+5@#^&*()-_=+[{]};:'"`~\|<>/? ''^^'`SEK.,-.;.^'`AaOoUueiyaoueiaoueiEaouei @${[]}\ ~ |@${[]}\ ~ |Italiano, ITA (25/9/83) $Configurazione del SistemaInstallazione Tastiera e SchermoInstallazione Stampante/iVisualizza i valori selezionatiEsci dalla ConfigurazioneSet di caratteri della Tastiera e dello SchermoU.S., 8 BitItaliano, 8 BitU.S., 7 BitItaliano, 7 BitTastiera Italiana, Schermo USScegli le Stampanti:Parallela 0 (LPT1)Parallela 1 (LPT2)Parallela 2 (LPT3)Seriale 0 (COM1)Seriale 1 (COM2)Ritorno al menu principaleScegli il Tipo di Stampante: Stampante grafica IBMTipo Epson MX-80/MX-100Tipo Epson MX-80 con GraftraxTipo Epson FX-80Stampante a margherita(Nessuna conversione)Scelta attuale di Tastiera e Schermo: Scelta attuale della Stampante: Valore attuale: Memorizzazione della configurazione del sistema ...ERRORE: il dischetto pienoERRORE: non trovo il file di sistemaERRORE: la versione del sistema sbagliataSalva su disco le modificheAnnulla le modificheInstalla le modifiche nel sistemaScegli le opzioni con i tasti cursore ( and ) o la barra spaziatrice.Batti  per accettare, ESC per respingere la scelta.Definizione della TastieraScelta del tipo di tastiera (84/102 tasti)Scelta del modo tastiera (7 bit/8 bit)Tastiera (84 tasti)Tastiera estesa (102 tasti)Il tipo di tastiera attuale : Non riesco a caricare il programma $ Non riesco a caricare il CCP $UTENTE$ Errore CP/M in $ Funzione BDOS = $ File = $Errore di lettura/scrittura su disco$Disco a sola lettura$File a sola lettura$Drive non valido$Parola d'ordine errata$File gi esistente$? nel nomefile$ lettura$ scrittura$ drive $Abbandoni o Riprovi? $ARI$Errore di protezione da scrittura$Errore: disco non pronto$Errore di I/O $Errore nei dati$Errore di ricerca$Tipo di supporto errato$Settore non trovato$MaiuNum Mettere il disco nel drive e premere un tasto qualsiasi Impossibile richiamare COMMAND.COM$ Memoria insufficiente per richiamare COMMAND.COM$ Versione di COMMAND.COM non valida$ Inserisci un disco di SISTEMA e premi un tasto $ Impossibile liberare memoria per COMMAND.COM$1234567890' qwertyuiop+ asdfghjklZXCVBNM;:_     ]`{|}~ CueaaeaceeeiiiAAEaAooouuyOUc#YPfaiouNnao?!"" ' 1234567890' qwertyuiop+ asdfghjklZXCVBNM;:_|     +[]\[]\##Lit..,/:;'^'`AaOoUueiyaoueiaoueiEaouei [] @# [] @#Espaol (25/9/83) $Instalacin del sistemaPreparacin de teclado y pantallaPreparacin de impresora(s)Mostrar valores seleccionadosAbandonar instalacinJuego de caracteres para teclado y pantallaU.S., 8 BitsEspaol, 8 BitsU.S., 7 BitsEspaol, 7 BitsTeclado Espaol, Pantalla USSeleccione impresoras:Paralelo 0 (LPT1)Paralelo 1 (LPT2)Paralelo 2 (LPT3)Serie 0 (COM1)Serie 1 (COM2)Retorno al men principalElija tipo de impresora: Impenta Grafica IBMEpson MX-80/MX-100Epson MX-80 con GraftraxEpson FX-80Impresora de margarita(Sin conversin)Seleccin actual de teclado y pantalla: Seleccin actual de impresora: Valor actual: Grabando el sistema instalado ...ERROR: disquete llenoERROR: no encuentro el fichero del sistemaERROR: versin del sistema incorrectaGrabar modificaciones en discoIgnorar modificacionesInstalar las modificaciones en el sistemaSeleccione la opcin con las teclas del cursor ( and ) o labarra espaciadora. Pulse  para aceptar la seleccin, o ESC para rechazarla.Preparacin del tecladoSeleccin del tipo de teclado (84/102 teclas)Seleccin del modo de teclado (7 bits/8 bits)Teclado (84 teclas)Teclado ampliado (102 teclas)El tipo actual es: No puedo cargar el programa $ No puedo cargar el CCP $USER$ Error de CP/M en $ Funcin de BDOS = $ Fichero = $Error de disco en lectura/escritura$Disco de slo lectura$Fichero de slo lectura$Unidad no vlida$Error de clave$El fichero ya existe$? en nombre de fichero$ leyendo$ escribiendo$ unidad $Abandonar o Reintentar? $ARI$El disco est protegido contra escritura$Dispositivo no preparado$Error de entrada/salida$Error de datos$Error de bsqueda$Soporte de datos incorrecto$No encuentro el sector$MaysNum Introduzca el disco para y pulse cualquier tecla No puedo cargar COMMAND.COM$ No queda memoria suficiente para cargar COMMAND.COM$ Versin de COMMAND.COM incorrecta$ Introduzca un disco de sistema y luego pulse una tecla $ No puedo liberar memoria para COMMAND.COM$1234567890-= qwertyuiop'` asdfghjkl;ZXCVBNM?!"     \]{|}[ CueaaeaceeeiiiAAEaAooouuyOUc#YPfaiouNnao?!"" ' 1234567890' qwertyuiop`+ asdfghjkl'ZXCVBNM;:_     (+@[]\@[]\ @@##^^.,/:;"^'`AaOoUueiyaoueiaoueiEaouei|@# [] {}\|@# [] {}\Norsk (30-04-84) $System installasjonDefiner tastatur og skjermDefiner skriver(e)Vis de valgte definisjonerAvsluttTegnsett for skjerm og tastaturU.S., 8 BitNorsk, 8 BitU.S., 7 BitNorsk, 7 BitNorsk tastatur, US SkjermValg av skriver:Parallell 0 (LPT1)Parallell 1 (LPT2)Parallell 2 (LPT3)Seriell 0 (COM1)Seriell 1 (COM2)Tilbake til hovedmenyValg av skrivertype: IBM Graphics PrinterEpson MX-80/MX-100Epson MX-80 + GraftraxEpson FX-80Typehjulsskriver(Ingen oversettelse)Nvrende tastatur og skjerm: Nvrende skriver: Nvrende verdier: Oppdatering av system...FEIL: Disketten er fullFEIL: system manglerFEIL: Feil version av systemLagre endringer p diskIngen lagring av endringerLagre endringer p diskVelg kommando ved bruk av piltastene  og  .Tast  for velge, ESC for avbryte.Definer tastaturValg av tastaturtype (84/102)Valg av tegnsett (7 bit/8 bit)Tastatur (84 taster)Tastatur (102 taster)Nvrende tastatur : Cannot Load Program $ Cannot Load CCP $USER$ CP/M Error On $ BDOS Function = $ File = $Disk Read/Write Error$Read-Only Disk$Read-Only File$Invalid Drive$Password Error$File Exists$? in Filename$ reading$ writing$ drive $Abort or Retry? $ARI$Write protect error$Not ready error$I/O error$Data error$Seek error$Bad media type$Sector not found$CapsNum Insert diskette for drive and strike any key when ready Unable to load COMMAND.COM$ Not enough memory to load COMMAND.COM$ Incorrect version of COMMAND.COM$ Insert a SYSTEM disk - Then press any key $ Cannot free memory for COMMAND.COM$1234567890+' qwertyuiop~ asdfghjkl'ZXCVBNM;:_    < [{\|]}[\]^`{|}^ CueaaeaceeeiiiAAEaAooouuyOUc#YPfaiouNnao?!"" '  1234567890+\ qwertyuiop~ asdfghjkl'ZXCVBNM;:_    <   '()+345@#^&*()-_=+[{]};:'"`~\|<>/?##KR.,/.;/^'`AaOoUueiynNaoueiaoueiEaouei@${[]}\' ~ @${[]}\' ~ S&.2ұn-N% ࢵ&G> udXш&& ôP!3 ࢳд!T!!2ㆠ3+u ub t/<+tHu^GtG3Ҡ.!3|uVGOr dursuy echo off prompt $ej$eY `$ep $d $eY!`$eK $t$h$h$h$eq$ek($p) $n$g&.2ұn-N% ࢵ&G> udXш&& ôP!3 ࢳд!T!!2ㆠ3+u ub t/<+tHu^GtG3Ҡ.!3|uVGOr dursuy MAIN HARD CPMINFO  NYNNNN M HARDS}};}} }}}}:}}}}@}} }}}}}}}}}}}}}}}}}}}}}} }}}}}}}}}}}}}}}}}}}}}}}}}}}}}} }}}}}}}}}}}}}}}}}}}}}}}}W}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}} }}}}}}}}}} }}}}}}}}}}}}}}}} }}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}c Ŀ}MULTI-USER / MULTITASKING} Ŀ|y|K}OPERATING SYSTEM} Ŀ|m|K5 Ŀ|g|K Ŀ }from}|c |K|g|K}Press [F10]}  |c |K} to install.} }DIGITAL RESEARCH}  nĿ }from}PNYNNNNAAAA M a:installh xm ca:installh xm da:installh xm ea:installh xm fCPMINFO]6Ŀ}Choose the \DOS drive \to install Concurrent DOS on:}6Z}ͻ}}ͻ}}ͻ}}ͻ}} F1 }} F2 }} F3 }} F4 }}ͼ}}ͼ}}ͼ}}ͼ}}Drive C:}}Drive D:}}Drive E:}}Drive F:}[0Ŀ}If you have \CPM Media \installed on your hard}} disk then press [F9] for further information.}0}Press to return to the previous screen}your hard}} disk then press [F9] for furtherNYNNNN A FDISK)Ŀ%}Concurrent DOS now supports Password}%}Protection on DOS media and therefore}%}only needs to support ONE media type. }%}' }%}If you are already using CPM Hard disk}%}Media then you should Backup your files}%}to a DOS partition or to floppy disk,}%}using your existing copy of Concurrent.}%}' }%}When you are sure you have \BACKED UP \}%}your files then rerun this installation}%}procedure and choose option [F10] at}%}this menu - This will run FDISK for you}%}which will allow you to delete your CPM}%}partition and create a new DOS one. }%}' }%} \If in any doubt please contact your \}%} \ Authorised Concurrent Dealer. \}%)t}Press to return to the previous screen}lease contact RRb`Y#2PVZ CP/M V1.35 6/12/85 SMALL Model CLEAR library. Copyright 1983-1985 Digital Research.$UWVVN< *^_]%Ë-++Ë6_Cr Ë6_+́;s;r+ێO$Zero divide error$XYZ+^gVDRQSVRSSSP6 [ZB;v Stack overflow. $+RSñ uPPt<vB AD ÃԱi@t+ P X"r.t " t5 t 5t+ɈH F ùË-UPPPe+]You must link with LINK86 V1.2 or later. $66 UVWv v~v2f_^]Y[ڎ^6-6'6!6666 6SV++4,S$p{ȳ+^t&u+[+u@fUYv PDDPDD%F: upPDDH# 8Fu PcDDJ PWDDH]2=2}>P P$PDDPNDDPWDDP<DDP-PUvDDPDD%FPDD~ w+P)DD~Ar̀~PwƊF2-AFP^XP%PP-PvPtFP-Pc~t PDD~t`ppPP7L?F L^?F~ ~XLPP tp? t|p?upFLM.F L^ F~ ~LPP tfpF^fF L^?F~ ~F PDD]UPDDPNDD%FP|DD8Ft 8Ft+j8Fu@lHLLPP PEDDPDD%F 8Fu n 8Ft PDDFFP PPDDFPF2@@[~uF'FF?0r FF?9v PDDcF~|pF2-0 PF2-0[ÉFF2-0 PF2-0[ÉFF2-0 PF2-0[-PF PF[FhPDDjP+P_PDDPDD%P2[;u,DPDD+PP$PZP PDD]UVW H< P=PPAH<PP@F+Fǃ>fuFp%@ t@Fp@?.t@F~t ~uFn t~up %tF~u"~uPPp@P tFp tpPi DD tF~tTd D PDPp@PT PDPpP?FDD~t^7v<P!DDF~tUD%uFl t ~u6FF t f9DuFDPDDvVXDPDD u4FD%t|u;u^VaDDvF uȋǍf_^]UVWvYE%uM=ulPDDP DDFrPF[؋P< DDF9F|ދ]UJPPPP&&:PP=u V P DDs3vpPIpPDDpÉFF FF FFp;FuP,P-PPPP]UVWv(D%tr-FԊD%ts-FՊD% t-aFFttFPP@ DPDPrPP$ f_^]U^FFf?^FFPFffvvv&PFH[7vP ]U^;hs@]VW p%@tp %tp %tp %tpƓ%t F~ pƓ'F ~_^UVWv+#F tǓG|F%tLF%tL _^]UVWvH@L PMPDPXlLPP t:P DD+_^]UVWvJ@ PPDPPPPP tPP5 DD+_^]UJPDDd+PPP+DD uPDD u Pv]UVWvLL0E%u$E?trP[؉? t ủE%u}uJPPEPDDHPPEPDDrP[؉?EP^DDFHPPPDDJPPh)PlDD~t  tX+f_^]UV$FFF FFFrP[؋ơPDDVDDVDD t+FVDD t+FFttFFvvFF$Fjvv+P@P X tF FFvvLPP`FFFFRPFP FFF;F}vv+PP+ X tvvv+PPG X tLPPFF}~|FFFvvPPFvFPFFF)FFF~t PPx PDDPDD~tzvv+PP X u utPPB  tFPMDD+PP+PPcFPF[؋PDDF9F|ޡP|DDVDDP[؋VbDD t+FttFFFPvv vv+PP X tPPdF^%F t F~u| tD2PPPPn t#D2PMPuWLPPDFۍf^]Uv,P+PPv3P]UF2 uF~u+F]UVWv| tD2PPPPf Ǔ'G ~_^]UF ^73P4ppPP ]UVP,PP-PHAPP$ PrR PDDPDD5PDDPHXP%PHPPF~tH&PP|& PP6PS 0" 0!PP1F~u*:PPF~uPP~tP-PpF< wpPP f^]UvBPC]UFF7DD^?u]U F FF^FFFFPoPk]V tơ$P}DDƃuPDDPDD^UVWv6_^]UVWv~ FGN~u_^]U(FـFFPF@[PFF%[F~ |FFPP]U*vDD u+FـFFPF@[PFF%[F~ |FFPPR tgPDDrFF׋^׀?u ^N׸r9Fv^׀?:t^׀?\uvrPrP&DD![PDDTvDD]U&FFۍFPP]UVWv~8t+FGN~u_^]+PP+P PU|FPvYP<|;t|+P|P]UPF[2]UVWv~~v PtPYY6>)>~_^]U"VW PY<2sP PYY=uN|FޑFF,F.FP1RfFFF/V1PLFu~ u ~ u< v WPYYF*H"_^]UV>|tPmP+P "PT PYY<`sdPRpVPi#6"ZPZYY"t+PvPt^]Ã>|t +PmP(Y% PY<`sdP6"[PYY+PY+t;t P%PYYUVW~;>v PtPYY6>)>_^]UVWv"P-P"P%P6"P"t vPAYY>|u)"t vP!YYvFP6"#u v&PYYFtu($&( $&( v>PYY>|u PYN~>t W\P YY#t- Pu6DDD6NUDO͡L@PD+W_Y;u;t P >NY+;$tka*HУ +>t WxPSYY#t< P6DDD6DO͡J&PY+ :86DB@20.,4*;$u";tPY66JPRPF_^]W;>Lr>tuW Y#t WPYY^>t&tWr Y#tw:WP_1$ <u%>t WP?YY. t6Gp>.u 666.P >tDlPY#t >tIm D>t+PPP6.u +PPP6.^P .4.FP+PPRLJJR% D#t*#tQPPR@#t RPP62B#t7RPP6,>t6>6<6>6<"P >.u>t1>tBP68P6:XP66P6.nW>u"+PPhP6.S6+RPXP'>8t'+PPhP6:*8+RPyBPPi0#t+RRzRP+PPR64>t'P06 P%6PP _UPVWvY;>LrvuhW YF#u4VF;&u ߀>t WPYY0-v;6Lwހ'V/ YÓG끃>t> >t PgY+PY_^Y]UVW~vNRPFRPv~RP1YY~v~uvPYYv VWP_^]U*VWvvPFPF։Fv #t,^FFtu^ u FO FFPY_^]UVW~#u+;6Y~V+PYFYYF~v YFL;w F;rFF;LvW P1P*=+FW7 Y#u.VWYY#;uW +YFF;LvF_^]UVW+;>Y~W+P 6YYt PPv P^G t:uw Y#tF^wFvveF~uIi PPivb PPX  #t ^G NGWG^G $*F#t@^G tDB>t^GW<>>t ^w8Y>t)~u#^G#tP] Y#uF;tv"Y+FF^;uQ;Ft Pv ->t^GW uW P[vT PN+F+҉FVw;>LvNFVt~u~F~t2^G t*,Ó>titd Pv * Pj #tF^wVY#uV8FY;&t +PVYYv6&W^G YVYFF;Lw> PJvC P=>uL;>(sF \ P#Y#t( PVLYY+^GЉGWGv PYY~t ~ Pv v P~t,FVW _^wYg>u`FV^+GW|NGW-+FV}7Q FV^GWG P=v6 P0F>u^u~u ~u Pv FP+^YYWY#u\#t PFY~A~ PFYWPFYYWDYB;u;tWPFYYW"뚸P{Y_^]VW+;>Lsߊ$<u VW YY#uFG_^U(VWF >t#v,Y#t :t+WF8vPFP>FF;YwaP+PYY?tO PFPS`#u7wVY#uVU+PVv+PYYFFF;YvP+PWYY"tLs&t>t W< PYY+PWYYG_UVWNRP^GW-RP^G;G:uY+;v^GPY#uBG6Z P:v3P-^#tv@( PWDYYNG_^]UW~+PW PR6q #u4G t*;u% PP SL#uG+t+_]UVW~FvR;>LsL~~+F;u.;6t(FFW YFF;LvW PVPO#tVvYY_^]UPVWP-PYY;>L}cuUPWaYY#tGWWv P#t4߀!VY#uVuF+RVv6&WYYG뗸P-P YY_^Y]UVW~v>tHPW PH.JPFVY@ FV+RPHH+RPv~FV6v&Pvv_^]UVW~v#u)H.JPFV#Ɗ +FVGH.JPFVY@ FV+RPHH+RPv~2FVv~vv#GYY_^]U VW~F#tuRRPvvv~_NF6R+F;~vv vvV6"q #tvv PFƙFV+&F 뇋F_^]UVW~#tpRRPvvv~_NF6R+F;~vv vvV6" #tvv PƙFV+&F _^]UVW~>$t2#F;Gt NJPY+F_0(ǺFt 7 ^7;6&v_^]UW~;>Lw r+*_]UVW~>$t+WQЋ#F_ӋډGY6Ǻ6t%VЉ %F_^]UVW~F6#t+;Lu;Ttv+;Tu;DtLe>tW" P YYtP+҉FVPFVRPeFVDTD;6t^6_^]UVW>u>t=#tg}t>tS>tuu: Pi PEUFV6H#t uPvvRJFVNE듃>t9PFV6H#t!66Jvv JFVN_^]UVW5#tT;VuT;VtD;FuD;FtBV>tvvR Pt6vvFVDTD;6t 6_^]W>tD=#t;}t>tuul P$u6uu%E_UVW"AP PFVW _^FYYF;~m㋿FF#t< t^FGN= t ^F.#t< t^FGN^~uFFPPVF_^]U FFP PP0~tF*  *;u+]Ã>u,>u%P㸆 P㸲 PPUvvRP?]UW~A| Z _]UW~"ttt+PPYYUvY] "t&h&G &N UVWFt~_^]P  u[&t&_&UVWU]~t&O&g_^]ø  UVW>"`s"NnQvv v  ( ]- $^%& &_&G fF (*F&F ,. &.$/_^] 0123456789ABCDEF000000001000000000COPYRIGHT (C) 1986,87 DIGITAL RESEARCH0000-XXXX-654321 CHKDSK 6.00 10-Aug-87,./\. .. MXdisk %s A: %s %s %s %s %d %s %9ld %s '' %s '' %s? , %u-%u FILE%04XCHK %c:\%s VX\`dhlptx|JanFebMarAprMayJunJulAugSepOctNovDec4^:CHKDSK v6.0 (18-Aug-87)-----------------------/B Read all files to find bad blocks./C Display cluster numbers of cross linked files./D Find removed directories on the disk./F Write fixes back to disk. (Default = R/O)/L Rebuild cluster links./M Verify disk for bad blocks, map bad blocks./R Recover root directory./S Show actual file space./V Be verbose - displays extra information./H Displays this menu.CHKDSK: %s %s Illegal Option: Not enough memoryRequires Concurrent DOS or DOS Plus$Bad drive specification: Can't select drive There are open files on drive Drive %s is locked or there are open files.Not a physical drive: Drive is not DOS formatted: Dir buffers allocated: %d FAT buffers allocated: %d Reading File Allocation Table Found erased directory in block %04x Directory at block %04x, parent = %04x Cluster lost: %d %d lost clusters found in %d chains. Recover first level directories (Y/N)? Convert lost chains to files (Y/N)? bytes disk space freedbytes disk space would be freed bytes total disk spacebytes inhidden filesdirectoriesuser filesbytes actually used in files recovered directoriesrecovered filesbytes would be inbytes in bad sectorsbytes available on diskNumber of FAT sector reads: %d Number of DIR sector reads: %d Cluster marked as bad: #%d Checking Directory Circular link found after cluster %u.Volume in drive %c has no label Volume %s created %d %s %d %d:%02d Checking directory entryDirectoryinvalid, convert to file (Y/N)Lost sub directory: File size error, please erase file: File contains bad blocks: . Delete it (Y/N)? Circular link found in file Missing end of file, link fixed: File cross linked with another file: on cluster %u File size error, file size adjusted: Cluster numbers for file: Root directory full. Erase some files and try again! Releasing lost cluster: %d Rebuilding chain for file: Cluster %d (%04xh) is bad, remap (Y/N)? Reading clusters %u through %u Disk error while reading track %d, sector %d Disk error while writing track %d, sector %d Reading FAT record %d Writing FAT record %d Reading DIR record %ld Writing DIR record %d yErrors found, F parameter not specified. Corrections will not be written to disk. S t/<+tHu^GtG3Ҡ.!3|uVGOr dursuy X X k6z2PV wZ CP/M V1.35 6/12/85 SMALL Model CLEAR library. Copyright 1983-1985 Digital Research.$UWVVN*^_]+ێOsZero divide error$XYZ+^gVDRQSVRSSSP6 [ZB;v' Stack overflow. $+RSñ uPPt<vAÃԱi@t+ P X"r.t " t 5 t 5t+Ɉ%Ë-++Ë6_Cr Ë6_+́;s;rùË-UPPPe+]You must link with LINK86 V1.2 or later. $66 UVWv v~v2f_^]Y[ڎ^6-6'6!6666 6SV++4,S$p{ȳ+^t&u+[+u@fUR[`u]> >=T t dPJDDFPvvF+PvDDDFPDD t FP &DDPODD+P`ADDPPsDPc=DDPPN&[؋GHPPN&[7PN&[؋GPPN&[PJ PCDDPLDDFP DDF+PCDD+Pu PGDD:P=u=u="u=!u=.u{=um=u_=uQ=u==u)=u=u=u=u=u=u=u= u= u=u=2u=1u= u= u= u}= ui=uU=uA=u-=u=u=u=(u='u]U^~~cPF@@7V tPF@@7@ u7>u t P^DD~~vF7~uvF@@7]P>DD8GZ$PnPnUvPP:]P\DD]UvDD@FFFPFHF؊[NF9F}ߋFHF؊F]Uv蹖DDHFvvFF2PN~}ߋ]Uv胖DDPFFHX+@PFHFPFFHFP]UFFFPFF[:t+FFF?uո]UvDD;F|7FF FHFPv tFFFHF؀?u+]UEFFP^?s)^?r!P^2[؊%t ^2^2[F^?u^]UFF+FPF[ 2FFF2 1FFFF?uɋFF2]ø PPZUvDDFFF9FFHF؀? tF FFFPFFHF؊[F9FFHF؊:Fu΋^v F@[]UvFPӓFFPFF2[؊% uFF?-u FFFF fPFF2[-0FFPFF2[؊%uɋFfF^FFF?u@]UvPvZ]Uv[DD u@]++UvvY]øZ2UF2PP]U^]UjvvXF u?vPFPDZvFPWF uvPFPZFPDDF]UFFI^? u/PF+FX+ÉF FF N~}FFP^[F^?u^]Uv蛒DDPPv(PPO PWDD= u]UVWv~GP[FN w_^]UVWv~ FFO _^]UTF~tN**|.v t'j% t(\F2<t<t<t< t^F+6?TF~r$~wPF2[؋F~tFp]UvZDDFJ^? t ^?tFSL t+P8DD0( F F=/t=0t=3t=+t>닋]U FvDDFF*F9Ft*FHF؀? u v|DDFFFF9F~΋F]U v賐DDFFF,^;F~*FHF؀? u v$DDFFFF9F~̋^FF]U PN&[؋GLFPADDFFFFFF? uFFF9F|F]UPNf[ÉFvD)DD^^G^G^GvFP ^GH^GJ]U<P!WDD u PaDDF.FH uFHX FH FŁ~~F#Pv#PNf[ءGLF~~]øPN&[UvP]UvU0DDP\2DDF]áPDDáUPN&[ÉF^GH;F} ^GHF^F^7PV)F^Gv^G@[GP^GHF؊2[؊% ubvv*DD@[GP^uv^G[G v^G[GvFPv-[GF=t=ugv^GPv[G]U PN&[ÉF^GH;F} ^GHF^F^7PX(FPmDD@F9F~FF^FGv^GPv.[G]øPN&[؋øPN&[؋GHUPN&[ÉF^7P'F^GPv܌DD@[;u-^7^GH[;u+^v^G[Gv^G@[G^GHHF؀? uv^GPva[Gv^G@[G^7P1'F^u!^?u+\P^HPrEv^GH[G^GHF؀? uv^GPv[Gv^GH[G^7^GH[;u+v^@[^7P&F^uv^G[G v^G[GvFPv[G^?u+v^H[^7P &F^uv^G[G v^G[GvFPvE[G F=t=u=u=u]UPN&[ÉF^7P%FFFP^GHF؊2[؊%t+F~tF~uF F=t=tك~uQ^GPv9DD@[;u1^7^GH[;t,^^7P$F^GF@@Wv^GPv[G)FF^u4^?u^^7P$Fvv蚉DD@[GF@@P^GHF؊2[؊2%t+Fh~tE^GPvIDD@[;u!^^7P$F^GF@@F*^uF~uF F=t=t~uv^GPv[GF=u=u ]UPN&[ÉF^GH;F}+ vP_#]øPN&[7DDU *PpDD"=2~#PP+PoDDPPpvJDDQ)]U>tu P4DD19PDDqFvDDPDD+P DD]U PN&[ÉF^7P"F^Huv芇DD u P\4DD~tv DD^F^G^G^Hu"^^GHP^GHP.B^7P "v^GHH[GHr2^7^GH[;~ v^GH[v'DD^GJ]UPN&[ÉFv^7P  tI^7'DDFHY1^^G^G^7^7-^GJ]UPN&[ÉFv^HPP  tH^HP4'DD0FH^G^G^@P^7o-^GJ]UPN&[ÉF7P ~ tGFF~~&F@FPFH؊2[؊% u܋FHPP评FHGPP77,P;DD tGH؀?utPDD@P7P  u7PP譄DD@@F FHPFHH؊[NG;F~ԋGGH؊FPG@[GPGPP[G77+GJ]UPN&[ÉF^7PFPۃDDF~u PDDF^GPF@[;t^7^GH[;u Py0DD^@PPhFP}DDFP^7P^ u^7P6FPv蛂FFPFHF؊2[؊% uFHPPvvvW^F^GF^GF^PDD^F^FG^FGP^GPv^G^7^7*FGJ]U PN&[ÉF^7P8FPMDD@FHF^G;F^_F+@P^GPv^G^7^7)^GJ]U졔 mo.m^?uo^2<\t0PN&[GJ]UPN&[ÉxxHu@ PxPu u*xJu 퉆zzPNvDD u P@DDLxPFPu t3xP|PpuFPxP^u+P|Pw]UPvP6ue uPvPu PvPAu tԍvPFPtFPuDDppHrFr?.t rr}胾r| Fr PFPt P""DDvP)"DD%FPx9DDnuPN&[GJ5 P DD @ P DDދ]U`F@?>u L PV$DDvL$DD+PeDDN PDDvFPsFPDDPP+PDDO PDDvFPrFPFPsDDH[؊F~>t~ tP PFPrFP,DDFF+PDDPPP|DD~t F*N.PDDFPqDDF+PNDD+PqDDPDD|PDDpPDDdPDDXPPHPP7P^P&PMPp+PDDPDDv [^ 7MrDD;F FFS PDD~uP DD t F2P0DD"FPDDFFe PDDtF=t=%t=+t=*ub=&uN=u;=u-= u=u= u= u=u=u=u=uz끃~uu P-DD.v P!DDF]UFP~ PPv% u+Jv v܃ u  PDD-^ ;F| ^ ;F~ PDD PDD뙋]UXvFPp PFPpFP PPFP u+vpDD=tz^?s)^?r!P^2[؊%t ^2^2=YtH^?s)^?r!P^2[؊%t ^2^2=Nt PDDL PDD^?s)^?r!P^2[؊%t ^2^2=Yu@]UPNf[؃Ju PDD]UPP+PDD~tPDD u+ PTDDPDD]UvWDD]øPPfPN&[؃H~+P;DDPN&[GJPPXU FFvnDDFPvvv%FFF9F~tك~~@]UFvlnDDFvanDD@FF HF؀?tv vF FFv vFPv tF9F~F6v vF PvvvpF~~FFHF~uF9F}FFF2v vFPvu u FFv vF ~u F9F F]U/*%FHF؊2<tFHF؀?r/PFHF؊2[؊%tFHF؊2FHF؊2FF8Fu FFFNF9F~gF]UFFFFFFHF؀?*u FHFvv?PӃFFFFHF?FFHF؀?tF9FuFvFPvFF?u+FHFcFFPFF[FFKFHFcFFPFHF؊[F"FHF؊2<\t<uPu/9t&>t>t V PDD>u%գPN&[؋G PDDP>uF 9}&FFPN&[؋G PoDD]á9uU  u P.DD+ ՉF9u9F|9F} PDD+X^ӡ+FF*FPJDDF+vDD u FF9F~θPF@PӃ]U PP/DD[؋GF+@FYԉF9u9Fu PUDD.9u"9F~ F+FF9F~ F+FF uFPDDF Pf[؃ t9Ft vDD PDDPP:҃PHDDPP[FFF +PDDFF9F~~~PFHPуvDDFFF@PvуPP+PDDPPу]U  u P DDFPDDF Pf[؃ t9Ft v}DD PrDDPP$уP2DDPPEFF PDDFF9F~vDDPP ]U t>PDDF Pf[؃ tvDDPPv? ]U t 9t2>t 9F}>t9F9}g]U t 9t&>t 9F}>t 9F}]á>zUFrPF[؋;FuF F~~߸]Ã>|u P DD~P||[ءzÃ>|~~P||[7DDU Pf[؃ t3vuDDPPYP/DDPPB]Uev*DDF~trPF[ءvDD`rPz[؋FFzPa]U F vGDDF~~]$PPPP P? PPN&[؋GHPPN&[7PN&[؋GPPN&[P UVWLLP<DD%PP# PPP +PDDFPDD=%u >uEf_^]UFz~t vDD trPF[؋]UPDD]UZ P&z[ÉF^G^G ^G'vFPL[FP[DD@F~#~F#FFFP^7g^FGv'PFHX+[G]U PN&[ÉF P&z[ÉF^F^7^G[;|~t#^7^GX+ÉF~}F^G+FF^FG^G;F~>vP^GP^_XHP^GP^7^_X+FHP^7 ^GFHP^GP;^7^GP^_X[;}~t+^7^G[ÉF^GH;F} ^GHF^GP^_XHF+ÉFv^_F+@[G^G;F~?vP^GP^_XHP^GP^7^_XHP^FP ^GP^_XHP^GP^_X+FPA^GP^G [;}v^G[G :^GP^G P^_X[;|v^GP^_X+@[G ^GP^_XP^_ X+P^7^XP^_X+P]UF +F=Ot uPPz@>zt9~ uv+Pv vvv vPv vvv ]U~t t PDD PDD PDD]U P&z[ÉF t>zuF9Ft^G;F~ ^GF^GP^_XH;F}^GP^_XHFFFOvLDDF~uI P^FP^_X+P}v^FP^_X+P_FF9F~]U P&z[ÉFMP^_X+ÉFNʉF^G;F|~u5^GP^G[; ^Gv^GP^_X+[GJ^GP^G[P@[;~vP^_X+@[Gv^GP^_X[GPPRP^GFPȃ]U P&z[ÉF1P^GPǃ+P^GP^_XHPǃ F=t=t‹]Un P&z[ÉFFFv5VDDFFFFk~~ NF BF9FmFHF؀? uvDDHFF@FF FHF؊FF^G ;F FFFF^G P^_XH;F||^>u ^G ^_ +@F^G;F|,~~&^G+F@PvFP^GFHPvh ]U P&z[ÉFPN&[ÉF^7^G[;|j^7^GP^_XH[;}OP@P^GP^_XHP^GP^7^_XHHP^7^X@P^_X+Pw ]U P&z[ÉFPN&[ÉF^7^G[;}^7^GP^_X[;}wPP^GP^_XHP^GP^7^_XHP^7^X@P^_X+P ^GP^_XHP^GP^_XHPJ]UvSDDF~uFHF~2~F2F+@FPDDvPvPP F@+PDD2+@PPK PPP\ PPPPL PB]U+PvV]UPvD]U>zu P&z[ÉFPN&[F^G;F~ ^GF^GP^_X;F^GP^_XHFF+F@ ~@FF-^GP^GP^FP^_X+PvFF9F~]UVW t,PDDPPO PPPHHP; +PDD9t+PPPHHP_^]UVWQ PvaQ u)T PPQ]~ uPvQ uvPP P(PxPFvFPPFPIQDDtt(~ Fdžt(tdžv (+t@vFPxPvH[P^P(PPxP)PHP  9F tBF FPv PPW P=PP PHPFP>PP 9Ft0FvY PFP}PPFPAPP 9FuGFv] PFPBPPFPFPPP PPa PKPP9 9F t,F FPv %PPFPLPP f_^]U;}vODDPPvPP ]øPP} U PvPO]UFPd P~um PFPNv PFPF u!x Pz PF u PDD |FPFPODDH[FPODD=}~.t~Kt ~MtPPFPEPFPTN thFPFPNDDH[FPNDD=|-~.u'~MuPPFPﷃFPPM.NPFPONP|DDvVPFP uvVPFPo tvDDG]UPcPvE u +vMDDHF]UVWf9Ft[ t PDD P PA#FPDD t PFPM uF9|ԍf_^]Ul>u uPjDD舾>}F~tF>~HHF~}FP(DD+PDDvDD FPDDFPDD t PFPbL u݃>~#FPHPḃ PDDFPDD PuDDȽ]á---+@@HHH6U~t~u>u+]U+ P PPwP PPePPPPneP PP@P PP.PPPP7PPPP& PSDD=t=uf]U\F+F@FPvFP븃FFvPFPvvA]UVW,P KDDPP,PPHP _^]+ۋUjv PFPvFPFPFPH P J]UVFPvζ~u FPJDDFvFP]Ur PDDF<PNf[ÉFH FFFvDDF~uF F0F^JtFYF 9Fu  tFYF FPFPEIFPIDDF6FPFH[؀?/tFPFH[؀?\uvոPFP NՃ~}čFPIDD=~FPFPPvP^GHPPFPkPFP]PFPOH PXDDF~E PCDDB]á^PXDDUv P.]U+PPF~1r@]U FPPv+PN FPPv+P: FP Pv+P& vF2[vF%[~u~Ou^P^>u0^>}^?Pu F2 u+^P^FFO]UFP*Pv+Pw vF2@[vF%@[^^]UFPFPFPF9FucFPFPvFPFPvx~u;~Pu5~u/~u)F+FFFFFPFPFPFPL]U&~uFF=P~ P+FFPfFFڋF FbFF FbFFFFFPfFFډFܡ`FދF@F`FFFFF^P+PYvPFPFP^PP6]U~uFF=P~ P+FFPfFFF`FF@F`FFFFF^P+PF FP+PvPFP ^PP]UPfFFF`FF@F`FFFFF^P+PIF2PPPPFP% ^PP"]U~OsPfFFF`FF@F`FFFFF^P+PF2FP+P@PPFP ^PP ]U FPP^P+PIFPP^P+P4F^FFPFPFPFP]UFd]ø PcDDU]ø PTDD\PP+P\P\@\>\|^dUVW.@@PF[.PF[.PDD_^]ø PDDø PDDUVW~u2F02F0 PDD, PDD!F=t=t=t=t=t=t_^]U.dGd% pd9d d.,d d!F=t=t=t=t=t=t]U2d% d;d%d0d% d"d%dF=t=t=t=t]U vBDDF+F @;F }FFF+F @F +ÉFF F HFFF+F @FdPF HFPvFHPFHPE ~~vFFHPFHP]ø PDDUF*FJFDF>F8F2F,F&F=t=t=t=t=t=t=tPPFPvv]U t P腪DDFFFF +F@PF+FHPFH[P`PFHPFH[P`P FF9F~FFFF +F@PFFHPFH[P`PFHPFH[P`P` NF9F}. PȩDD P迩DDF =t=t=t=u!]U~tpPFHPFHP]U]AU+PnPàP-P趠 uP P衠+PP藠F FF2P^2[ãb+PPi^>^~*P PQ+PPG`PP^P+PXP P$]?dHHHQUVWVN ^?&%?& ^?&%?& Jt)^? ?^? ?v_^]UVW^VN?&%W&#F 3F & _&%?Jt^? ?v_^]UVW^^^ ^S^X^^^ v_^]UVW&^F^&^&v_^]UVWiVwF^ F=u&&v_^]UVW/V<؋F=t &G4 &G46t6F6F2(F2FF2F~uF6F2f_^]U F FF4FFPFPFPFP/fP P;]U +PP(4F FF4FFPFPFPFP]UVWv~vFPF[~ tO ~vDDF=u~u+Ff_^]UVWv~F ~}FP f[ÉFG%uރ~|+=wt=WuvPVm Fe=at=Au;vPVtF }vPV; FP+PPvC =rt=Ruv+PV0F+V~}+L^G^Fv^+G[G=rt=Ru ^G^G~u^OFf_^]U+Pvv]U+Pvv]UPvv]U@ vҚDD]UVWvD%t(VDDD%t DPBDDV+G[GDdPDD_^]UVWvD?|D2V:DD_^]UVWvD%t,D?|DF2#VF2PL _^]UVWv~LLFW2PF=u<uFf_^]UFPv P ]UFPvv ]UVW4F̉VvB=uD2ǍF܉Vv=uh|t% tD2;tDD2W!DDFʍFPPlFvW;~t$+f_^]UVW FDVދFG[GDFPvVV+P;Ǎf_^]UVW }VDDPvVV<DD_^]UVWFH+@VDD u+VW_^]UVWNjƋDP\X3 tPDD+D;Fu;6tǡNjƋD;Fr;6uvDD u PcDD+_ʡNjƋDP\X3 t P9DD+5D;Fr);6uvDD u P DD+_^]UVW^ƋDPF@[;w v[?fÉWD+F[GWE[GW[^?ދFGVD[GFD_^]UVWLLF?FfPLDDƃu+5@RP+P@PjrXZƉߋFGWE[GEP DDf_^]UVWF-ƋDP\X3 tPDD;r9r9r 9v;r;r(DⓋPEⓋ[;w>+lDⓋP[;uVG[GVD[GV[V[EⓋ;uWD[GWE[GW[5>+_^]UVWvVDDFH+@FP3DDF u+R^;t8;s GP[N~uFNjF OPN[N~uvvf_^]UVWvVUDD u F% t% t=% u4EPE PI!X tP+PPV" PPVW`DDFE2PfDDFEPP豔2=uFvE2PrVVDDVDD~uFf_^]UVWvP[؋FD% =u>DP\X+ÉF ~-vDPP&9~tLHD%t|tD%tDDPDؙRPP DVD[G+f_^]UVWv P+Pv'4 P PF@P4 PFPVIƀ<:u,FPvt=u PFPFPƀ<*uP?PF@P3FPF@PFP<.uC PFPFPƀ<*uP?PF Pv3FPF PFPS<;u) PFPFPƸPFPFP%+2< t< t<tf_^]UVWv~4GP0}dž PF2-0[ÉFFF~0r~9vĿ~.u+FFF~*uv^ǃFFF. PF2-0[ÉNjFFF~0r~9vdž~lt~LuFFFFtև::PP PPV ttև::P+P PPV ttև::P+PPPV tPtև::P+PPPVU tv^Fv^2䈆ƆF2PWPVF F2PWPV F2PWPV( vF2P/zF2u:P@@P=uP+PP@P=u@@PPB +P@P&=t@PP ?PW@ u*PW1 uF4PP|PWP)F~u PWMFPF2PvFPDD@P2|DDFFPvvDDPWPF~uWDD2<>u<D2P%DDFDP#PpvvD2P=D0P.+PPX[-F^%uvv+PPX uDPvv)X t-vDD tvvV tDPvv+PP{D4ǍFG;~s=uDPD4+ÙRP DP+PPpCDPF^SP+PP"ODP?D P8X tDPD P%+D PDP DP X[f_^]Z[w7ZYX[GZ[YX[SPZ[YX+[SPUF UFF 3FFF tVV FV FtVVFV F Fu3FFFFVV VVQvvvvYYs$QvvvvOYYYF^VV VVFu"F^Ft ]YSPF^ZX[؃SPZ[YX;[u;uPZ[YX;[u;u+PUN ;N|N;Nwr4F ]+׸ҸYXZ[WYXZ[)WYXZ[!!WYXZ[  WYXZ[11WZYX['WZYX[oZYX[QSPZX[YSPQRX[YZSPRQ&RUVWvFtt+PPXZF+Pvt tX tpVDD tD\%SPD \-%SPX tP+PD4P@F+SPV t$+PvDD D%F+F;~vFu+ vRWvD4FP~DP+PW~)~ @+PvDD F=uVDD t!F~s`FF"PF+SPvF+SPV;FtFFF~DP+PW~)~~wD\%SPD \-%SPX tP+PD4PF+SPV7 t\vvD4P @+PvDD FFDP+PvtFFtttt )X t ttD DFf_^]UVWv~+PvFFFNDP+PPFFDP|vvX tgV$DD tDPWX[%SPD PEX[-%SPX tvvV/ tDPvvD4PD%[ÉF+PvFF:= u ~ tF GFNFFF @DPP}XX9Fs~w9FrVMDD tF^+F^<~u-DPqD PjX tD PDPW]F^ ~vf_^]UVWv~FO _^]Udžpdžn^%t r^%t r^%tFllG% ndžvFFF^? u)džvptF@=|xF FW^? uOntHPv%X+ÉtFt=}WtvxF Ftt uFxFPFF[FNv~} ~tJFHxxPrDD~t$F]UVWv~ v vFF DP+PPFFDPvvX t0V>DD tvvV| tF^+F^ D4PD%[ÉF~^F~u7 DP,D P%vX tD PDPF^+F^ ~ uFDPPXX!GFn^ FDPPXX9Fsv v+PPX tdv v+PPX tDPD PX tD PDPsyF^f_^]UVWv^%t 4P%DD~sFu"+P@PBlƆ uƆP Pl2䉆9s PPk+=u^ +8FPG[N~vwȃ~vF G+Íf_^]UVWv~v vFFDPO+PP=FFDP9X[% uDP"vv[X t'VDD t=vvV t&D4PD%[F%GPFF[n^ DPPXX9Fsv v+PPX uF^ u-DPD PX tD PDPpvF^FVFFv v+PP:FFvv+PPX t!PvvWvvV$FVFPvvDPvv+PPsvv+PPFPevv+PPXZǍDPD PX tD PDPvvvvX t F^+F^ F^ u F^VDD tvvVS tF^+F^ iDPv vD4FGPFF[n^ v v+PPJX u֍DPD P4 X tD PDPF^f_^]UVWF `F bv~ _^]UWV+V Fu أ02.F^ ;wr ;vr+v@60>2^_]UVWvLL2ljF2PP^hO Ff_^]U<P4PXv4PD\P4P54P P hPg]UVWv2FF$+v8Ǔ?$u-^?$t v Pg$PPg@ÉFG;~|Ë9Ft v PgFf_^]ZX[Ww7ZX[)_w7ZX[w7WZX[w7)_UF f؋Ff؋FfډF^ ]F FF2n=uDu&t t =ut u Etu Eut+؉^TV@^ RPFXY؃㓇ҋʋV҃VR ҃R FFufVVVV 3FFFFFߋOOO/ }^FuNfVVVF2n=uDutuEu=ut=tC^5VPF=uDuNu Eu:tV2u Eun=tuD\LE]M;} FNFTVTVTVVF2͈NV+=5vdE]M5r֊͊ߊĴt NuFu%VN^FF tFn^^^^N6V+VN^FsڃVuNJ݊Ίs^4u N6vF^NV t;#y ؃u3u ԊKs]UEË\ݱxT}`LTD| <$ Ċ֊tu"y؃33ҷt"ú"y@Bx"y"t -x@BËD-y-4|D$ \LU ֊͊ߊtEuDt]ENJ݊Ίu ]Mܓ3Dt̀24E3ۉ]]=t Dt]ËDEDEDEÁFsFuFuFF tFFF==|FtN2F4EF^NE] E%-D%-þB RPB BXZB R FFuþRs BuBuBFFGG uËGW/_uF ^VNNNð n3FtM]]ð3UVW؎~*ʋ~OvJsF_^]UVW؎~+ыv~tH@UVW؎~+ыv~t|&]awaawa:t밋W؎6*ыH_UVW؎*~V+ы~vOs\UVW؎+~V+чʋ~vss+UVW؎+~V+ыv~t H@F_^]UVW؎N~vs_^]UVW؎~FNs_^]UVWv؎~F~ ī_^]UVW؎^vN ~s_^]û+VW؎6|*6Du6|OuA_^+_^$@Y@@@@j@.AcAחA7yACyCxDnF\)c=Hsȡ1I=P1PK?O8M20HwZ$gAAI0G`+OI~.G ~0GIJuO=0tG^_ä.G`Ib: Response too longInvalid commanddefaultNumber requiredOut of range (y/n)? Invalid responseOK to lose changespatsizememfullText capacity exceededMax line length reachedSource block marked in some other bufferWaiting for second mark ...No source blockBad targetBad targetNo source blockWindow stack overflow..Press space bar to resume editing ... ..O....B%4d%5d/HELP.EDXhelp.edxrrl:help.edxNo help filerl:lsn.edx@@You're now on Lesson Can't fenestrateDR EDIX Release 1.00 (C)Copyright 1984 Emerging Technology Consultants, Inc.%%%dsFile Bfr Lines Wnd Chg MrkEYrcjkefVDverout is disabledVDscroll - VDsaveonVDscroll: D_LEFT is disabledVDscroll: D_RIGHT is disabledRequires Concurrent DR EDIX cannot be run from external terminal.67CprogramCON:LST:<>.,=:|[]* : unmatched quoteCannot open Cannot append Cannot create : No matchStack Overflow $Raw I/OC RTL - program not linked for Program terminating $ 77@ECopyright (C) 1983, Digital Research, Inc.Serial No. XXXX-0000-654321$؎k>  - X >t 33| {  tutq . tb32u | Ytyu Etu w v w 6w ta 6w iþ 6 X} ~ y (tZu Zzu tI<tCPtJtlv uX+<uX!Uv {t X<t <ttY 6 qÀ>| u >} u~ t+ ?u؎Gugt BtN㋟u &v Pu &v t'y u { # t { l tXu &v 3I{ }  ,tLutQ u w Pta 6w û3s y u { t%Rt<d u @;k w  ` so y 6R{ t u~uItþ 2q{ . Q Q Q Q Qy m( &UP^Xá @;k w, g ȡo @;i wo   2ððáq s ás q o û+ ?u Om  e g q 3Ҋ6e Hi 33ɋG@OPO3YG Hk   þ+ + u X H v 2# ڈA$& W_ t ؎!Fò< )PS7[X u33òmw+ PtP3XË)e2ËkmOËkmgñ-]VmMk&Gq=2s,&Toqm(U&tێێË Ž3S&O[S&g[(ñ ຘ- ?COPYRIGHT(C)1983,84,DIGITAL RESEARCH(05/02/84)XXXX-0000-654321PSQRR&K&ZػC?u3&1GV[3&1SZY[XUVN u)+-/]Z[َѼSRË$22122V72 PEPPPI3>I3u{P_PI3>I3u6 2s2PT>72u2RPA2| 72872u2F2QQd<u92I 22sP2 PP5UPP]UPFP]U Pv]U Pv]UPFP]U PP]UPv]U^G G PS]UPvz]UPvj]UPvZ]U^G G PSA]U!Pv1]UPv!]U$Pv]U PFP]U6$<t]à]U6PvAPFs]UNv~]U333< r@3΋^P u@Y"s"^:t:s333 3뷠3]Y11QU3>1u-31]Á>1vH133;1w}1H=v-3+3^1@-3u]Ã>1vB33;1w21@?v-331/@-3u]U3383wS31Í-P'3Q<tP1PDPB33uP]UFF<vP<t2FF]U3 2"2sf^:2v][P^^?u P^wP^?uP^o!^? t3^ ^ P]3]U11PP]U3>u33:w#À t 3,uƇ 3u33:r@3P t@Y"s3֊3.u 23Ƈ 333>3 wPQ3ÍF2P3u333"3#33u@"3"r u 33P< u@YP[u@Z"Pu@Z"P> 3 r@P>3 r@Z"Z"s@`v{s 333 3öֈF23 3u33< w#3s"3H3[u;3ȱÀF2 u3Ȣ33ƇF2[33#33 2 22283w 3 3< rÀF2[uoU2Cu2 3ÀU2Eu 2.3@ 3ÀU2Nt 3ÀU2Lu  2 2͠ 3ÀU2 u3 3  3s3]U2(3'322$3< s>2u2122'32+222QP 2'3rn2À-$u'32Ê.:$3t(3r(32P%3>$3u'3sqP2PP]>$3v?222PPt2P2H[.:.tٸ2PPM2)2>$3w '3sP2P%3Pw21u2Pj%3 PE%3>%3 w%3Ƈ)3 %3u63$ P2Í-P)3PP)3P22Ê.:$3s'32P622(3s2P%3PP]U;38393<3 2@:3>92uS73 73ÀF2 u7373,273ÍF2P2ÍF2P:32ÊU2=3>:3t >92t>92u2ƇU2 83Њ93"r 2À-$u28.t2ƍF2P-P":3>:3t P 2Í-P2ÍF2P22<3s 2>3<32<wÀF2 tF2[u ;383? 2PP;3-<3s 2Ê>3:.r93 2PP;3sX 2@1P 2Í.PP/P 2Í.@PP 2Ê.2.2>92u2Ê=3U29393]U?3?3:Fr@2"sE2P22s@3@3:?3w PY@3u?3ÍF2PB?3]U P622s 2P!22sP<tPe2P P2]D3D3Ѡ2"PQG<t@Y"sѠ2ȢA3A3A3<v@D3"rA3C3<u2B3D3Њ2"P>B3r@A3P/t@Y"Y"s%B3S!A3B3˷SA3[E3먀>B3uD3 B3ƇE3$2ЊD3"s6>C3 u 2s 2P26C3>B3vE3PB3 2UP!PHP2PH3"P HPƇ2)H3>H3t 2s2PbH3]Ìi3g3&e3R]&6h&\ L3Z(d3&CSQS[Y< u< t<u t͠(b3V<u<u t&K<u QSd3<u[d3:(s(<u[&e3g3b<u7Q}Y[SQ tC&QS:[YSb3 t*(b3Fb3u<u؎(:sC&QS[Y-C& [&/i3 i3g3G&e3á_3 u Q8Y Qѱ,Yá_3 t>a3t ua3Êa3_3 ua3_3< t< t < t<t< t0<u _3t<u<u _3`<u3_3ã_3b3ud<t(< s(t<u(< u(Êxs P^Y@ u ($u  #(:d3s  zQYË<$tAQY! ERROR: $ $Reading file HELP.HLP.$ Press RETURN to continue $ $ $ Topics available:$ For more information, type a period and one of the following subtopics:$ $ $ $Reading file HELP.HLP.$ HELP (Enter topic, ESC to exit)> $HELP HLP HELP UTILITY V2.0 At "HELP (Enter topic, ESC to exit)> " enter topic {,subtopic}... EXAMPLE: HELP (Enter topic, ESC to exit)> DIR EXAMPLES $? HELP HELP Topic:$Not found$No HELP.HLP file on the default drive.$ This program cannot be run from a menu from the Serial Terminal.$ DATE OF LAST CHANGE 05 NOV 87 Requires Concurrent $#Concurrent Disk Maintenance Program* DSKMAINT cannot run in the background. DSKMAINT $I O ` #U Main Menuf S E L E C T F U N C T I O N F3  $ F5  $ F7 $  Verify a diskette" Copy from one Diskette to another Format Diskettes  DATE OF LAST CHANGE 05 NOV 87  w G I N S E R T A N D S E L E C T D I S K E T T E T O V E R I F Y G I N S E R T A N D S E L E C T S O U R C E D I S K E T T E GI N S E R T A N D S E L E C T  D E S T I N A T I O N D I S K E T T E# Verify a Diskette # Copy from one Diskette to another    F2  $  A: F4  $  B:F6 $  C:F8 $  D: & 9Source and destination diskettes are not of the same typeg &Could not lock drives - already in use C   B A D D I S K  Press any key to return to Menu C C - Z  Z  %Copying from the Diskette in Drive :3 % to the Diskette in Drive : ` <This will erase data on the destination diskette in drive :  )Is this what you want to do (Y or N)s?t C ,INSERT DESTINATION DISKETTE AND TYPE ANY KEY, INSERT SOURCE DISKETTE AND TYPE ANY KEY GNT  .Z  Reading track  Writing track  Checking track Verifying Diskette in Drive :C - 3The source and destination diskettes are different. =Do you want to format the destination diskette (Y or N) s?t^C - hn*The destination diskette is not formatted. DATE OF LAST CHANGE 05 NOV 87 ! E =;da  #A_} (P(js' PP=Pj'(P[('PPzP'(P(js'PP=Pj'TjO PjO$ljO      @h  p  ` :p x@ $&BX!'J-Format Diskette in Drive :PG S E L E C T T Y P E O F D I S K E T T E T O F O R M A T    F3  $ F5  $= F5  $[F7 $[F9 $zF7 $ F3  $ F5  $ DOS single sided, 9 sectors DOS double sided, 9 sectors CP/M single sided, 8 sectors CP/M double sided, 8 sectors DOS hyper (1.2Mb) DOS 720Kb 3.5" Disk DOS 1.44Mb 3.5" Disk# Format diskettes B S E L E C T F O R M A T D R I V E # Format a Single Sided Diskette # Format a Double Sided Diskette #Formatting the Diskette in Drive :Formatting track Formatting Diskette in Drive :Ȏ؎м|-Q|Q|s S|u.O|T|+u *** Error while reading Loader *** Try another diskette. Ȏ؎м<:<4%:<4Otu@O.@u=6<,>tt >AE#.E ð.]AuSQ+gY[CCNJN@%!E E CN JIAN@Q6:>A>Yt A Ë.+6G+E0E+&>}u.02ËGG6E tG 8Ë6:D nul8؎..4K&263N G:IuâI<(rO*CJrôKu ôtx&z.|-@|**IF{|P^}w}w++QR|CCPM SYSDOSPLUS SYS^> |9 t}t~ts@;tX}> |AQ6|@@P>"|AV}&|+$|XZYP.|ݱSx[+Q|&|Y.&|XHPu* LoadingCCPM SYSDOSPLUS SYSUse another boot disk CCPM.SYS not 1st file *P|Xsu CCPM.SYS read error |26(|uŰ.ìtDSKMAINT FORMAT DATE OF LAST CHANGE 05 NOV 87 E a 255N PĿ --I hl F1 w HELP     (ESC2 Exit this program (ESC2 Go back to previous menu(ESC2 Stop current operation +HELP STRING NOT INITIALIZED $ DATE OF LAST CHANGE 05 NOV 87 MXdisk DATE OF LAST CHANGE 05 NOV 87 Yw6fE Eqt7evsttpqru ef -VCMXQ@ HELP FACILITY TAKES OVER AT THIS POINT. PRESS ANY KEY TO GET BACK TO PROGRAM. $E$ Printer Busy $&.2ұn-N% ࢵ&G> udXш&& ôP!3 ࢳд!T!!2ㆠ3+u ub t/<+tHu^GtG3Ҡ.!3|uVGOr dursuy  6苯2PVZ CP/M V1.35 6/12/85 SMALL Model CLEAR library. Copyright 1983-1985 Digital Research.$UWVVNT-*^_]+ێOsZero divide error$XYZ+^gVDRQSVRSSSP6 [ZB;v' Stack overflow. $+RSñ uPPt<v.A.ÃԱi@t+ P X"r.t " t 5 t 5t+Ɉ..%Ë-++Ë6_Cr Ë6_+́;s;rùË-UPPPe+]You must link with LINK86 V1.2 or later. $66 UVWv v~v2f_^]Y[ڎ^6-6'6!6666 6SV++4,S$p{ȳ+^t&u+[+u@fU+PPFFPPv+Pgh~t&~tvqDD=u PDDPDDvv=]U\uvˢDD]Uj2Ph2P+PPPPj vDD]UƆz PDD @NP{PP u n$u+PPzPPxxtxuxutP PƆz PHPzP+QFP Pe @ppP PKƆz {PqjDDvvtmKQ vv7]UFPrtDD t(F^F2F2-2䓠2㢐 tP̣DDPãDD2PDD2PDDFF>F*FPF[FFPFf@[F2;FF2;FFFN FPR^ [2f;F~)~uFF FPFN=} .[FF2;F FPR^[=>F2HCDvv`bPDD]U~u PiDDvPPF% t +PPePDDF% t5F% t PDD]UFHP>fDD t#JPv4DDP+Pv@B]UP F^?uv _2-@[F9Fu^2PDD~} v [vmDD]BP`P UOF@>Bu(H؃?uء2BPDDP@2P]+PPPDD PnDDU FPlPPnPP@DDP4DDP(DDPDD|PbDDqPWDDfPLDD[PADDPPDDE+D?F2@v @2P_DD@P DDP@2P @h>@w@P@2;~@[ u@2FF@oFHB؋FEP DDFB>D tcL+PDD(^GP2P2<t<t<tF=t=t=u|@2FBF@2H@؋GF@2H@؋F^ tF9F}|F9FtP@2PP @2HFB؋FBvFPPPF>؋ЃF u^GPv@R t^GPveF~uFF9F~6FF~tv4DDB>LPDDPvPPmF~~@P9F@[# tN tBd0%hP2P"2<t<t<tF=t=t=tB=uB=u#=u]UH>FYF|F|FrFoFgF_FWFOFFBFF5= t= t= t=t=t=t=t=t=ut뾃~tHvFP˃ PFPʃF t^vFPʃvFPʃFFvYDD]UF2HPP=t@]Ux u~ZP褚DDbP蛚DD`P蒚DD^P艚DDFFx7pDDFv9FrxP\DDFF|7CDDFz9Fr|P/DDPH DDx@P9 DD|v PvPzP|PxPF2PF2PBvvPDD^vPDD`vPDDbvPDDZFF^PFx؋[Fv9Frٸ PvPxP PzP|P0x]U F@FFFFFF~}FF2%F< u֋F F^? t FF.FFFFPFF2%[FF~| FF FF= |^]U^F2PDD+IGFPvF2 [~t' FPF@P u ~t+CtPPvPFItPF[؊:FttPF[G tPF[@PQPǃ~t%CutPF[؊G2%@t+E t#GF P PDD[NG IFPvDD[NINPtPF[P~uGEt=~utPF[PLLPv`]PNPƃvF2 [vPF~t F9I}CuPF@PƃvF2 [vPyFdžGtPF[G tPF[؊G2%@tu Pv Pv+]Uvv vPF&Pv~t@]Uvv  vP5F&Pv\~t@]UvPFPF@P)~t@]U^FG!^G#{PPv!PFPF@P~u@]UvP~vPqFPF@P~u@]UvP>vP1FPF@PV~u@]U 9|h  tmFFF vvJ u FFF9F|ظF > u2]U^F~}+FFFFFv@DDF"FF/-FFPF[FF= t= t=t=tӃ~u FH;F^F~u ~t+ ^]+PP@øP PUF2P P]U*FPv ~tF2 FF2 FFPPmF׸Pv~t@]UVW&G@_^]UlRvvbqR]UURvviZR]U6cvv/j]-Ra;R#Ri1RøP-P+P-PUvDDF uP6 DDPDDF]Uv&DD@PDDFvvmF]UvDDPvDD[;t+ydFFF PF2[؊2%t F2-aAF2P PF2[؊2%t F2-aAF2[;t+FFF u]UF +F~ rv vvF +P^;F }^7F0[^^+]U^HF^~},F؉F^;F}^-^^+ vvvvFF^F]U ^G F^GFFFFFF9F|^G ]UvDD^G FFFF؋HFFF9F|ۋ^FG ]U ~PKDD PvPxPFPhDDF uPDDF*FFPFF؋Hx؋[FF9F|θ PvPxPFWFF؋FFFv9FsFx؋;Fuv9FrFFFPF@[FF9F|v腍DD]á -UF~th2PHDD2PHDDoN;PPJPDD;PPqJPDD~|;PFPQJPDD4Nvv]U P:]DD[Ɔfr~u  tPrP耼PrPoPrP` GPrPMrPDDP 2[;~+rP 2[PPrP 2[dž  t]P PvOfPPPq t't6PfP賻:PfP袻L+PPL\rP\DD +PP*\fP\DD PP\P\DD|'1 2-PP[P\DD P+P[PXFDD PP[PBFDD P+PXHP,FDD PP[PFDD+PPw[#L P+PHPEDD+PPR[PP 2Pv[ 2@PPGPEDD+PPGPEDD+PP[P 2P [~t PPZPgEDDvKS]UFFFFFFFF t~ t ~,t~ rϋ^F]UF*F^PFF؋Hx؋[FF9F|΋]U@$PFPxv FPe~t,~~FPvvvFPDDv^[^]UvvPF^  2PPPv]Uvvv]UFP0YDD=>F2HCD E?RGA459;]U@F=P^GP uPFP=^GPFP,j^G2PPPFP]U=Z,ZvZDDZtQ]UvDD ZHPFHPvZFG{ZF]UvDDY}CF PF2[؊2%t F2-aAF2F0ZF2]UYYvQYDDXPHYDDYPHPFP$ZY]U F2PCDDFFF u]U2PBDD2PtBDD+PPQD)H FvDD/H]UZPDD+PP&DGPDD~t*PPDvdDD PPCvODDG]UVPPvFP@PPvFPFP]UVW~@+FHlj~F;}&vFF7F7# ~O;~&vFF7F7 };}8F؋FFPF؋[F؋F;}cF؋FFPFF؋[FF؋FFH+;~+vVvvFH+P@FP)vFH+P@FPvVvf_^]UF ~F\vPZP]UFFFPFF[FF9F|]\UFFPFF[^?u]U FFFFFPPZ܃=tPF@Po t+F^^G F]U&FFFړ?*u PFPvڍFPⳃ vFPٳFPAP/vv]U~t~u,vEDDPvP^ GP|P u+|P^ GP|- t+]Uv vvv t+F]U^ GPDDF]UFF^;FuFFF2;F+]U~tvDDⓡ ]U~~FHPvDPDDv DDvDDFv,DD t7]UPv@\PvF t5F^?t*vvFNN^?:t F^]U.+P4DDFFFҸl PFPo t8'FFPFF7FP0 t F~|ӍFPDDj2P]UTvFP^HPD u@[G NP^GPFP:^GPFP^GPFP]U^GF^^GPv Pv^GP^G[7vЯ]U^F^ t+^GPFHP\DF tv2DDvDD5v[Gv2[G^GP^GPvvv;DD]U FGFjvDD PDD]U^F^tvF PC u PDDFHPWCDDF^G;Ft9^FG^t ^GvF PCvDD+]U FvDD tY^tvF PjC ttP4 PEPPnFL t F14 \P?IB;4-&F=t=t=t=t=t=t=tvDD+]U` F G F GF  P`DD+ GFPDD PzDD^FFvvvF@PF tvFH[FH;Ft@,~u+!^G4 HF+ PHP4PZPP  PDDPP  PPF^Fvv tv`DDv P^ ^xGvDD^qP@PvPUPPvP8PPd~t1 PFP,P^ tFPv: t+ PDDPP~tЃ uNF'F#PhPiЃ tFF#9F}~uˍhPDD$P%P u džFvDDvDD~tJ GPPvPDDPDP΃ uL%PDDdžF PDP΃PDPPσPPHփF6F#PDPσ uFl%PyDDdž FF9F|DPDDFhPDDF~ttJPv$PՃ~t%PDDvDDvDDFv P udžuP^$PoՃPDDPh$PUՃ~u$PDD PDD`vvv  t+F#GPPґ#GPP近PPԃ~tP#%P|DD#P ]DD# tF GPFF؋H[7FPԃFF~ u%PP0$PlPPPFPlP"PP4PlPFf2FPFPlPEփ uF>uzA~:u&FF2-@FP=DDjjGFFP芎DD= ~@F PFFPFP FFPFPHك t~t<PFP ׃F~u( $P/DDFFPFF؋[FFPFPXF9Fu PP-##F viDD##PDD~t)v vvFPvvFPyF t+F tFFPFF؋[FF9Fu#FF9F} ~u"FFPFF؋[FFF9F|֡#P\DD6$Pvvv҃F]UFfvDDFPDDd]Uv DDP^GP˃F t%~tF^GP2[;~2+]U F&FFhfҸ&PDDPvʃ~t##Pvv^҃F$PPԃf2HPDD u frPDD&~~ &9F}+Pvvvv BFF4$PP0Pփ&PDDFFPDDFPDDFPwDDFPfDD _2-@Fɸ,&PDD+P&PFP[ tv)DDFFѸ$PPӃoFhFPDDWFPDDFF =ɡ PDDd-&P DD+P&PdPF uF1Ѹ$PPӃFPHPvvv+ +$PP迴2P˸DD t+&P_DD=t=t= t= uE=u==u$=u=u=u=u=ux=up=uW=uO=u6=u.=u=u =u=?u=u>5]UdžX+FFFZ>ty GPFF؋H[؋FPFP΃PP.&PFPPPFPFP0PP4PFP PFPFPbЃF+~u~:unD&PDDZPFPӃ u<PFPуnpFPFPƒ t?džXFFF׉F`&PvEӃ FFFFFF uFFPFF؋[FFFPFF؋[FFF9F}8&Pvvv̓Xt vvȃF]U^ G PvvH΃v vvv,]UF~LP&Pf&P΃&P&P  t%FFFF؋HF GPF[7'DD u"FFPFF؋[FwF.vFF* GPF[P GPF@[؋[Fv9FrF$FF؋H;F~FF؃/FF9F|FF9F}-&PvvvŨԱ~t vveǃ~~vvЃыFFF]U^ G Pvṽvvvw]ø(P(PUv vvv!ӃF0F]U.PvF t+Fvvă tFFF u+]UV(PFP鄃)PFPՄFPgDD]U.Pv| u4)Pva uƆx ƆyvxP聄^?t(PxPjvxP\$B)Pv  t$PPxPvcvu@F!Pv߃ txPMDDF&PPxPvvu@+]UvF[PPǫ vDDF~u +PP觫PP蚫^ ~t(~utP Pz~uP Pf~tPPRF]UXbF2A)vFP(Pv)Pv )PvFPv䂃vvvF]"%U (Pv諂*^PHPvF^ vv腂!Pv:F u¡PPo~u@]U GP^H[7FPȃ4)PFP u(PFP: t+F]U^) t+ tf)PT)Pb)PT)P豁+]+D@F@HBD>JL2䣽U@DP@RBN>TV2䣽fF]U FFSFF؋HFv GPF[7k u FFPFF؋[FFF9F|)Pvvv;ǃF]Urfdr2PDDF^ t^ u+P>ru@[ tF9 u j)PDD+wvDD+PPvvv F uR^ G PvvNǃf2P^DD+PcDDPvvvFh2P5DDj2P7DDF]U^ G PvvƃPvvvv]U^ G Pvvƃ+PvvvK]Uv vvv@̓]        UZ~ Q~F QF FFPFPv誼 tYFPv 謾 uHv v vvv ^P*DDFP^[vFP@DD[G^F]UF^F t~ tF]U ^7DDFFF fPF2-0[ÉFFF^F t ~0r~9v˃~t^F^FF]U^FF^FFFFFF~=tF~Q} ^F u֋^~=t+>F-FP+PF[7S t^FF@ F<+9F|+]UvDDFPvcփF^G]UdžkiPyPtPrPo|v{oPGDD u S|<r|P|2HPo tPPlP P`nPPR*PFPi u(r2PDD+PDD*PFPD umu|FuowPuP tw QwPuP tw 3wPuP tw wPuP~ tw wPuP` tw wPuPB tw wPuP$ tw wPuP tw wPuP tw awPuP tw CwPuP tw %wPuP tw wPuPp tw wPuPR tw wPuP4 twwPuP twuPkDD=t=t=t=ud=u>=u=u=u=u=u=uZ=u4=u=u=u=u=udžmQmPFPFP肷 tZFPߵDDyyPDD  qdžwwP DD uqPPw[؋[GqPw@[qPPwX#i t@[G t qGqP{2[GqGqP2[GqP[G P_DDsqsG>+PsPxOP8DDsqsG P DDsqsG PDDsqsGqww}  芤贷PȷDDP輷DD2䣽P褷DDF@FP萷DDHBFP|DDD>FPhDDJ}PSDDLdžwvPw[؋G[vPw[؋G[GFFFPPw[؋[FFPPw[؋[}}PPw[؋G[PPw[؋G [w2;w~G2PxDDPF2PeDDRF2PRDDNF2P?DDT}2P+DDVdžwvPw[؋G[vPw[؋G[GFFFPPw[؋[FFPPw[؋[}}PPw[؋G[PPw[؋G [w2;w~GD t +PPPPr{2PLDD|2PDDl2PPQn2PPA|2PDD֋]UN~u^FFPFF[ u]UFPP胝B+'F2䓡p+؊:B+uD+PF2[؊B+FF2䓡p+؀?uɠB+2]øPP1øP&DD u@| | P DDU| tF2PP]s G<"øEPDDU졆 t PF2[؊2P^DD PF2[؊2PFDD]U졀 u~ PF2[؊2PcDD]U졀 u~ PF2[؊2PDD]Uvt+[vr+[]á t  .T  },wrmhc2V?2IB)2t+tt+"r+@;+rãr+d U~VW^]_VLPF+F+\|+O,|+Fr+Ft+믡t+@;+rt+à|+ t~+ ++ à|+ t ++ ~+̀}+++ LF$++:+tu +++ +++'F$++:+t u+++ +++Vr+Ft+N ^ 3FVr+Ft+N ^ 1؎FVr+Ft+N ^ ,+<ux++Ë.3r+t+x+‹++r+r+t+#It Bx+‹r+t+SQ++ȋ+bY[>x+SU+MBnu]SU+Px+XGBnu]SU+Px+X;Bnu]PQ.9&+ YXPQ.9 YXPQ.0 YXZ +7 fF+ 5 e/òY)r+ *t+ !76RZRZëí@ `@ ` @ `+PP&=`|@U FPPv+P+PFPPv+P+PFv+FFPFPFPFPJ]áv+P+PD+áv+PP/+á+ t v+P+Pá+ tv+PPU; u+P P[+PPQF FF2P^2[ãz++PP#v+x+PPv+P+PFP,Pv+P+P~t@]U u+P P̕+PP•F FF2P^2[ãz++PP蔕v+x+]UVW^^^ ^S^X^^^ _^]UVW&^F^&^&_^]UVWVF^ F=u&&_^]UVWNV_؋F=t &G4 &G4q tfu q IfD=u =tS6[ 6   ע ע a> rp.  > u s u  SWB+yJMt%u @Bu 3'Pû Xt_V< u0^[ÅuO= t G03GG G23xà  } uE 0E:á 3ɃK  } uE 0E-E --3ҋ-<r @+ȋ3һm uHmP3۹ ; vSKƋσuu @;uB+ XYRZÉ x w Ëx gx g x 'x gx gx gx gx g x g x gx gx g x W É x W É x W É x W Ë FFÏ Р X& UWV^_]P3& 3r+t+  UVWR_^]>Y u >Y uUWV&t+r+@^_]UWV>  t 1x ^_]> & t1Uã WSގƾd <u[_2K> t + ø FFsPRUVыSrC+ӃuRPP9 tyX> 8& t 2& t;6 u &; t'. t3& &. t3q &׊YQR> Ou@tQ+ZY_^]ZXR > & uZ_ZS > Pr  > r  tWS&u( & 6$ o$ [_&&Pt ެ؊ (( & X 'ˈ& 2& t1W_UVWF9 < r 0C0P4 4 u9 4 uX #4 uU R,XPL1 u" б4 t,ߎǿd 6 =PCu&Y  u ǎg02 Awt &&6  t02 Awǎ߻d t 'Ș؋ t t ؊ " >X u P4 XPx >Y t=p+Z+X+˸+;tXP؎X󤿲 * mX_^]?Rӱ[u? u uøðâ   > ENM G C.C.C 󪱜G&_.t^2䠌 &tM& &OtSQY Q  u\O:O A3Ë E2 Ӄ N;t'  t;s!È O;u;s!.O;s!\ȋ +È ( t > t+ t^GPDD ^GPDDPDD]U$PF[G$_"$G=u $G $G& u $P [G&$G( u $PP [G( PF2PP]U^G ubv& DD^G2P^G2P^G u*F^G%2PADDF^G28Fr-^G!2PDDF^G%2P DDF^G28Fr^G"2PDDFq^G2P^G2PF2XP^G&2PDD^G2P^G2XHP^G2PF2XP^G'2PwDDF^G 28Fv^G2P^G2P^G2XHPd^G#2P3DDF^G(2PDDF^G28Fr^G$2PDD]U^G tYvDD^G 2P^G2P^G2P^G2P^G2^GG2+PPv]U^G^GvDDvyDD]U^GF^G FF^GF~t^GPF2X t+ t"v^GPF2XPF2X[GvF2[)GF^GP^G[;~vF2[GF^GP^GP^G2X[;ЋF tY^GPF2HXPF2XPF2XP^G2X+ÉF^G;F~ ^FGF tvDD]U^GF^GF^G FvDD^G u^G+Pv^G uQ^GF t ^G P^GPXF t'^G 2P^G 2Pv0vv8F t^G2䓋FÉF*^GP^G2[;} ^GP ^G2PXFFFc+PPvvv ^G t^GPFX؋ t+ t"F+FP^GPFX7vfFF9F|^G9F} ^GP^GPXF u(^G2P^G2Pv,vFP3]U^GF^G F^GFF Fv7DD^G* tl^G*PF HX؋F tR^GPDDvDDvF2PvFF vDD^G tv^G DDvDDF u vv ]U"^GF^GF^G F^G^G(FGFF^G u"^GFPvF2PvF. vDD^GF^G u^GPv~u+ +Pv ~u vDD+ +Pv ^G"FPbPDDFF FF^GF^_F+ÉFF t FFF v!DDFFF t!^GPFHX7ODD8Ft+ u^G t^G P^G XPF[^G=u ^G =^G PFHX؋ t@ t^G PFHXF +Pv vvF2PvOF u^GPv FF u F t+ tFFNF2䓋F؊FF tF t F t+ u+ u"F2F2䓋FP PF2X؊2% t. PF2X؊2% tF2-aAPF2PF2PX[^G$28FrNF2䓋FvFPvF ubF9FuF2Pvj F2PvvdF t(FFF@PFPv t@ tF 'F uF u^GPv +FFF2P^G9FuPF@PvF^G=u^G vDD+e^G PFHX؋ uN^G PFHX^G t^G P^G XPF[F +Pv] 4F~u'~~F29F~ F2)F NF2Pvv FF2P~u ^GPFHPvF^G9Fu~F2Fv^G[;j^GP^G2XP^G[;}H^GPvv^G[GPv8vF2䓋F+[G+PvQ(FF2Pvv)F t0NF<u^<uFFNF2Pv^G=~^G PFHX؋ t+ u^G PFHXF +Pv^G upFF^G9F}^G PFX؋;Ft+ u*^G PFXP^G PF@X؋[F^GH9F|~uFF2PPv^G9FuFF2P^GPv^GPv+^GPv^GPv^G t)F^G PFXF^G9F|ދ^G vDDDFF2PPv-^G=u^GPvF tvDDv:DDـ~t ~t+ tF~t ~t+ t vDDNF2F2䓋FPF2[F2䓋F+PPv8 vv= vDDF< u$~,uF2PX t+ t+ t3~,u@F5؊F u^FfFFFFFP PF2X؊2% t. PF2X؊2% tF2-aAPF2PF2PX[FF29F|Fb^G PFHX؋ uK^G PFHX^G t^G P^G XPF[F ^FGvFPvdF uvDDvDDFF2P^GPvF t2vvF2PvjF u^GPvFF2=*ui=u=u=u=u=ux=uM=u5= uu=uC= u=,ua= u-=u= u= uF2䓋FQ]U^GFGPv^FGPv+PvF2Pv]U0^G9F|+^G"FP.FDDFvF2[F^<u@F tF~u ^F@VC^GPFX؋Fո PF2X؊2% t0 PF2X؊2% tF2-aAPF2PXFՋF u^28Ft+ u~uF@ P^GPFX7PF2X+ÓXPFP΃FP&EDDFF PFPF2X؊2X؊2% ubFPF2XP PFPF2X؊2X؊2% tFPF2X؊2-aAPFPF2X؊2PX[F؊F28FsgF uF2@PF2X+ÈFFIF2PFPF2XPF2HFPD uvF2䓊F2H[F@Fظ PF2X+8F},FPF2䓊F2PF2X+2X؊ t+ tp F2HPFPF@P2D uF@F^G9F}+]U^GF^GF^G F^G uҋ^GHF^GFF t F+FPF+FPXFvDDF u/^G F2P^GF2Pv vDDF t^G=u+PF u^G=u+Pvvv ]U^GF^GF^G Fҋ^G(FGFP DD^G F+PPvF t}^GP^GHX؋FP=BDDPF2X+ÈFv!DDF2PvvvDD^G F^G FF2PF2䓋FPv^G& t^G&Pv^G tRF u^GP^GH X7v-Pv^GP^GHX7v^G 2P^G2[;s^G2P^G 2X+Pv F tF2PF2Pv8vZ DD]U^GF^GF^G F^GF^G Fz t ~~+ u | t^G t+ u+F^G PF+FX؊2@P^GPF+FX؊2PvF tF tz u ~u+ t+ th~u&~u^GPF@[;u+ t+ u+~~^G PFX؋ t+ u+ u+ t+ tvDDFF t PvVF^GPP^G u vX t+ t ^G2HHP ^G2P^G9F| -P^GPFX7v F tvDD]U^Gz t<Pv]UvF2[G vF2[G ^G2F^G2F^G 28Fs^G28Fs+ t(^G2䓊F2P^G2䓊F2P)˃]U^Gz t>Pv <]Uv, DDFF2PvFF28Frv DD]UF uvvv*DD^G 2P^G2XP^G 2[;rF t'F tv=DDF;F}+ t+ t"F2䓋F+FPvQ F2)FW^ t:^G 2P^G2XP^G2[;sFF2PvF t PvFN u(v.+lDⓋP[;uVG[GVD[GV[V[EⓋ;uWD[GWE[GW[5>.+_^]UVWvVDDFH+@FP3DDF u+R^;t8;s GP[N~uFNjF OPN[N~uvvf_^]V+Z-P [PDDF|^UVWvdž~u]džFFF^?t^?%u郾~vPv FFFF?%tdžFFF<-uFFFF ~0uFFFFFdž~*uv^FFF>0}dž PF2-0[ÉFFF~0r~9vĿ~.u+FFF~*uv^ǃFFF. PF2-0[ÉNjFFF~0r~9vdž~lt~LuFFFFt PP PPV tt P+P PPVO tt P+PPPV tPt P+PPPV tv^Fv^2䈆ƆF2PWPVF2PWPV^F2PWPVvvF2PH/zF2u<DP\X+ÉF ~-vDPPp9~tL*.V-HD%t|tD%tDDPDؙRPPDVD[G+f_^]UVvDD u]~u+S% t*. V-9%tvvV#%tvvV vvV^]UVW=uzV7DD .P[؋ǃ~u D-Pv% u BJ-Pv  u )PvV t*.#V- _^]U+Pvv^]U+PvvJ]UPvv5]UVvDD u+ % t@^]UVvDD u+%^]UvDD tD-+]UVvdDD u*. V-]DPvvbDPvvSD Pv~DDSPDPD Pvv)*.V-BF =t=t=tׁ$DP+PPX t DPPPDPX[^]UPHPPv(]UVWv .PF[؋FFWV  t*.V-}t vE[G~u$?P@PZ t*.V-^G2P DDF~u WPl>~u^%tEWvK>F~u%^% uE %tWFP>v^G2P ~u*.V-*~t~uF~+*.V-f_^]UVWF F v~_^]Z[w7ZYX[GZ[YX[SPZ[YX+[SPUF UFF 3FFF tVV FV FtVVFV F Fu3FFFFVV VVQvvvvYYs$QvvvvOYYYF^VV VVFu"F^Ft ]YSPF^ZX[؃SPZ[YX;[u;uPZ[YX;[u;u+PUN ;N|N;Nwr4F ]+׸ҸYXZ[WYXZ[)WYXZ[!!WYXZ[  WYXZ[11WZYX['WZYX[oZYX[QSPZX[YSPQ X[YZSPRQ& UWV+V Fu أ...F^ ;wr ;vr+v@6.>.^_]UVWvFtt+PPvXZF+Pvt tX tpVVDD tD\%SPD \-%SPX tP+PD4P>F+SPV[ t$+PvDD D%F+F;~vFu+ vRWvD4FP~DP+PWO~)~ @+PvDD F=uV~DD t!F~s`FF"PF+SPvF+SPV;Ft*.V-FFF~DP+PW~)~~wD\%SPD \-%SPSX tP+PD4PF+SPV  t\vvD4P @+PvDD FFDP+Pv'FFtttt X t ttD DFf_^]UVWv~+PvFFFNDPE+PPFFDP/vvhX tgVDD tDP X[%SPD PX[-%SPhX tvvV tDPvvD4PD%[ÉF+PvFF:= u ~ tF GFNFFF @DPPXX9Fs~w9FrV#DD tF^+F^<~u-DP$D PnX tD PDP F^ ~vf_^]UVWv~FO _^]UFFF^G2PDDFF:v P97F0Pvv+PP@vv +P@PX t,.%`u~~n,.% t,vv +PPX t +۸SPF ^SPXZF*vv +PPkX t +۸SPF ^SPXZFFv,P6FPv6F~t;~~ ,.% t  F FFFPFRP%FFPFRPF PFRPFPFRPFF vv +PPX tv^G2P]~t P,P5F^]UVWv%@t?"P+P@PD4PDPV-SP+P@P1X t*.V-$+_^]UVWv!P+P@PD4PvvVSP+P@PX t *.V-DPvv$+_^]UVWv P+Pv] P PF@PK PFPVIƀ<:u,FPvt=u PFPFPƀ<*uP?PF@P FPF@PFP<.uC PFPFPƀ<*uP?PF P FPF PFPS<;u) PFPFPƸPFPFP%+2< t< t<tf_^]UVWv~4GPD2P DDFDP#P0vD2P%D0P+PPX[-F^%uvv+PPRX uDPvvX t-vDD tvvV tDPvv+PP7{D4ǍFG;~s=uDPD4+ÙRP DP+PPCCDPF^SP+PP"DPD P X tDPD PD PDP DPX[f_^]UVWvLL2ljF2PPV/O Ff_^]UVWv2FF$+v8Ǔ?$u-^?$t v P/$PP.@ÉFG;~|Ë9Ft v P.Ff_^]ÃF FF2n=uDu&t t =ut u Etu Eut+؉^TV@^ RPFXY؃㓇ҋʋV҃VR ҃R FFufVVVV 3FFFFFߋOOO/ }^FuNfVVVF2n=uDutuEu=ut=tC^5VPF=uDuNu   Eu:tV2u Eun=tuD\LE]M;} FNFTVTVTVVF2͈NV+=5vdE]M5r֊͊ߊĴt NuFu%VN^FF tFn^^^^N6V+VN^FsڃVuNJ݊Ίs^4u N6vF^NV t;#y ؃u3u ԊKs]UEË\ݱxT}`LTD| <$ Ċ֊tu"y؃33ҷt"ú"y@Bx"y"t -x@BËD-y-4|D$ \LU ֊͊ߊtEuDt]ENJ݊Ίu ]Mܓ3Dt̀24E3ۉ]]=t Dt]ËDEDEDEÁFsFuFuFF tFFF==|FtN2F4EF^NE] E%-D%-þB RPB BXZB R FFuþRs BuBuBFFGG uËGW/_uF ^VNNNð n3FtM]]ð3ZX[Ww7ZX[)_w7ZX[w7WZX[w7)_+VW؎6|*6Du6|OuA_^+_^úUVW؎~*ʋ~OvJsF_^]UVW؎~+ыv~tH@UVW؎~+ыv~t|&]awaawa:t밋W؎6*ыH_UVW؎*~V+ы~vOs\UVW؎+~V+ʋ~vss+UVW؎+~V+ыv~t H@F_^]UVW؎N~vs_^]UVW؎~FNs_^]UVWv؎~F~ ī_^]UVW؎^vN ~s_^]$@Y@@@@j@.AcAחA7yACyCxDnF\)c=Hsȡ1I=P1PK?O8M20HwZ$gAAI0G +OI~.G ~0GIJuO=0tG^_ä.G I Enter one or more Concurrent command lines; ESC returns to the File Manager.S O R T I N G ...READING DIRECTORY... (Press ENTER):*HELPn@n@>n@>(5BO\iv,9FS`mz csBB~v <!I#xPq_PH((X((4(;(vF|F) F)&^4iT)r!:)L:z)z)Q!))Zg)  <  )B s Q F)n&:;Q;|?ALIQRSS.VH&H&H&VVWXXXH&H&H&H&H&H& `(|D$@\x <Xt ERROR: Cannot read disk!Read only diskPhysical disk error Press Esc to Return to File Manager $A>$Insufficient Memory $File not found $Out of Memory DOSCP/M Media| You are here  DIR #1Subset of files = Main1 2 FILEMANAGER These files were MBk*.*HELP.CMDToo many files selectedChange DirectoryHelpView FilesSet Directory 1Set Directory 2Make DirectoryRemove DirectorySelect the highlighted directoryon changing directorieson the highlighted directoryto the highlighted directoryto the highlighted directoryEnter the name of a new onedelete the highlighted directoryChange DriveHelpView FilesSelect the highlighted driveon changing driveson the highlighted driveYou can only delete subdirectoriesDIR #1 set to: Enter a new directory name: No Space, try another diskDirectory not emptyFiles on ...\\ You are here Subdirectories . . . Dir above You are here Subdirectories . . . Select a directoryn@Error on drive USER.TXTSelect a driven@n@ *.*This command requires DOS mediaInvalid pathCannot change directoryInclude ? or *, 12 characters max.Enter wildcard (? matches any character, *.* matches all): Press return for next pagePress return to type Last page of Press any key to quitTyping NOT typed Printing, Press ANY KEY to stop printingPrinter not availableNOT PRINTED HelpCopy to A:Copy to B:Copy to C:Copy to D:Copy to DriveCopy to Dir #1Copy to Dir #2Copy to DirCopy to New Nameon duplicating filesyour selected filesyour selected filesyour selected filesyour selected filesfor drives other than A: - D:first set Dir #1first set Dir #2select destination directorycopy the file, but give it a new nameCOPYTMP.$$$>>> CHOOSE A DESTINATION FOR THE FILES SHOWN BELOW >>>> NOT CopiedCopy NOT COPIEDPress ANY KEY to stop copyCopy doneCopy abortedRenaming temporary fileWriting Creating to Reading on Single drive copy (Y/N)?press enter (any other key ABORTS): Insert source diskette Insert destination diskette Error opening source file Error making destination file Error writing destinationDestination must be different than sourcenot enough memory for a copy buffer NOT copied, READ ONLY file on destination n@Rename, NOT RENAMEDYou cannot specify a drive. ERASE, are you sure (Y=yes) ? YNOT ERASED CLEAR: 2,27,69 ATTRIBUTE: start screen: 9,27,99,0,27,97,3,27,98,2 ATTRIBUTE: leave screen: 3,27,98,7 ATTRIBUTE: general: 3,27,98,2 ATTRIBUTE: errors: 3,27,98,15 ATTRIBUTE: message: 3,27,98,14 ATTRIBUTE: data: 3,27,98,3 ATTRIBUTE: input: 3,27,98,12 PRINTER INIT: 1,13 FORMFEED: 1,12 LENGTH: 60 WIDTH: 80 REPORT PRINT: true SHOW SKIPS: true ID:Concurrent DOS Hard Disk Backup SPLIT: true ERASE: true Backup/RestoreBackup and Restore your hard disk filesBACKUPBACKUP.CMD&&&'!'A'b''''''''(*(8(F(Bad file type, only Run a ProgramCMDBATCOMEXECMDBAT !A:\CDOS.COM /C .CMD, .COM, .EXE, or .BAT files ((((((DSKMAINT.CMDSize/Date ON ON OFFSystem disk undefinedNOT set*SETUPSYSTEM ATTRIBUTESFUNCTION.CMD!SETUP /PARAMFDISK.EXEFM.CFGEND DRIVES=OVPMODE=MENU POSITION=OBJECT FG COLOR=OBJECT BG COLOR=COMMAND FG COLOR=COMMAND BG COLOR=PROMPT FG COLOR=PROMPT BG COLOR=MENU SIZE=PROMPT SIZE=TOP MARGIN=BOTTOM MARGIN=LEFT MARGIN=RIGHT MARGIN=KEY FG COLOR=KEY BG COLOR=NO FM.CFG file on drive A: user 0, ABORTING ))))))))))))))))))* *2*D*U*f*q*~*******.* D+P%iIncorrect Concurrent DOS version.$Incorrect Concurrent DOS version.$PCTmpUse sysdisk d: to define a system diskDirectory already exists--------------------------------------- *** V I P *** 06/01/84 VER 0.40 SERIAL NO. XXXXX ALL RIGHTS RESERVED COPYRIGHT (C) 1984 DIGITAL RESEARCH,INC --------------------------------------- (,R,|,,,, <> ... CprogramCON:LST:   --: unmatched quoteCannot open Cannot append Cannot create : No matchStack Overflow $<>.,=:|[]* sp.-bkspc.TERM DAT FILE MANAGER COLOR CONFIGURATION This file, if present on the system drive, allows you to override the default File Manager Colors for the Object Window (WINDOW), Command Menu (MENU), Prompt Window (PROMPT) and Function Key Legend Window (KEY). As an example, this file contains the default colors used for File Manager if this file is not found. That is, in this case the file need not be present for these colors to be in effect. Feel free to experiment with diffe! rent color combinations. The colors 8 - 15 are special colors, in that they only apply to foreground. Foreground colors assigned from that range are converted to the corresponding background color by subtracting 8 from the color number when the display is reverse video mode (highlighted). Similiarly, background colors assigned the 8 - 15 range below, assume the corresponding background color in normal mode and are the specified color only when displayed in reverse video mode.  (Note the colors must be specified as numbers and the rest of the color specification command, e.g. "WINDOW FG COLOR=" must be exactly as shown, no additional spaces, etc.) ********************************* * File manager colors * ********************************* (WINDOW means the object window) (MENU means the command menu window) (PROMPT means the prompt line) (KEY means the key legend) Colors must be entered as a number as follows: Standard colors for both foreground and background. 0 -> Black 1 -> Blue 2 -> Red 3 -> Magenta 4 -> Green 5 -> Cyan 6 -> Brown 7 -> White Special (high intensity) colors for Foreground only (These colors are converted to the above standard set when displayed in background) 8 -> Grey 9 -> Light Blue 10 -> Light Red 11 -> Light Magenta 12 -> Light Green 13 -> Light Cyan 14 -> Yellow 15 -> High Intensity White OBJECT FG COLOR=0 OBJECT BG COLOR=5 COMMAND FG COLOR=14 COMMAND BG COLOR=1 PROMPT FG COLOR=15 PROMPT BG COLOR=3  ࢳд!T!!2ㆠ3+u ub t/<+tHu^GtG3Ҡ.!3|uVGOr dursuy Concurrent DOS Serial Terminal Configuration file for EDITMENU, COPYMENU, RUNMENU, and FILE-MANAGER. Digital Research, Inc., 1985. Terminal type: Zenith Z-29. ^ >< ~ kh !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~. : fc ii`tttcct`cdddceusvabvvefusvabuusseeffbbdfi p,- * /+ g @ o 2l FFFFLLFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFLLLLLFLLLFIIIIOOIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIOOOOOIOOOIRURRRRRRRURRRRRRRURRRRRRRURRRRRRRURRRRRRRURRRRRRRURRRRRRRURRRRRRRURRRRRRRURRRRRRRURRRRRRRURRRRRRRURRRRRRRURRRRRR^URRRRRR^URRRRRRR[XXXXXXR[XXXXXXX[XXXXXXX[XXXXXXX[XXXXXXX[XXXXXXX[XXXXXXX[XXXXXXX[XXXXXXX[XXXXXXX[XXXXXXX[XXXXXXX[XXXXXXX[XXXXXXa[XXXXXXa[XXXXXX"%(+.2:=@C6Y EKJvwy5x5s0ABCDFG &.2ұn-N% ࢵ&G> udXш&& ôP!3 ࢳд!T!!2ㆠ3+u ub t/<+tHu^GtG3Ҡ.!3|uVGOr dursuy Concurrent DOS Serial Terminal Configuration file for EDITMENU, COPYMENU, RUNMENU, and FILE-MANAGER. Digital Research, Inc., 1985. Terminal type: PC Type Terminal (eg Wyse 60)PC  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@C@@@@@@@C@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@C@@@@@@@C@@@@@@@"%(+.147:=Y EKJvwefABCDqp&.2ұn-N% ࢵ&G> udXш&& ôP!3 ࢳд!T!!2ㆠ3+u ub t/<+tHu^GtG3Ҡ.!3|uVGOr dursuy ECopyright (C) 1983, Digital Research, Inc.Serial No. XXXX-0000-654321$؎\&p >tN M    |   x ! < u<taP 33 VE ^ tu =`uú 33ౙ<úB  33>tZ4QV^YFFíI&V ^DL 6Qo Y+! OþZ4ȭ;\|+\2Xȭ;|+SX+;tR[SV>Q ^[ C .WËt[SVRL8 X^_L|D ÿ DW|L+Lڎ_VQ  o É QW _YQW3 _Y<u<u ; }<\tQ_YQWSCCSW@2 _<u;~}YYY2;~|YYY}00tËC;X|3ۉÌ )))(؋_.ڎ‰XQV^YíQV^YÀ>u>DD |L66QWV4^6_>YËDDDL >>À>uŽ)& u QV^YZŽ) t< v<~w-P\!XP X $'@'ê>u Wб<_ì<\uPX$ ÊL|QWt/<\u t&rPt[r _Y<tX_Y-ab>e t">et\ uþ=t/ ePfFgK>tD,aY\Q t<t'  t3Ɋ̸ᣑ2ð6;6r t<tƖ6<^3ɿv' !|  8  G GÃ3FVQ  G6< t<\t"\G0G0GY^AB;t6AVRZQY^þ!GWP_0GES<t_.&G..+Ȋ؊ S[ӿ2 . S2؋[û<t4dt1Uu([KtS[K?:td[[Kt.CPCFCKC CZ|V[LuKCA|ȀPÀ@dSt< t0<.t,<:t(<t$dtA<.tGC t GAò ñ-dd=u1,dP,X<ud, Tu u0u )"u u Cû'^íV3^V&K&C^4K&73P&WW'tP3Xm(.2þ((s(m(g(2((U(OmD(Aò3))OË))gË))t3OË))g) u ) )2)3ñ )À>)u)À>)t))&G)}2 ),&T)))(&#)RS)J!)&G):)2,&T39)"%)&G')&_(P*))08=Z#)&#)R))8Y|4-Z))`ñ8ñﱋ6%))&L&\))39&GPS&g)p[X&GË*)'),)3یŽ؎&>))tێێË*) Ž')3S)!)&O[S)!)&g[))(ñ 8 ?COPYRIGHT(C)1983,84,DIGITAL RESEARCH(05/02/84)XXXX-0000-654321PSQRR&K&ZػC?u3&1GV[3&1SZY[XUVN uR)+-/]Z[َѼSRË$X=?><=@>V=V}= PEPPP>>>u{P_P>>>u6R=sA>PT>}=u>>RPA?>3 }=8}=u>>=QQd<u= >PX= PX=sh?>PX=X=sU P?>PX= P|6}= ?>PX= Pe?>PzX= PUPa?>PcX= P>>>X=sPW= PP5UPP]UPFP]U Pv]U Pv]UPFP]U PP]UPv]U^G G PS]UPvz]UPvj]UPvZ]U^G G PSA]U!Pv1]UPv!]U$Pv]U PFP]U6$<t]à]U6PvAPFs]UNv~]U[>\>\>< r@\>΋^P u@Y"s"^:t:s[>[>\> \>뷠[>]Y>=@=QU]>>>=u89`>@=]Á>>=vH>=_>_>;>=w}@=H=v89]>+`>^@=@89_>u]Ã>>=vB_>_>;>=w2@=@?v89]>`>@=/@89_>u]Ua>]>8a>wSa>1Í:9P'`>Q<tP>=PDPB`>a>uP]UFF<vP<tX=FF]Ub>S="V=sf^:@>v][P^^?u P^wP^?uP^o!^? tb>^ ^ P]b>]UB=D=PP]Uc>>uc>c>:w#À t c>,uƇ c>uc>c>:r@c>P t@Y"sc>֊c>.u >>d>Ƈ d>d>c>>c> wPQc>Í=Pc>u۠d>c>e>h>i>e>u@h>"r uf>e>P< u@YP[u@Z"Pu@Z"P>f> r@P>c> r@Z"Z"s@`v{s c>c>e>f>öֈ=e>f>uc>c>< wi>sh>He>[u;c>ȱÀ= uc>Ȣc>c>Ƈ=[e>c>i>e>R=S=T=U=8c>wf>f>< rÀ=[uo=CuT=f>À=Eu U=.c>@f>À=Ntf>À=Lu R=S=͠f>À= uc>f> f>sc>]UF=n>m>L=>>j>< s>>>uF=:=F=N=m>F=+H=J=H=QP F=m>r%H=À:9$um>H=ÊI9:j>tn>s[n>?>Pk>>j>um>s+PH=PP>j>w m>sP?>Pk>PN=1u?>Pk> Pk>>k> wk>Ƈo> k>u|>$ PH=Í:9Po>Po>P_N=H=ÊI9:j>sm>H=P6L=L=n>s?>P'k>PP]U>~>>>P=>>=uS}> }>À= u}>}>,=>}>Í=P=>Í=P>=>Ê=>>>t >=t>=u=>Ƈ= ~>Њ>"rP=À:9$u>>8I9t>>ƍ=P:9Pk>>>t PP=Í:9P>>Í=P$>>>>>s >>>>>><wÀ= t=[u >~>?P=PPJ>->sP=Ê>:I9r> P=PP>sXP=@:=PP=ÍF9PPxPP=ÍF9@PP^P=ÊH9W=I9>>>=u=>Ê>=>>]U>>:Fr@X="sE?>PX=X=s>>:>w P>uꠅ>Í=P>]U Pe6>>X=s ?>PjX=X=sP<tPW=P PDX=]>>ѠX="PQ<t@Y"sѠW=Ȣ>>><v@>"r>><uX=>>ЊX="P>>r@>P/t@Y"Y"s%>Sj>>˷S>[>먀>>u> >Ƈ>$X=Њ>"s6>> uS=s ?>P6X=6>>>v>P> W=UP!PHP$?>P>"PHPƇ?>r>>>tR=sA>P>]Ì>>&>R]&6h&\ >Z(>&CSQS[Y< u< t<u t͠(>V<u<u t&K<u QS><u[>:(s(<u[&>>b<u7Q}Y[SQ tC&QS:[YS> " t*(>F>u<u؎(:sC&QS[Y-C& [&/> >>G&>á> u Q8Y Qѱ,Yá> t>>t u>Ê>> u>>< t< t < t<t< t0<u >t<u<u >`<u3>ã>>ud<t(< s(t<u(< u(Êxs P^Y@ u ($u  #(:>s  zQYË<$tAQY! ERROR: $ $Reading file HELP.HLP.$ Press RETURN to continue $ $ $ Topics available:$ For more information, type a period and one of the following subtopics:$ $ $ $Reading file HELP.HLP.$ HELP (Enter topic, ESC to exit)> $HELP HLP HELP UTILITY V2.0 At "HELP (Enter topic, ESC to exit)> " enter topic {,subtopic}... EXAMPLE: HELP (Enter topic, ESC to exit)> DIR EXAMPLES $? HELP HELP Topic:$Not found$No HELP.HLP file on the default drive.$ This program cannot be run from a menu from the Serial Terminal.$ DATE OF LAST CHANGE 26 AUG 84 Requires Concurrent $@R"Concurrent Function Key ProgrammerFUNCTION $@ # Main Menu!S E L E C T F U N C T I O NHS^ F3  $i F5  $F7 $ Assign Function Keys Save Function Keys in a File Reset Window Switching Keys DATE OF LAST CHANGE 26 AUG 84 4 0123456789aAbBcCdDeEfFf jpv |  8 B F1: F2: F3: F4: F5: F6: F7: F8: F9: F10: #  Home: : Pg Up: -: -: End: : Pg Dn: Ins:  Del: -! Alt F1: Alt F2: Alt F3: Alt F4: Alt F5: Alt F6: Alt F7: Alt F8: Alt F9: Alt F10: # Shift F1: Shift F2: Shift F3: Shift F4:  Shift F5: Shift F6: Shift F7: Shift F8: Shift F9: Shift F10: - Ctrl F1: Ctrl F2: Ctrl F3: Ctrl F4: Ctrl F5: Ctrl F6: Ctrl F7: Ctrl F8: Ctrl F9:  Ctrl F10: -Press the Function Key you wish to program 9or Carriage Return to display the other sets of keys  2 BJP-You are now Programming the selected Key. 6To terminate the sequence enter Ctrl @ or \00 -Type -- to erase a character ; The file specified in the command line was not found. = The file specified in the command line cannot be opened. $ Error while reading input file *F1 * *F2 * *F3 * *F4 * *F5 * *F6 * *F7 * *F8 * *F9 * *F10 * *HOME * *UP * *PG UP * *LEFT * *RIGHT * *END * *DOWN * *PG DN * *INS * *DEL * *ALT F1 * *ALT F2 * *ALT F3 * *ALT F4 * *ALT F5 * *ALT F6 * *ALT F7 * *ALT F8 * *ALT F9 * *ALT F10 * *Shift F1 * *Shift F2 * *Shift F3 * *Shift F4 * *Shift F5 * *Shift F6 * *Shift F7 * *Shift F8 * *Shift F9 * *Shift F10 * *Ctrl F1 * *Ctrl F2 * *Ctrl F3 * *Ctrl F4 * *Ctrl F5 * *Ctrl F6 * *Ctrl F7 * *Ctrl F8 * *Ctrl F9 * *Ctrl F10 * *Scr swtch */ / //--   4 .PFK 3  4I SAVED" -3M 9:Invalid Drive  -- Press any key to continueyM ;Directory Full -- Press any key to continueM ?Bad Sector on Disk -- Press any key to continueM #;Read Only Disk -- Press any key to continuedjM p6Disk Full -- Press any key to continueM ;Unable to Open -- Press any key to continueM <Unable to Write -- Press any key to continueGC I()*,:;<=>?[\]|KEYS PFKFUNCTION SAVEFUNCTION SWITCHChanging Window Switching Keys !,7(F2 2B F3 P (F4  2Y F5  ` (F6 2h F7 w(F8 2 F9  Keypad Only Shift Alt Ctrl Shift + Alt Shift + Ctrl Alt + Ctrl Shift + Alt + Ctrl Z9{CSave Function Key Assignments?You can enter a file name to save your function key assignments ?:in. At any fut" ure time you can restore these function key 9assignments by entering the command: FUNCTION +where is the file entered below. L FUNCTION KEY FILE NAME is: 4IKEYS.PFK `kF3 $vF5 $ Change File Name Save Function Keys DATE OF LAST CHANGE 26 AUG 84 p b v&y&&&y&&N&PĿ --I '''''' F1 ' HELP ''' ' ' ' '!(G((ESC2( Exit this program (ESC2,( Go back to previous menu(ESC2R( Stop current operation o(HELP STRING NOT INITIALIZED $ DATE OF LAST CHANGE 26 AUG 84 Yw6fE Eqt7evsttpqru ef DATE OF LAST CHANGE 26 AUG 84 MXdisk 8VCMXQ@ HELP FACILITY TAKES OVER AT THIS POINT. PRESS ANY KEY TO GET BACK TO PROGRAM. $# E$ Printer Busy $&.2ұn-N% ࢵ&G> udXш&& ôP!3 ࢳд!T!!2ㆠ3+u ub t/<+tHu^GtG3Ҡ.!3|uVGOr dursuy .K default CURSOR MOTION COMMANDS KEY ACTION up arrow Up down arrow Down left arrow Left right arrow Right PgUp Page up PgDn Page down Ctrl-left arw Word left Ctrl-rght arw Word right Home Beginning of buffer End End of buffer F3 Beginning of window F4 End of window F5 Beginning of line F6 End of line Alt-g Go to line (prompts) This is the first of 4 help screens; press Alt-h again for second screen. .M default2 EDITING COMMANDS KEY ACTION Backspace Delete character to left of cursor Del Delete character at cursor Alt-d or F9 Delete entire line Alt-F9 Delete line to right of cursor Alt-u Insert last deleted line above cursor (undo) Alt-a Get blank line below cursor Alt-i Get blank line above cursor Ins Toggle between insert and overstrike mode FILE COMMANDS KEY ACTION Alt-e Edit new file (prompts) Alt-f Change file name for next write (prompts) Alt-r Read file into buffer below cursor (prompts) Alt-w Write contents of buffer to file (might prompt) Press Alt-h again for third help screen. .M default3 BLOCK COMMANDS KEY ACTION Alt-k or F8 Mark lines to copy, move or delete Alt-c Copy marked lines below cursor Alt-m Move marked lines below cursor Ctrl-d Delete marked lines SEARCH AND TRANSLATE COMMANDS KEY ACTION Alt-s or F10 Search for characters that match a pattern (prompts) Alt-F10 Continue search Alt-t Translate characters that match a pattern (prompts)  Press Alt-h again for fourth help screen. .M default4 WINDOW AND BUFFER COMMANDS KEY ACTION Alt-1 or F1 Edit in window 1 Alt-2 or F2 Edit in window 2 (split screen if necessary) Alt-o Restore screen to one window Alt-b Swap to different buffer (prompts) MISCELLANEOUS COMMANDS KEY ACTION Alt-x Exit from DREDIX or exit from prompt Alt-p Display status of files, buffers, windows, etc. Alt-h or F7 Get help Characters typed on the alphanumeric keyboard (including tab) are inserted at the cursor, pushing the rest of the text on the line to the right. Inserting a RETURN splits a line; deleting a RETURN joins two lines. Additional help is available whenever DREDIX prompts you for additional information (for example, a file name). You may press Alt-h at any time, and DREDIX will give the help that you need. .M default .K Pattern Type a pattern to be searched for followed by a RETURN. If you want to cancel this command, press Alt-x after pressing the space bar. Simple patterns consist of letters, numbers and most special symbols. Upper and lower case letters are different. Special characters can be used to build more complex patterns. If you don't want a character to be special, precede it with \ (backslash). CHAR SPECIAL MEANING * Matches any string of zero or more characters. ? Matches any single character except end-of-line. \ Makes next character (*, ? or \) non-special. .K Replacemen Type text to replace text that the pattern matches, followed by a RETURN. The RETURN isn't part of the replacement text. If and when a match is found, you will be prompted to enter one of three responses: RESPONSE ACTION Alt-x Terminate the translation process. Translations that were already made will remain made. l (local) Perform this translation, and go on to the next match. g (global) Perform this translation and all other translations. [space bar] Skip this translation, but go on to the next match. Hitting any other key is equivalent to hitting the space bar. If you want to cancel this command, press Alt-x after the space bar. .K treply DREDIX is ready to make the translation you requested, but first it wants your approval. You must respond with one of the following: RESPONSE ACTION Alt-x Terminate the translation process. Translations that were already made will remain made. l (local) Perform this translation, and go on to the next match. g (global) Perform this translation and all other translations. [space bar] Skip this translation, but go on to the next match. Hitting any other key is equivalent to hitting the space bar. (The most likely response is pressing "l" or "g".) .K File Type a file name followed by a RETURN. If you want to cancel this command, press Alt-x after pressing the space bar. .K Line Type a line number (from 1 to the number of lines in the buffer) followed by a RETURN. If you omit the line number or use a line number of zero, you will go to the first line of the marked block. If you want to cancel this command, press Alt-x after pressing the space bar. .K Buffer num Type a buffer number or file name followed by a RETURN. The buffer you specify will be brought into the current window. If the buffer was previously associated with some other window, then the two windows will exchange buffers. Otherwise, the old buffer will not be associated with any window. In any event, the old buffer will remain undisturbed, and you can change back to it later. If you specify a file name and there is a buffer associated with that name, then that buffer's number will be used. If the file you specify isn't associated with any buffer, then an error message will be given. If you want to cancel this command, press Alt-x after the space bar. .K OK to lose If you just issued an edit (Alt-e) command, then the problem is that you haven't yet written out the changes you made to the current buffer. If you respond with "y" followed by a RETURN, then you will lose the changes. #  To get a chance to write out the changes with a write (Alt-w) command, respond with "n" or any character other than "y". If you just tried to exit (Alt-x), then the problem is that some buffer (not necessarily the one associated with the current window) hasn't been written out. If you're not sure which buffer it is, type "n" followed by a RETURN and use the Alt-p command to get a status display. .K memfull Memory to store text is full! No more text can be read in, and no more editing can be done. You should exit from DREDIX immediately and start over. If you have made changes that you want to save, you may issue a write command. If you haven't made any changes, just exit.  ࢳд!T!!2ㆠ3+u ub t/<+tHu^GtG3Ҡ.!3|uVGOr dursuy  Mr. Bob Thomas 279 Apple Wood Blvd. Tarzana, CA 91356 Dear Mr. Thomas: On Tuesday, March 31, our Tax Department received three shoe boxes via Express Mail which they assumed contained your tax records. Instead, the boxes contained the following: one pair athletic shoes, powder blue with white swoosh, size 12 one pair wing tips, brown, size 12 EE one pair ladies dress sandals, red patent leather, size 7 We are returning the shoes via registered mail to your home address. Mr. Thomas, you may want to check with your shoe repair shop to see if they are in possession of the boxes containing your receipts. If so, please expedite the records, as April 15 is fast approaching. Sincerely, Suzanne Johnson  ࢳд!T!!2ㆠ3+u ub t/<+tHu^GtG3Ҡ.!3|uVGOr dursuy Welcome to DREDIX! We'll be explaining how to use DREDIX in a series of short, simple lessons. Each lesson will appear here, at the top of the screen. You'll be able to try out what you learn at the bottom, where the cursor is. When you're finished with a lesson and ready to go forward, hold down the Ctrl key and press f. If you want to go back to an earlier lesson, press Ctrl-b. Now, press Ctrl-f and the lessons will begin ... @ ENTERING TEXT Type something on the alphanumeric keyboard. Did you notice how each letter was entered onto the screen where the cursor was, and then the cursor moved to the right? This is the basic way you enter text using DREDIX. Now try using the RETURN key. Notice how it ended the line and moved the cursor to the start of the next line? Try entering some more text, and when you're ready to go on, press Ctrl-f. If you want to go back to the previous lesson, press Ctrl-b. @ MOVING THE CURSOR UP, DOWN, LEFT AND RIGHT To move the cursor around, you use the arrow keys at the right of your keyboard. Press the up arrow to move up, the down arrow to move down, the left arrow to move left and the right arrow to move right. Try it. Did you notice that sometimes pressing an arrow key didn't do anything? If there's no place to go (for example, UP when you're already at the top), then that's where the arrow key takes you: no place. Press Ctrl-f to go on, and Ctrl-b to go back. @ INSERTING TEXT If you move the cursor to somewhere WITHIN a line of text and then type, the new text will be inserted where the cursor is. Since the old text has to go somewhere, DREDIX pushes it to the right. Give it a try. Try this too: Move the cursor to the middle of a line and press RETURN. The line is split! You can think of this as inserting a "RETURN" into a line. Press Ctrl-f to go on, and Ctrl-b to go back. @ DELETING TEXT One more lesson, and you'll know all you need to start typing a manuscript or a program. What if you want to erase something you've typed? If you notice a mistake right away, you can just backspace over it with the backspace key. Or, you can just move the cursor under the character you want to delete, and press the key marked Del. Try it out. So now you can enter, insert and delete text! Press Ctrl-f to go on ... @ JOINING LINES Remember how you could insert a RETURN as though it were an ordinary character? You can delete a RETURN, too! Try moving the cursor to the far right of a line (not the last line, though), and pressing Del. Two lines are joined into one! So inserting RETURN splits lines, and deleting RETURN joins lines! There's lots more to come, so press Ctrl-f and we'll continue... @ GETTING HELP One of the most useful commands is the HELP command. You can issue this command at any time to get some help from DREDIX about what to do in whatever situation you`re in. Try it: hold down Alt and then press h. Are you back? Do it again, if you want. Commands like "hold down Alt and then press h" will be abbreviated "Alt-h" in these lessons, on the help screens and in the DREDIX User's Manual. Now press Ctrl-f ... @ EDITING FILES Tired of typing? Want to get a lot of text in a hurry? The EDIT command tells DREDIX to read in a file of text (or a program, or some data, or whatever). To issue this command, press Alt-e. (Remember: hold down Alt and then press e.) Answer "y" (followed by RETURN) if you get an "OK to lose changes" question. DREDIX has displayed the prompt "File:" and placed the cursor after it. It wants you to type a file name. Type the name "text". (Don't forget RETURN.) You should have a window-full! Press Ctrl-f to do some things with this text ... @ SCROLLING Now, there's more text in the file "text" than DREDIX is showing (you probably suspected as much). Move the cursor with the down arrow. Notice what happens when you reach the last visible line? DREDIX scrolls the text automatically! Now go back with the up arrow. DREDIX scrolls it back up. In fact, you're free to move the cursor through the text any way you want, and DREDIX will move the window to keep up. Practice a while if you like (go ahead and change the text if you want to--you can't hurt anything). Then it's Ctrl-f and more ... @ SCROLLING SIDEWAYS DREDIX not only can scroll up and down, but it can scroll sideways, too! To see this, you'll have to help out by editing the file "text" a little, but you've already learned all you need. First, join two lines together by moving the  cursor to the end of a line and pressing Del. You've probably made the line too long to fit on the screen (more than 80 chracters). Move the cursor to the right (as though you were moving it off the screen). The window moves with it! You might want to play around with this a while. It's fun! And then Ctrl-f ... @ THE SCREEN It's time we explained a few things about the screen. As you can see, it's divided into two windows. You've been working in the lower window, and we've been displaying lessons in the upper window. At the lower right DREDIX tells you what file you're editing, the column you're in, the line you're on and the total number of lines. It also tells you what "buffer" you're in (B2), but we won't worry about buffers right now. Messages show up at bottom-left, and prompts above messages. Now, Ctrl-f ... @ JUMPING AROUND Moving the cursor up and down a line at a time can get pretty tedious if you have a large file. Here's how to move around in a hurry: the Home key mo$ ves the cursor to the very first character in the file, and End moves it to the very last character. Try it (you should still have "text" in your window). PgUp moves the window a bunch of lines up, and PgDn moves it a bunch of lines down. How much is a bunch? It's however big the window is: 10 lines right now. Of course, if there's nowhere to go, you go nowhere. Ctrl-f ... @ DELETING LINES If you want to delete a whole line, you could delete a character at a time. But there's an easier way: use Alt-d. If you delete a line by mistake you can "undo" the damage with Alt-u. You can think of Alt-d and Alt-u as opposites. Try to undo the deletions you just made. Then delete them again, and undo them again, and ... Enough of this game ... onward with Ctrl-f ... @ WINDOWS DREDIX actually has two windows, numbered 1 and 2. We've been in window 1, and you've been in window 2. You have to stay in window 2 while you're taking these lessons, but when you use DREDIX for real, you can edit in a full-screen window (window 1) or in split-screen windows (1 and 2). You'll use the F2 key to go to window 2, the F1 key to go back to window 1, and Alt-o to restore the screen to one window. A full explanation is in the DREDIX User's Manual. Press Ctrl-f to go on ... @ SEARCHING Scanning the whole file to find the text you're looking for is OK, but there's a nice of way of getting DREDIX to do the hunting for you. You type a pattern, and DREDIX finds the text that matches it. Here's how it goes: press Alt-s, and DREDIX will prompt you for a pattern. Try it! Now, type the pattern. How about the letter "e" for starters? (Don't forget RETURN.) DREDIX has moved the cursor to the first "e" it found. You can edit there just as if you had moved the cursor yourself. Ctrl-f for more ... @ MORE ON SEARCHING Frequently, when DREDIX finds something that matches your pattern, it's found the wrong match. Maybe it wasn't the first one you wanted, but the next one? You can tell DREDIX to look further along without retyping the pattern. Just press Alt-F10, and DREDIX will find the next match. Go ahead, try it. Try more patterns (they're not limited to single letters, of course). There's more to patterns than we can go into here, so on to translating (Ctrl-f) ... @ TRANSLATING Automatic translation is one of DREDIXs most powerful features. For this you use Alt-t. DREDIX will prompt for a pattern and then for a "replacement". Whatever the pattern matches will be replaced by the text you supply. Do this: press Alt-t. Then type the pattern "girl" (without the quotes), and after RETURN, the replacement "young woman", followed by RETURN. DREDIX will stop the cursor at "girl" and display a message. To decrypt it, press Alt-h to get help (we thought you'd like to use help for once). Then Ctrl-f ... @ MORE ON TRANSLATING You can make the replacement string empty, and thereby just delete whatever the pattern matched. You supply an empty replacement string just by responding to the "Replacement:" prompt with an immediate RETURN. There's too much more on translating for us to go into it all now. So we'll move on. If you'll press Ctrl-f ... @ SAVING YOUR CHANGES When you're finished making your changes, press Alt-w to rewrite the file you're editing with the version you've created inside DREDIX. Until you press Alt-w, your changes aren't saved. Since a power failure or other glitch can terminate your editing session at any time, it's a good idea to write your changes with Alt-w every few minutes, even if you're not finished editing. That way you stand to lose only your most recent changes if things go wrong. Press Ctrl-f ... @ QUITTING Feel like quitting? Well, even if you don't, you might want to later, so here's how: press Alt-x (the same keystroke that escapes from Alt-t). If you try to quit without writing your changes (Alt-w), DREDIX will ask you if it's OK to lose your changes. If you answer "y", you'll quit anyway. If you answer "n", DREDIX won't quit and you'll get a chance to save your work first. This is a nice safety feature! If you don't want to quit, school's still in session, so press Ctrl-f ... @ GOING PLACES Would you like to go directly to a line by specifying a line number? Try Alt-g. It'll prompt you for a line number, and if you supply one the cursor will go there right away. It's a little like searching, but via a line number instead of a pattern. Useful if your compiler just gave you an error message and you want to see what the line in question looks like. Now, we'll move on to moving, with a gentle press of Ctrl-f ... @ MARKING LINES TO BE MOVED Moving lines from one place to another is a three-step procedure: 1. You mark the line or lines you want to move (with Alt-k). 2. You place the cursor anywhere on the line where you want the marked lines to be moved to. You can do this with the arrow keys, with searching (Alt-s) or with the go command (Alt-g). 3. You press Alt-m, and DREDIX moves the text you've marked. Press Ctrl-f and we'll go through it step-by-step ... @ MARKING Do this: put the cursor someplace, and press Alt-k. Notice that DREDIX tells you that it's waiting for the second mark. Then place the cursor a few lines away, and press Alt-k. DREDIX will highlight the lines you've marked with a reverse-video bar in column 1. After you've marked things, press Ctrl-f and we'll move them someplace ... @ MOVING Now that some lines are marked, place the cursor somewhere else (above or below the marked lines), and press Alt-m. DREDIX will move the lines. They're still highlighted, though, so you can easily see what DREDIX has done. To turn off the highlighting (and cancel the marks), just press Alt-k again. Notice that DREDIX moved the lines to FOLLOW the target line. (A useful fact to keep in mind.) Copying lines is just as easy. Press Ctrl-f and you'll see ... @ COPYING Copying is exactly like moving, except that the lines you've marked aren't disturbed in any way: they're still marked, and still highlighted. But a group of lines just like them will be appended after the cursor. Follow the steps we did for moving (use Alt-k to mark, and then position the cursor to where you want the copy). Then press Alt-c. Presto, a copy. You can move and copy BETWEEN windows, too. Just place the cursor in another window before pressing Alt-m or Alt-c (try this later). And now, for Ctrl-f ... @ DELETING A GROUP OF LINES There's another useful thing you can do to a group of marked lines besides move them or copy them: you can delete them. The marking part is just like it is for moving and copying. To delete the lines, you press Ctrl-d (instead of Alt-m or Alt-c). If you've deleted the marked lines by mistake, you can use Alt-u (undo) to get them back--one line at a time. Try Ctrl-d for yourself, and then press Ctrl-f to move on... @ CONGRATULATIONS!!! If you've gotten this far, you've passed the course. Not that there isn't more to learn, though. After you've used DREDIX for a while, you'll want to read the User's Manual thoroughly so that you can use DREDIX to its fullest. Press Ctrl-f for a list of some more handy DREDIX features that you can learn about from the manual. @ ADDITIONAL DREDIX FEATURES * Using multiple buffers * Appending/inserting blank lines * Jumping to start/end of lines * Status of files/buffers/windows * Merging files * Fancy, "wild-card" patterns * Additional cursor motions * Moving right and left$  by words * Overtype mode * Using multiple windows @ THE END Press Ctrl-f to start the course over, or Alt-x to exit. Emerging Technology Consultants, Inc. 1877 Broadway Boulder, CO 80302 303-447-9495 Tutorial and program (C)Copyright 1984 Emerging Technology Consultants, Inc. }}ECopyright (C) 1983, Digital Research, Inc.Serial No. XXXX-0000-654321$؎t uY>t\.19 2V33;V^6ﾪXR>tPF>tPFPù tu =`uú^ 33ౙ<úB  33i&C\_S<t ^V[n2S㋏ 6 :@~223ҳ [P 6 ^$À>u J R>uh 9À>u ~>u  k3DD D  ؎>t/$ȋ߾߀>u;9Ⱦ߹>t  %  úu u ò$IJڎ¿ QZ*ц$ ڎ2P65XP$)) (XP$X$ ÈCCú GGPR uGZX2PXP$蓋 X$؎>tf< wF66 uȬI< tNA6>tҦuIu>t< u든>t5LV>tȬ^þ2<u2À'À'À'À'þ3PN<' 6Y*" &+ j '= =  4 1  3 0 |o \_Sq<t ^V[2$ t 6 } ɀ}ЈS[3Ҹ 2pV^4eþ 6 r 6 }ùػrùC؎ 7CCù  &?CC (ûPS[X 3ۊðĹN! ~,P& cvͿNxãQYKYV'^ 3ۊÉ3ۭ t VS [^;tCCíQSV^[YíV^ VQsY^QV^Yÿ؎V^íV3^V&C^473WW3Ҹ;<t<FQYQYí6o 6pO +0Otñ t <t<Ã>:tP3X.2þYUs~mgs2}zUeOmD[Aò3OËgËt3OËg u23ñÀ>uÀ>t&G}2䢯,&T(&RSJ&G:2,&T!"&G&_(P0!=Z &R8Y|4-Z`ñr!ñﱋ6&L&\!&GPS&gp[X&GË3یŽ؎&>tێێË Ž3S&O[S&g[(ñ ຄ! ?COPYRIGHT(C)1983,84,DIGITAL RESEARCH(05/02/84)XXXX-0000-654321PSQRR&K&ZػC?u3&1GV[3&1SZY[XUVN uR)+-/]Z[َѼSRË$%&%&%V#& PEPPP5'>5'u{P_P5'>5'u6%s&PT>#&u&RPA&3 #&8#&u&2&QQd<u%& &%sP% PP5UPP]UPFP]U Pv]U Pv]UPFP]U PP]UPv]U^G G PS]UPvz]UPvj]UPvZ]U^G G PSA]U!Pv1]UPv!]U$Pv]U PFP]U6$<t]à]U6PvAPFs]UNv~]U'''< r@'΋^P u@Y"s"^:t:s''' '뷠']Y%%QU'>%u!'%]Á>%vH%'';%w}%H=v!'+'^%@!'u]Ã>%vB'';%w2%@?v!''%/@!'u]U''8'wS'1Í!P''Q<tP%PDPB''uP]UFF<vP<t%FF]U'%"%sf^:&v][P^^?u P^wP^?uP^o!^? t'^ ^ P]']U%%PP]U '>u ' ':w#À t  ',uƇ  'u ' ':r@ 'P t@Y"s '֊ '.u & 'Ƈ  ' ' '> ' wPQ 'Í2&P 'u۠ ' ' ''' 'u@'"r u ' 'P< u@YP[u@Z"Pu@Z"P> ' r@P> ' r@Z"Z"s@`v{s ' ' ' 'öֈ2& ' 'u ' '< w's'H '[u; 'ȱÀ2& u 'Ȣ ' 'Ƈ2&[ ' '' '%%%%8 'w ' '< rÀ2&[uoA&Cu% 'ÀA&Eu %. '@ 'ÀA&Nt 'ÀA&Lu %%͠ 'ÀA& u ' '  's ']U%''%&'< s>&u%%%%'%+%%%QP %'r%%À!$u'%Ê!:'t's['&P'>'u's+P%PP>'w 'sP&P'P%1u&P' P'>' w'Ƈ' 'u"'$ P%Í!P'P'P_%%Ê!:'s'%P6%%'s&P''PP]U''$'%'('%&'>%&uS#' #'À2& u#'#',&#'Í2&P&Í2&P&'&ÊA&)'>&'t >%&t>%&u&ƇA& $'Њ%'"r%À!$u&8!t&ƍ2&P!Pk&'>&'t P%Í!P&Í2&P$&&('s &*'('&<wÀ2& t2&[u ''$'?%PPJ''-('s%Ê*':!r%' %PP''sX%@%P%Í!PPxP%Í!@PP^%Ê!%!&>%&u&Ê)'A&%'%']U+'+':Fr@%"sE&P%%s,',':+'w P,'u+'Í2&P+']U Pe6&%s &Pj%%sP<tP%P PD%]0'0'Ѡ%"PQ<t@Y"sѠ%Ȣ-'-'-'<v@0'"r-'/'<u%.'0'Њ%"P>.'r@-'P/t@Y"Y"s%.'Sj-'.'˷S-'[1'먀>.'u0' .'Ƈ1'$%Њ0'"s6>/' u%s &P6%6/'>.'v1'P.' %UP!PHP$&P4'"PHPƇ&r4'>4't%s&P4']ÌU'S'&Q'R]&6h&\ 8'Z(P'&CSQS[Y< u< t<u t͠(N'V<u<u t&K<u QSP'<u[P':(s(<u[&Q'S'b<u7Q}Y[SQ tC&QS:[YSN' t*(N'FN'u<u؎(:sC&QS[Y-C& [&/U' U'S'G&Q'áK' u Q8Y Qѱ,YáK' t>% M't uM'ÊM'K' uM'K'< t< t < t<t< t0<u K't<u<u K'`<u3K'ãK'N'ud<t(< s(t<u(< u(Êxs P^Y@ u ($u  #(:P's  zQYË<$tAQY! ERROR: $ $Reading file HELP.HLP.$ Press RETURN to continue $ $ $ Topics available:$ For more information, type a period and one of the following subtopics:$ $ $ $Reading file HELP.HLP.$ HELP (Enter topic, ESC to exit)> $HELP HLP HELP UTILITY V2.0 At "HELP (Enter topic, ESC to exit)> " enter topic {,subtopic}... EXAMPLE: HELP (Enter topic, ESC to exit)> DIR EXAMPLES $? HELP HELP Topic:$Not found$No HELP.HLP file on the default drive.$ This program cannot be run from a menu from the Serial Terminal.$ DATE OF LAST CHANGE 26 AUG 84 L# Main MenuS E L E C T F U N C T I O N F3  $ F5  $(F7 $: Port Configuration Port 0 Protocol Port 1 ProtocolPf Requires Concurrent $|,Concurrent Serial Port Configuration Program/ No Serial communications options installed. SETPORT When running this program from a Serial Terminal you must specify the configuration and protocol parameters in the command line. Type SETPORT HELP for an example of how to use the command line $ DATE OF LAST CHANGE 26 AUG 84 SETPORT CONFIG Nyyyy Printer 35 Printer 4* Serial Port 03? Serial Port 1T#Press function key to advance value  Baud rate  Word length Parity  Stop bits)4?F3  )J F5  )PF7 )VF9 )\7F4  Bh 7F6  Bn7F8 Bt7F10Bz         P3 P4 110 150  300@ 600`1200240048009600NONE ODDNONEEVEN 1 2 5 6 7 8HELPINNN&IDNN&INRN&IDRN&INNX&IDNX&INRX&IDRX&ONNN!ODNN!ONRN!ODRN!ONNX!ODNX!ONRX!ODRX!)  )  `0 ?  =Question mark is under invalid identifier in command tail  Absence of command tail arguments invokes screen mode If a command tail is present all arguments must be separated by spaces. Valid device identifiers are: P3 P4 Valid speed identifiers are: 110 150 300 600 1200 2400 4800 9600 Valid word length identifiers are: 5 6 7 8 Valid parity identifiers are: NONE ODD EVEN Valid stop bit identifiers are: 1 2 Valid protocol identifiers are I(input) or O(output)followed by: DNN NRN DRN NNX DNX NRX DRX The following example sets Printer 3 / Serial Port 0 to: 1200 baud 7 bit ODD parity 2 stop bits input protocol is NO DTR/DSR + RTS/CTS + XON/XOFF output protocol is DTR/DSR + NO RTS/CTS + XON/XOFF SETPORT P3 1200 7 ODD 2 INRX ODNX  $;JYit" Serial Port $ Printer Input Protocol2*Output Protocol ADTR/DSR PRTS/CTS _XON/XOFF F3  $ 7F4  B F5 $ 7F6 BF7 $7F8 BSETPORT PROTOCOLON OFF DATE OF LAST CHANGE 26 AUG 84 <XoruN~PĿ --I RiV F1 a HELP qw}    (ESC2 Exit this program (ESC2 Go back to previous menu(ESC2 Stop current operation HELP STRING NOT INITIALIZED $ DATE OF LAST CHANGE 26 AUG 84 Yw6fE Eqt7evsttpqru ef DATE OF LAST CHANGE 26 AUG 84 MXdisk % !VCMXQ@ HELP FACILITY TAKES OVER AT THIS POINT. PRESS ANY KEY TO GET BACK TO PROGRAM. $E$ Printer Busy $ (ûPS[X 3ۊðĹN! ~,P& cvͿN ࢳд!T!!2ㆠ3+u ub t/<+tHu^GtG3Ҡ.!3|uVGOr dursuy rr)Copyright (C) 1984-1987, Digital ResearchXYU{r3 t.a"QÃÍ6 tu =`uú 33ౙ<sÍ 33؀>uTVWXþ h >)t>j*uL ^.(T\J0>)t>j*u Í6(66  u0C v Y*.w65Q=s=vQQ-=u=sQ !5 ÊƱ$Q+6R*X*6Ę6P t 0X<`r, t *ðp(qCw \uH +.w6AbSSҾ Su  D }.AYV<O{6NX뽾" ?KX.{wX,Xvt!>t>Stmu ~ ~4W1t _~.*G& >6{ 6Y À61Zyu Xi >Qu T T .T 8#>T u2 2m2 .&>{sT 8uT u52؍}u|tQT QSÍ6i X }QQW_Yt  +#1+#A##x$9.x6 XšS#8r #1Ê0me'T$t<t''70/0Ê2eڊut" tDÊ2]ڊ2m#&&t:&󤾂$2t]ڊu<w"%2#$J%t ^%<tr%$%t%/$%t%I$eڊ%tu uc$þ'N&4u  ''  '' ' $1'n.g { s { 6 À6XԀ6X̾' ' t n'c't'T(t((t(þ((aT("(. % T  {6$ þ((5($13(& )(f(] )T )K%)B,)9>)t); 2 (t(7s(8(1s(2؁㋷6)((t`)P)(('(6(.& m2 5 8 F I { 4Ê$$ 4Í6X))($13*&**7*. I*% Q* Y*>j*tj* (b*tf*)b*tf*)b*tf*)󤊇b*tf*)b*tf*)b*tf*)S) ) ^.E eU h { {$4 uÊ$4 uÊ$4 uÊ$4 uÊ$4 uÊ$4 uÍ6zX*#V u "t#!󤨀u+f!"PS*v m *d [X@f!"Z" tt"!󤾎"t"!"@t"!PSf! "X [X. a { v<u >u "+<u>t>uۊȊmsр0L"@"&"n!؊o4 o4o4@o4oÍ6CX*#*#<v :Sv*#2þF 38 t^3 4n3/u33u 33 333  3t).643?u3O 4 .W{jt? 6//u * X:77T 9Q+qY9d8 8 .GOb{9>9u9Ë9AӅ{uy3ãyu&  1{1{Í6 Xo9P=u98 {֡y拴9 X=u99S [þ*3.i / v 0 .@w/0B 1 <u==&@fz M6A@@e:`<~6;AuK+6QAu66QAu&6Au6gAu bpmq6C4-=>A@At*&A@ãA,@!Í@"Í@ò,t A@á=P%AX>=>A6Í>=>AÍ6OÃ6Q,þ= @@:t >t{=4>u)(؍>7CCBBCu(B JJJ $ٱ ۋþ FLP7.6F<w6;&QXf 9- $ౚ&>t&G&G@(p uDO󥾂,>Q&>Qt& >phÀ>tt-íVQY^þ f  NH@8:O2 YM N HD Q1YQR#ZY* $N  F X xċV f^V" U^QP3^;uþ Ѿ) RVQY^ZP suðYa a Z GQWP,_Yt=+K۴9uöKOƀvðruPXSQRVWЊ_^ZY[?COPYRIGHT(C)1983,84,DIGITAL RESEARCH(05/02/84)XXXX-0000-654321PSQRR&K&ZػC?u3&1GV[3&1SZY[XUVN uR)+-/]Z[َѼSRË$EFEFEVE PEPPPF>Fu{P_PF>Fu6EsFPT>EuFRPAF3 E8EuFEQQd<uE FEsPE PP5UPP]UPFP]U Pv]U Pv]UPFP]U PP]UPv]U^G G PS]UPvz]UPvj]UPvZ]U^G G PSA]U!Pv1]UPv!]U$Pv]U PFP]U6$<t]à]U6PvAPFs]UNv~]UFFF< r@F΋^P u@Y"s"^:t:sFFF F뷠F]YEEQUF>EuAFE]Á>EvHEFF;Ew}EH=vAF+F^E@AFu]Ã>EvBFF;Ew2E@?vAFFE/@AFu]UFF8FwSF1ÍAP'FQ<tPEPDPBFFuP]UFF<vP<tEFF]UFE"Esf^:Fv][P^^?u P^wP^?uP^o!^? tF^ ^ P]F]UEEPP]UF>uFF:w#À t F,uƇ FuFF:r@FP t@Y"sF֊F.u FFƇ FFF>F wPQFÍEPFu۠FFFFFFu@F"r uFFP< u@YP[u@Z"Pu@Z"P>F r@P>F r@Z"Z"s@`v{s FFFFöֈEFFuFF< wFsFHF[u;FȱÀE uFȢFFƇE[FFFFEEEE8FwFF< rÀE[uoFCuEFÀFEu E.F@FÀFNtFÀFLu EE͠FÀF uFF FsF]UEFFEFF< s>FuEEEEFE+EEEQP EFr%EÀA$uFEÊA:FtFs[FFPF>FuFs+PEPP>Fw FsPFPFPE1uFPF PF>F wFƇF FuF$ PEÍAPFPFP_EEÊA:FsFEP6EEFsFP'FPP]UFFFFEF>EuSF FÀE uFF,FFÍEPFÍEPFFÊFF>Ft >Et>EuFƇF FЊF"rEÀA$uF8AtFƍEPAPkF>Ft PEÍAPFÍEP$FFFs FFFF<wÀE tE[u FF?EPPJF-FsEÊF:ArF EPPFsXE@EPEÍAPPxPEÍA@PP^EÊAEAF>EuFÊFFFF]UFF:Fr@E"sEFPEEsFF:Fw PFuFÍEPF]U Pe6FEs FPjEEsP<tPEP PDE]FFѠE"PQ<t@Y"sѠEȢFFF<v@F"rFF<uEFFЊE"P>Fr@FP/t@Y"Y"s%FSjFF˷SF[F먀>FuF FƇF$EЊF"s6>F uEs FP6E6F>FvFPF EUP!PHP$FPF"PHPƇFrF>FtEsFPF]ÌGG&GR]&6h&\ FZ(G&CSQS[Y< u< t<u t͠(GV<u<u t&K<u QSG<u[G:(s(<u[&GGb<u7Q}Y[SQ tC&QS:[YSG t*(GFGu<u؎(:sC&QS[Y-C& [&/G GGG&Gá G u Q8Y Qѱ,Yá G t>Gt uGÊG G uG G< t< t < t<t< t0<u  Gt<u<u  G`<u3 Gã GGud<t(< s(t<u(< u(Êxs P^Y@ u ($u  #(:Gs  zQYË<$tAQY& ! ERROR: $ $Reading file HELP.HLP.$ Press RETURN to continue $ $ $ Topics available:$ For more information, type a period and one of the following subtopics:$ $ $ $Reading file HELP.HLP.$ HELP (Enter topic, ESC to exit)> $HELP HLP HELP UTILITY V2.0 At "HELP (Enter topic, ESC to exit)> " enter topic {,subtopic}... EXAMPLE: HELP (Enter topic, ESC to exit)> DIR EXAMPLES $? HELP HELP Topic:$Not found$No HELP.HLP file on the default drive.$AST SETUP =>M@rrrr5;{CKQV[bipw}"/PARAM/PFKSAVE/PORTSAV/MDISK/HEAD/DISK/VERIFY/SERIAL/MEMORY/SYSDAT/CLOCK/HDISK/SCROLL/LIMSetup Buffer ==>d  0` Requires Concurrent $ SETUP can't be run from a Serial Terminal. $SETUPSETUP SYSDATSETUP PARAMSSETUP MDISKSETUP VERIFYSETUP DISKSETUP MULTIUSERSETUP MULTIUSER MULTIPORTSETUP MULTIUSER MULTIPORT CONFIGSETUP MULTIUSER FEATURESSETUP SERIALSETUP SERIAL PORTSETSETUP SERIAL CONFIGSETUP SERIAL PROTOCOLSETUP MAXMEMSETUP LIMSETUP HI-MEMSETUP SCROLLSETUP UPDATESETUP DISK MOTORSETUP DISK STEPSETUP DISK SETTLESETUP DISK LOADSETUP DISK UNLOADSETUP CLOCKSETUP HARDISKEwfqtu6Eve7OOOConcurrent System CustomizationĿ  AruC Main MenuPrevious Menu SELECT SYSTEM CUSTOMIZATION OPTION   a F1 rHelpu*F2 Reserve System SpaceF3 Save System Parameters*F4 MDisk F5 Diskette Drive Parameters *F6 Verify After Diskette WriteF7 Setup Serial Consoles*F8 MENU TWOF9 Color Monitor Scroll Mode*F10rUpdate and ExituEscrQuit without UpdateuSELECT FUNCTIONF1 Help*EscReturn to This option controls the amount of memory in the system spacethat is reserved for use by DOS-compatible device drivers. Concurrentwill stop the device driver installation with an appropriate errormessage if the space available is not sufficient for the size ofthe device being driven. Many drivers will require no extra space,but if the driver will not load, you may wish to increase this valueby 128 bytes and retry. Any space reserved here reduces the memoryavailable to application programs.The amount of System Space currently reserved is: bytesF3 Enter a new valuea Enter a four digit decimal number to set a new value in bytes.The new value must be between 0 and 9999. To enter a value less than1000, be sure to start with a zero. ___e This option allows the current state of certain system parametersto be saved, and reinstated at the next Power-On or System Reset. Tocancel the Save command, retype the appropriate function key. F3 Save Programmable Function KeysF5 Save Serial Port ConfigurationsSaved a This option allows you to reserve a portion of memory to be usedas a Logical Disk Drive, or MDisk. You may increase or decrease thesize of the MDisk.Current MDisk size: Kb 0123456789ABCDEFF3 Increase MDisk size*F4 Decrease MDisk sizea:0000 Invalid Starting Address TYPE ANY KEY TO CONTINUE This option controls the Verify After Write feature of the systemDiskette software. When enabled, the Diskette is verified after eachwrite operation, with automatic retries for verification errors. TheVerify feature results in greater data security at the cost of speed.F3 Enable Verify After WriteF5 Disable Verify After WriteThe Verify After Write feature is: Enabled Disableda This option permits customization to support non-IBM diskette drives. Type rESCu now if your system consists of IBM drives.r CAUTION: A customized version of Concurrent may not run correctly on other machines.u Be certain that a back-up copy of CCPM.SYS exists. F1 rHelpu *F2 Motor Startup TimeF3 Head Step Time*F4 Head Settling TimeF5 Head Load Time*F6 Head Unload Time*EscrReturn to Main Menuua This parameter specifies how long Concurrent will wait beforeattempting a diskette read or write after turning on the drive motor.If this interval is too small, read and write errors will result. Ifthe startup time is excessively high, diskette accesses take longerthan needed.F3 Decrease Motor Startup TimeF5 Increase Motor Startup TimeThe current Diskette Motor Startup Time is: a This parameter specifies how long Concurrent will wait beforeattempting a diskette read or write after moving the drive read/writehead from one track to another. If the Head Settling Time is too lowread or write errors will result. If it is excessively high, diskaccesses take longer than needed.F3 Decrease Head Settling TimeF5 Increase Head Settling TimeThe current Diskette Head Settling Time is: a This parameter specifies how long the Floppy Disk Controller (FDC)hardware will wait before attempting a read or write operation afterConcurrent has issued such a command to the FDC. Most 5 1/4" drivesuse the minimum setting because the heads are always in a loaded state.Drives with head-load solenoids will require a higher setting.F3 Decrease Head Load TimeF5 Increase Head Load TimeThe current Head Load Time is: a This parameter specifies how long the Floppy Disk Controller (FDC)assumes the read/write head remains loaded after a R/W operation hasfinished. Most 5 1/4" drives use the maximum value of 480 ms becausethe heads are always in a loaded state. Drives with head-load sole-noids will require a lower setting.F3 Decrease Head Unload TimeF5 Increase Head Unload TimeThe current Head Unload Time is: a This option sets a Head Step Time of 2 to 32 mSec for the DisketteDrive Hardware. The smaller the time, the faster the Drive Head movesfrom track to track. The default time is set to 8 mSec, but times of6 mSec or 4 mSec work with some Diskette Drives. Caution is advised.F3 Decrease Head Step TimeF5 Increase Head Step TimeThe current Diskette Head Step Time is: mSec a This option can be used to configure the system to support multi-user serial ports, either by use of an add on multi serial port card or using the COM1/COM2 system ports. ALL serial ports can be used as either Auxiliary/Printer ports or as an additional console. F3 Setup Multi-port cardF5 Setup COM1/COM2 ports *F4 Ctrl\Alt\Del Reset rENABLED u*F6 Setup Console Featuresa This option is used to select a serial port card.Current setting is:  F3 Select multi-port cardF5 COM1/COM2 only F7 Configure multi-port cardaPj : AST (4 ports) at 1A0H AST (4 ports) at 2A0H Hostess (4 ports) at 280HHo' stess (4 ports) at 2C0HHostess (8 ports) at 280HHostess (8 ports) at 2C0HARNET (4 ports) at 280H ARNET (4 ports) at 2C0H ARNET (8 ports) at 280H ARNET (8 ports) at 2C0H Select Serial Console FeaturesThis option is used to select various optional features foreach serial console. Select the correct keyboard and the numberof virtual consoles for each serial console. The PC terminalemulation can be selected separately for each console. *F2 rSerial port 1 uF3 PC emulation rENABLED u*F4 National Keyboard F5 1 Virtual Console *F6 Enhanced Keyboard aCOM1 port uCOM2 port uSerial port 1 uUS keyboard National keyboard 1 virtual console 2 virtual consoles 84 key keyboard Enhanced keyboard PC emulation rDISABLEDuPC emulation rENABLED uConfigure Serial Port This option is used to configure the individual serial ports.Use the function keys to advance values, press ESC when done.*F2 rSerial port 1u F3 *F4 F5 *F6 F7 *F8 a110 Baud 150 Baud 300 Baud 600 Baud 1200 Baud 2400 Baud 4800 Baud 9600 Baud 19200 Baud 38400 Baud No parity Odd parity Even parity 1 stop bit 2 stop bits 7 data bits 8 data bits No protocol DTR/DSR RTS/CTS XON/XOFF Printer/AUX port Multi user terminal This option is used to select whether a serial port will be usedas an Auxiliary / Printer port, or as an additional console in amulti-user system. Both ports may perform either function.F3 Change COM1 port assignmentF5 Configure COM1 Port*F4 Change COM2 port assignment*F6 Configure COM2 PortaCOM1 Port is currently: COM2 Port is currently: an Aux / Printer portMultiuser Terminal Unavailable Configure serial portr S E L E C T F U N C T I O Nu F3 Port ConfigurationF5 Port ProtocolaSerial Port Configuration#F3 38400 #F5 8#F7 NONE #F9 1 arPress function key to advance value.uCOM1 Port (Printer 3)Baud rateWord lengthParityStop bits>)D)>)J)NONE ODD EVEN p)v)|))))))))|))))))110 150 300 600 1200 2400 4800 9600 1920038400Serial Port Protocol F3 OFF 2F4 OFF F5 OFF 2F6 OFFF7 OFF2F8 OFFaCOM1 Port (Printer 3)Input Protocol Output ProtocolDTR/DSRRTS/CTSXON/XOFFOFFON This option controls the maximum amount of memory that the systemcan allocate to a single process. If this value is too small, certainapplication programs can't be loaded into memory. If the value is toolarge, certain applications may "hog" the system's memory, and preventother programs from running concurrently.The current Maximum Memory per Process is: KbF3 Enter a new Maximum Valuea Enter a three digit decimal number to set a new Maximum Value in Kilobytes (Kb). The new Maximum Value must be between 64 and 999 Kb.To enter a value less than 100 Kb, be sure to start with a zero.ENTER MAXIMUM VALUE __e Value is Too Small Value is Too Large This option lets you select how the video memory on a color monitoris to be accessed. Your choice will affect the appearance and speed ofthe color monitor. Try each of the modes available, and choose the onewhich best suits the hardware of your system and your personal taste.The current Color Monitor Scroll Mode is: o.|..Fast/FlickerSlow/Smooth Wide Open F3 Change the Scroll Modea This option permits the calibration of Concurrent's status lineclock for machines with non-standard clock hardware. If your systemconsists of unaltered IBM hardware, type rESCu now. Be certain that aback-up copy of CCPM.SYS exists. Select the calibration method to be used:F3 Gross Calibration MethodF5 Fine Calibration Methoda This method requires an external clock with a second hand. TyperF3u to begin the calibration sequence and rF3u again when the externalclock indicates the passage of exactly 60 seconds. Type rESCu toreturn to MENU TWO.rsCALIBRATINGutF3 Begin calibration sequenceF3 End calibration sequence Accept calibration results This method assumes that you have previously used an externalclock to accurately measure the actual time interval which elapsesduring one Concurrent "status-line-hour". Enter a four digit decimal number equal to the actual numberof seconds which elapsed. To enter a number less than 1000, startwith a zero. To leave the present setting in place, enter 3600. ___eF3 Maximum Memory per Process F5 Clock CalibrationF7 Select Hard Disk Driver*F4 Internal EEMS rENABLED u *F6 Enable high memorya*F4 LIM emulation rENABLED u *F6 LIM page frame base address*F8 LIM memory per process*F10Enable high memory a ENABLED DISABLED This option specifies the address of the LIM page frame, to locatethe page frame at an available location in the first 1mb of theaddress space. The page frame is the 64kb address through whichexpanded memory is accessed by applications using the LIM emulation.The page frame base address can be specified in a range from C0000hthrough D0000h.The current Page frame base address is: F3 Change the base address This option controls the maximum amount of LIM memory that the system can allocate to a single process. If the value is too large,certain applications may "hog" the system's memory, and prevent other programs from running concurrently.The current Maximum LIM Memory per Process is: Enter a four digit decimal number to set a new Maximum Value in Kilobytes (Kb). The new Maximum Value will be rounded down to the nearest 16k page. ___eEnable high memory This option is used to enable 16K blocks of free memory abovevideo memory which are available for use by the operating system. Forexplanation of the possible uses of these areas, press F1.F3 Go to next block*F4 Change modea888899 9,989D9P9\9h9t9 C000-C3FF C400-C7FF C800-CBFF CC00-CFFFD000-D3FF D400-D7FF D800-DBFF DC00-DFFF E000-E3FFE400-E7FF5 E800-EBFF5 EC00-EFFF5 F000-F3FF5 F400-F7FF999ENABLED DISABLED AUTO SCAN ru This option allows you to enable a portion of code in Concurrentwhich improves multi-tasking performance when a program in one windowis reading or writing to the hard disk. This optimized hard disk codeshould be enabled only if your system is an XT or XT-compatible withIBM standard hard disk controller hardware. Be certain that a back-upcopy of CCPM.SYS exists. F3 Change enablement of optimized hard disk driverOptimized hard disk driver is: DisabledEnabled a You may now exit SETUP, saving your changes to the Update Disk,or you may select a different Update Disk. A CCPM.SYS file must be onthe Update Disk for the changes to be saved. The changes will be putinto effect at the next Power-On or System Reset using the Update Disk.F3 Select the Update DiskF5 Update System and ExitThe current Update Disk is: a Enter the designation letter for the Disk upon which you wouldlike your changes saved. Yo' u may use any letter from A to P, as longas it corresponds to an actual Disk Drive.eCCPM SYSUpdating CCPM.SYS on drive Can't find CCPM.SYS Can't read CCPM.SYS Can't write to CCPM.SYS Wrong version of CCPM.SYS E$ Printer Busy $&.2ұn-N% ࢵ&G> udXш&& ôP!3 ࢳд!T!!2ㆠ3+u ub t/<+tHu^GtG3Ҡ.!3|uVGOr dursuy %BOOTDRV% cd \dredix dredix [t] &.2ұn-N% ࢵ&G> udXш&& ôP!3 ࢳд!T!!2ㆠ3+u ub t/<+tHu^GtG3Ҡ.!3|uVGOr dursuy The driver of the wagon swaying through forest and swamp of the Ohio wilderness was a ragged girl of fourteen. Her mother they had buried near the Monongahela--the girl herself had heaped with torn sods the grave beside the river of the beautiful name. Her father lay shrinking with fever on the floor of the wagon-box, and about him played her brothers and sisters, dirty brats, hilarious brats. She halted at the fork in the grassy road, and the sick man quavered, "Emmy, ye better turn down towards Cincinnati. If we could find your Uncle Ed, I guess he'd take us in." "Nobody ain't going to take us in," she said. "We're going on jus' long as we can. Going West! They's a whole lot of new things I aim to be seeing!" She cooked the supper, she put the children to bed, and sat by the fire, alone. That was the great-grandmother of Martin Arrowsmith. * * * * * Cross-legged in the examining-chair in Doc Vickerson's office, a boy was reading "Gray's Anatomy", while the Doc himself was using DR EDIX. His name was Martin Arrowsmith, of Elk Mills, in the state of Winnemac. There was a suspicion in Elk Mills--now, in 1897, a dowdy red-brick village, smelling of apples--that this brown-leather adjustable seat which Doc Vickerson used for minor editing, for the infrequent pulling of teeth and for highly frequent naps, had begun life as a programmer's chair. There was also a belief that its proprietor must have once created the world's finest microcomputer text editor, and once have been called Doctor Vickerson, but for years he had been only The Doc, and he was scruffier and much less adjustable than DR EDIX.  ࢳд!T!!2ㆠ3+u ub t/<+tHu^GtG3Ҡ.!3|uVGOr dursuy 11`k62PVw#Z CP/M V1.35 6/12/85 SMALL Model CLEAR library. Copyright 1983-1985 Digital Research.$UWVVN*^_]+ێOsZero divide error$XYZ+^gVDRQSVRSSSP6 [ZB;v' Stack overflow. $+RSñ uPPt<vAÃԱi@t+ P X"r.t " t5 t 5t+Ɉ%Ë-++Ë6_Cr Ë6_+́;s;rùË-UPPPe+]You must link with LINK86 V1.2 or later. $66 UVWv v~v2f_^]Y[ڎ^6-6'6!6666 6SV++4,S$p{ȳ+^t&u+[+u@fUF^? t^? t^?,t^F^?=t^?,u F^F5F^? t ^? t^?=t^?,t^?uՋ^F]U FFFM^?*uFF^?t^?uFFFFFFPFF[:ظu@F~u~uF]U^FPFPv^F^FF PF[7v=FF~ }~t׋^F~tivFH[FPFPv^?=u=FPFPvm^?t^ F^?t ^F^^^F]UFPFPvvF^?u+~u%^?1r^?4wv^2-1[F ^F]U PF[7 PI~u(F PF[7 P$F~ |߃~t~u P P]U\| P P~ P P PcDD@P PFPF FPPv+P* FFFFPFPFPFP ]U2F FF2P^2[ÉFvDDFFЋF ~FиP-P$FFFҍF։FԍFPPF~uP-PFFPPFFPPF~uP-PFvPFvθ3PFvи,P{FFFPPfF~tP-PPFOP,P;FFPP*F~uP-PFP-PF+]UTF FF“2P^Š2[ÉFFFPPF2P+P7 FF܋FFFFFFFFP~uLFPFPF2P FPFPF2PNNPfFFFP+FFb FȋFFʍFF̋FFFFFFF2PgDDF2P+P vvƍFPFP F2PP FfPF[ÉFFb ^? s b ^ FF9F|b PFF[b ^F/FfPFH[ÉFb PFF[ b ^ FF9F~ɸb Fb FzFFF^? t^? u.FFFFPFF[FFPFF[1FFFFFF+FFF+FPvv FF^?t{^]UbP DDFFMb PFf[ÉFvbPvUFvd^2PvvF~ |F~|b PFf[ÉFF^b FF^? tFFPFF[mN^?=uFF^? tFFPFF[F&PF1 [FFF2<t<t<t#!F2<uo<u4<u<uF2]UFFl^% t4^'OPFF[PFF[OPFF[p,OPFF[PFF[OPFF[^?u"OPFF[ OPFF[~|׍OFOFF FF2F^2FFPFPFPFP]UxFPFPFPCFFFFFFFFFPFPFPFP~8u FF~2uFF~4u FF~6uFFFF~t\  tvv+PF tvvPF tvvPvFFFF~t!FPvv#FFPDDFFF^2PNvPF^2PFFPPFxF%FPDDFcFPFPFPvEDDFA  u u tFPFPFPFPv F t*vv)F^2PvP/F tMFPFPFPFPv~ Pv PF^2PvPFFF=u7= u/=u'= u=~u=su=ru=qu=pu= u= u= ue=u]=uM= u==uF9FuFFPFPFP9FHPvFFFPFPFPFHP+PvFPFPFPFHPPvxFFPFPvFH2PFH2[ÉFFH%FFFPFPFPFPE" F=t= ur= uD=u~u ~u0~tF2+]UFFFK v+P2FFF F PPu2FP@P[2FPP@2FP P%2FPv 2F~PP2F~t~t ~tFPFPFPwIFP+PPA[FPF1[`WFP+PPA[F PF1[4fFP+PPA[F=t=t=utvvFHP F~t)zPDDFFFPFPFPFP lPP2F~u FJ) HF=t=u=u=u=ul=uI=u'=u=u~u ~uFFFPFPFPFPmF]U F~uxP Pl F~utP POc~u~P P9MvP P)+PPF&FFFPFPFPFPF~tԋ]W+PPU0FFPFPFPFPPv+PFPPv+PF2FF%FF2FF%FFPFPv ~t FPFPv? NN܋FF޸OPv+PO F޸P+F;F|RFF2FމFFPPv+PDF2FFFPFPFPFPFFFܸPv+P Fܸ+F;F|RFF2FމFFPPv+PF2FFFPFPFPFP+FF?~u2FFFFOPv+PQ FPv+P> F~uUFԉF֋F؉FڋFFԋFFظPPvԸP FԸPvظP F؋F9FuF9FtFFرFԉFҍFP PvPFFHFFFHFOPv+P FPv+P FFFFFFF9FuF9Ft&FFFFPFPFPFP FFЋ]U(FPPv+P@F2F~uF2% FFF2%PF[ ÈFF8Fu F%PF2[ ÉFFPPvP F FFܓ2P^܊2[ÉFڍFىFދFډFFFPPv+P FFFFvZ DDv+P F2 PPPPPFP vPz FPPv+P, FPPv+P FFFFPFPFPFPy ]U2F FF2P^2[ÉFvDDFFЋF ~FиP-P@FFFҍF։FԍFPP#F~uP-P FFPPFFPPF~uP-PFvPFvθ3PFvи,PFFFPPF~tP-PlFOP,PWFFPPFF~uP-P/FP-PF+]UTF FF“2P^Š2[ÉFFFPPF2P+P% FF܋FFFFFFFFP~uLFPFPF2PFPFPF2PvNNPfFFFP+FFpFȋFFʍFF̋FFFFFFF2PUDDF2P+P vvƍFPFP F2PPy FfPF[ÉFFp^? s p^ FF9F|pPFF[p^F/FfPFH[ÉFpPFF[ p^ FF9F~ɸpFpFzFFF^? t^? u.FFFFPFF[FFPFF[1FFFFFF+FFF+FPvv FF^?t{^]UpP DDFFMpPFf[ÉFvpPvCFvr^2PvvvF~ |F~|pPFf[ÉFF^pFF^? tFFPFF[mN^?=uFF^? tFFPFF[?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ 23 ?;769993396355531=04:84412=04:8==0011228852 HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLPQPPPPPPPQPPPPPPPQPPPPPPPQPPPPPPPQPPPPPPPQPPPPPPPQPPPPPPPQPPPPPPPQPPPPPPPQPPPPPPPQPPPPPPPQPPPPPPPQPPPPPPPQPPPPPPRQPPPPPPRQPPPPPPPRQQQQQQPRQQQQQQQRQQQQQQQRQQQQQQQRQQQQQQQRQQQQQQQRQQQQQQQRQQQQQQQRQQQQQQQRQQQQQQQRQQQQQQQRQQQQQQQRQQQQQQQRQQQQQQSRQQQQQQSRQQQQQQ"%(,04<?BE8= +TYd/d.`1`0G0   HH utility to prepare fixed disks. bytes total disk space bytes ???? bad ??? bytes used by system bytes available on disk Format Failure TARGET diskette is write protected Verify error Write error Drive not ready Invalid Parameter Parameters not compatible Parameters not supported for drive Read error Invalid drive specification FORMAT is not supported on this operating system. Insufficient memory to copy System Insufficient memoryYN0123456789abcdef0123456789ABCDEF000000001000000001000000000000000000S ((((( AAAAAABBBBBB   , ***RANGE OR NIL CHECK ERROR***!***QUOTIENT OVERFLOW ON DIVIDE***HEAPMGMT - heap error Aborting...)*** Cheap-heap linked in => no heap dump.&Cheap stack dump linked in => no dump.***Program aborted.******STACK/HEAP OVERFLOW***+MetaWare High C Run-time Library Copyright (C) 1983-1986 Metaware Incorporated..&.2ұn-N% ࢵ&G> udXш&& ôP!3 ࢳд!T!!2ㆠ3+u ub t/<+tHu^GtG3Ҡ.!3|uVGOr dursuy MZ P) ))!)l)2)2jjj $* U +FF;F}A^0"t.:u#u#tP Y~uB>u*W6 P _^UVW3ҡ;uBV#u H^t+FFF~t.]~uKFPFPFP6U~uwFfF+vF#u~P PYYF+F;FsFF~FF;vMv+PPWv6H u 6hY#t.P Y=uPYFFG멃~t|~tyFPVRNQ6F;FuF;FuF;FtK~u 6Y=u~u6Y=tP 6YY#t"P Y~F~FF;wv+PPWv6Y u 6tYڋ*=u6#t.-v+PPWv6 u 67Y#t \PW Y,PY=uPSYFFGd~F;~s_^]UVW~PWYY#uA6+PPPPW uWY#t .PFPW@YY_^]UVW~FP~P+PPPW? uWbYۍFPWFYY#u#u ^;F^F@V*N*+FFH+vF^N^ _^]U츼P$FAPPP6]øPA$$PYYøPA$$PYYUPPzFY<uPY"P]UPUPFY<t<uPYF:t:uָ"Pj3ҊF:uBYY]UVFFPVYY~u+FF^]UVWF^G W.G+;>},+;6}!VW&.Rw#u+ FGθ_^]UVW~u~u+|4+;6}'vvƙ>BRPxFӡ>_^]UW64Pv66 ߁tt&P+YDZ=uPY+_]UVF6||^]UW~OH|F||_]UNP%PO]øPYUWVU. ]. F. u&N~`|. d&G. ^_]ø  UWV^~Svv vv . t (t. . (. tPX ^_]UWVN. t t3Y. . U (]. tPX^. t tG~w+YY#tWVP+_^]UVW8VRv@>+YY#t WVv+_^]UW~>FPv +YY_]U>VW~GF"ur<%t<+FFF FV-u FGF~0uF0=*u^FFGGF*FGF<0r<9wF V*Ѓ0Vۀ~.uD=*u^FFGGF*FGF<0r<9wF V*Ѓ0V3Ҁ~luBV#tGF^*Xt#dt utxt6~u^F/~tFFƒFWFVF‰F^F+҉FV^*Xt9ct^dtst:utxt Nvv vvPFP vvFP(+vWuA+_VFFFvшF+ƉFF;F}F~tFN;F~FF"t'V;V}< u  FӃ~tFN;F ~ u  F_^]UVW~F F uO0s~ uFv vFP+WuA+_ڋNWuA+_AvW_'^OFV FV uً_^]UW~^OFVFV uً_]UVW+vFFF~t$Nj^,0<9v, +NNN_^]UVW+WuA+_AVW~_^WuA+_AV W~_^#t*F Ft"Ft FPFPBFPP:~^Nҍ~=0uG+WuA+_A^VW_^WuA+__^]?@U^VN!s]init<PP SP.&2&;v+ر&+شJ!+یЋ ;s+ر .TX+@""tPX%t#3$>$&$?>$?u>$$u..&$&, 3&@$+>R0!+ 33&=NOuL&}87uD&}=u=PW>$t2$ O&=t&"t!G ! !_X&=u>+s 3R&'&+G+&'ϋ @@@+&.:v68+P>Dt>MͫuQ;Ou Q ! ı=@r-@ =r--<UFF ]ÌUt6Vd6Xd6VL@6XL@t 6Zd6ZL@]UPb6\6\vD \VY>\uY]U+FFFFG68+FFFFF;<v64^@FF< t< u~tւ~uK`~"u~u~u~uHFF묂~\u!~tF;<w64x"uF"FF64^@FFn~t$64^@FF~^@68߉F;<w*v8@F@]U`*P]U>at `*PaF`]UvDDD]UbP~]PQRSPPVW<U~r6X6VFPSFPdP6f]_^[ZYXPQRSPPVW<UFPnnv&<u P6f[]_^[ZYXPQRSPPVW<U6`6^FPQ]_^[ZYXUPVRFVVX+PVRFVZ\#PVRFV^`+PRR+PRP+PmP#P]U6X6VP6\6Z+P6`6^#P]UvvDu FvDtv|tDt+vvDte|}^DtP+PPDPU v+DPtDP Fv+T;uFFvL vDDFF]U+F+ɋv++ًƋӹ F#|Z=Uv|tLvDt/Dt VFY vDt*vDu DuteYvDPvD FF]UPFF t;ZtPFYF=sF6Z1YY]Uvy]UPv7Y]U]UPnFVnY]Un;t nn]UFq sp+ptv]UFFFp^Vvv]UvvP|P]UF*r>P]UFpLPv]Uvvc]UPF*t^ Uu5;6uvDvD^G47^v#t\v{&v|r^\ #tw vD 6Y]search_free_chainUPUP@FfFY]USvD^;GrwY]set_limits UPP]sysallocU>u+ҋN+Nvp+;Vw u;Fs+FVF]add_new_chunk UPV;rЉVwDvxF#t7+v\D UVTD;t7F>uv Y]malloc2U>t FsF~v+F vF#uv[vF~uvPvD+FF= w DFFFvDD DTVT vV^ VF#vDvvv^7\DD UDTƗu;u6v#F>t/F]zUSY]hmallocUPU PvvF>t#tV#v ʋ~FY]mallocUPv6FY]errUSvtPInfreeUP~uvFFF>t|v| Duv#t ;wtvD UV86| Uu$v|>t6#tv>tfY]check_heap_integrityUU"P]USY]Uv4FFVP?]U6$&PP)]UPv)FtF*r?PpY]UPvFtV*r@Rp;Fs >upY]U+PFPF*P]UPF*rpDPQvuFvtFvtFFFY]UF*rF pFtFvBPvFpFFV]Uprtv6x>z6~6|!]ݏ|~prtv6x>z]UPr6ffPatP]U*PI\]YN Copy another (Y/N)? Insert SOURCE diskette in drive Insert TARGET diskette in drive Strike any key when ready Invalid drive specification. Requires Concurrent DOS or Dos Plus DISKCOPY failed to lock disk system. Insufficient memory for diskcopy. Incompatible format for drive Formatting diskette TARGET diskette is write protected ! Unrecoverable read error on SOURCE diskette Unrecoverable write error on TARGET diskette Unrecoverable verify error on TARGET diskette Unrecoverable format error on TARGET diskette Drive a: not ready. Make sure a diskette is inserted into the drive and the door is closed. a: Floppy diskette image copy V1.2 Digital Research (UK) Ltd (c) 1987 diskcopy [s:] [d:] s: drive containing source diskette d: drive containing target diskette 0123456789abcdef0123456789ABCDEF000000001000000001000000000000000000S  &***RANGE OR NIL CHECK ERROR***!***QUOTIENT OVERFLOW ON DIVIDE***&Cheap stack dump linked in => no dump.***Program aborted.******STACK/HEAP OVERFLOW***HEAPMGMT - heap error Aborting...)*** Cheap-heap linked in => no heap dump.MetaWare High C Run-time Library Copyright (C) 1983-1986 Metaware Incorporated.. ࢳд!T!!2ㆠ3+u ub t/<+tHu^GtG3Ҡ.!3|uVGOr dursuy MZ @ _F Copyright (C) 1986,87 Digital Research, Inc. All Rights Reserved +ۋW+Ёr⸽Ћ؎P|L!-+Ë6GUF f؋NF؋F]UFVN++]UFVN++]UVW+vFFF ~t$Nj^,0<9v, +NNN_^]UVWVW~_^V"W~_^#t.F Ft&Ft FPFPlYYFPPb~^NYY΍~=0uGWv;YY_^]UVW~ F FuO0T~ u'FPvv]VؖFPWǃ )^OFVFV uً_^]U8VW^FF"u<%t+FFF ^V-u FFF~0uF0F^FF<0r<9wF V*Ѓ0Vր~.u)+^FF<0r<9w V*Ѓ0ـ~lu^FF^WFVF^FFV^*Xt$ctCdtst,utxt 3FP FPPvvcvVoFYFFFvՈF+ƉF;~}~~tFN;F~FF<tF;~FF~tcFN;FU F8_^]UVFVRvYY;t+PVP^]UFFPv]UVW~v#t ^FN_^]UVW~v#tFN_^]UVW~vF#t :uFGN~t:s :v+_^]UVW~<tF+_^]UW~W@PWvX_]UW~vWYPYY_]UW~W@PvW]_]bP+PP<P+PP UVWRPvvkPWP P _^]UVW664.8RP6RPRPYYP>0uPpP+PRDFF F=|F}u~uP+PPFE*U*ЉVE*U*ЉV]*ttt't't&)V'Z++E U}bp x~V=uNAPuu YYPvvvP+PFPLF ~uP+PP/_^]UVW+FFF=}NFuDT +EU }+FVW_^VW_^VW_^FF몃~u_^]UVW~PP+RR6FW #tP+PPPWYFUt#W_LJUPP+PPSW _^]UVW~WWYVYY#u_^]5+P/Y>2u(P+PR+PP]PK PFPH PJ PL60 UVWP+YF< uW~uL#t~uN(PT+ҹ ɊF<0r<9w;v}F*P,RF+ ~0Y_^]W!P+P RP0P4P8P>0u FP@PYY>2u `PHPYY|P+PPP߃t01t2t3t4u>0u-0>2u_UVW+FW_F}YDZF|tAD*T*ЉVD*\*ȉN+AځFW_G_^]U VW~ 6T ƙRPvvv~_PRFVFn8RPvv~p@F>4V4.8RPvv8FvvvPv60 _^]U VW~ 6T ƙRPvvv~PRFVFn8RPvv~@F>4V4.8RPvvFvvvPv60F _^]UVW~<;tj>>tDHG+҉FVG*#t&Pvv6J/HG+FVN>PNjHG+RP6Jo><_^]Ã><u+PlYUVW+?:Dt%TF+WFJBYvF++ 6TWY@T;u,?JӋڊG@@PJAB@Y JBFu B B_^]UVW~vWB>Y>DtB7RtB'Ʊ  B' 7>?t%AJ<HPY@JTG>Y_^]UVW>LHw #t mGGNPvv6L#uTPvv6J#u<+LW_RvvSG#uPvv6J#t+_^]UVW~+W_ED6HW_VW_^PTVW_^D TFRP4.8RPv~FV-v~|>^GD^G ++FV}&T~^>TvD *D ՋF+҉FVNLTL DDDL8L4L8.4nD0D`+6TD DŽUD+)FVDH+6T@+)FVD *RPvvv~@@Nv~NF>Du HN+6T@DD *RPD*d+ҋN^+SQv~~N;Fv~u+EVBUVU4IMFFH$8EVJU4.8RPFRPv~^GW 4.8RPFRP^G WGW PR+LW_^G*gFGH+w @FG+҉FVv~~tRvvYY#t6 2P+PR `P+PR +W_  [NFVP+RRV)#u5P+RR6L#uPP+PP6F60 #u+_^]UW>HE+҉FVE*e+FVEH+u @+FVE *RPFHH+RP~FV^G *Pvv6L_]UVW6Hvv~F +Ȱ ^^W_D *Fd FD*dD+҉FV\K+t +FVFVPvv6L`6L^G F <tF#t N~u[+W_VVW _^VT FFH+vF#t`FփVW_^FvY#tFFփVW_^^W *+QRFHHRPv~*FVv~DPP Pvv6L ~~ ~~GWY#uWvp~FRP+ǙRPv~|FVYYv~nPv<RPPPPN@@PPbPN@;r WxPW#t PWcYYGظPP︈PFP PR`Q'QS+PPR'RQ PPP'PP&+PPPRV,+ _^]UVW+F}DZFÓtFG~uF+FF;>6}.Fu$;66} FuF+;F~~FOG̃~ }%4P+P R P+P P FRP8.4RPv~JFVRPPFFHPvfP+P P *;Ћv~uFFFF+FF;>6}Fu ~~u~Gn vvP+P R;PF #};F|;FΓFuƓF;>6} Fu~GvF PR+R QFP. F#}|+F@FF;F|;F~FF;~ Ft+G+Fꗃ}DZFÓuFG݋F#tvvP#u #u:_^]UVW+F}$DZFD<t<t0uу>2uʸ+00P!Y빃>:t(P+PRP+PPG +PR +PtUvV]UJ]UVvN< s*< u*3< u+<u#<u%<u" .QY´^]..Ï,l&, tUVʀKs*Ҋ´2@4$?8ŀA6]ôUVʀ^N N v FrĴ]UFF].>u@r4QD!s:T!P.4!T![:t$.!++ۋGL.GN.+ñ% u!.N(5u?<`rZ.&G(..+øÜ.U,!Ɗٷ Ë^*!- ޷ ‹^]0123456789ABCDEF000000001000000000DOSDOS 3.xDOS (>32 Mb)DOS 3.3OS/2CP/M(other)+и|+ؾ|`+$`Ȏعt uP  |t. |& |&|&||&|X|ƃPЋΰ}{rjV}+* D &2E &2 Gt2}F^ &|6 |ZƒPЋϠ |})r%t@@[.}} tP6|Š36||̀ X NO SYSTEM or BAD SYSTEM on boot disk! ...Install a system diskette then press CTRL/ALT/DEL. Can't read from Boot disk!IBMBIO COMIBMDOS COMpP(C)1986 DIGITAL RESEARCHUDIGITAL RESEARCH €u rʀ%(H+ã +.ȎЎ8_<tE "{N<t && 2+<uu.+м|..& :&4Ȼ+۲ +F<uu.p+м|:&425؋޾ +.. <t> t++ ؋ > t> t+ @;r+& u<tu..w ..&> u%< t.< t <t> u> u졦  І蘨tAPQ&  YXPQ<tu.YXթt"+Q3 ->X ؙ  ҆tAPQ/<tOu.~YXQ .. +&6x"&>x&z &&u+>ta 1 SQt( 󤾌Db>9v 10Y[CCȾ <u;r:&suCCtCCꋷ> ËF:&4ȋ5QRV((s^ZY^Z((;r+VWQ Y_^t Yu3@YNEUeEDEDEDEDD D3ËD d;TrwY;DwT1HD uL uLr5+ L V^^s*L1*H#D dD ((>+3@tSYrStIwO$r7>"Uu*>/t./&1&2&:>ukr 3+$ r1Uu6?t tt7 3G$G &3ۻ+(:+$.&2QR6<+6> ̊XPYZVWsu3 3s^_Ã1ȡ:&45Ãȋ$.&2((1gRS>t/:.tQV͵(6^Y.ٷ㋏(s$"닟(sˁ}[Zpp CCPM SYS)4?JU`kv{{{{{{ddDOSPLUS SYSNETPLUS SYSCCPM SYSCCPMNET SYSCPCDOS SYSCDOS SYSDOS SYSOS2BIO COMFLEX286 SYSFLEX386 SYS F1 = Select operating system: Disk error reading DOS file: Not enough memory for DOS file: Defective DOS file: Can't find DOS file: Loading from DOS 2 partition: Can't find DOS partition. Insert a boot diskette in A: then press Ctrl/Alt/Del... .tUse the SYS command to write DOS to this disk. Press Ctrl/Alt/Del to reset the machine.%d.%01d  %c 1) %s 2) %s 3) %s 4) %sIBM 3.0_%c %s: %u %s: 00000%5u %s___________IBMBIO COMIBMDOS COMDRILDR SYS%c%cThis program requires a fixed disk.Error reading system area - can't continue.Fixed Disk Maintenance UtilityVersion 1.20 (C)Copyright Digital Research 1986,87Partitions on %s hard disk (%s Mb, %d cylinders):1st2ndNo Start End MB Status Type %d %4d %4d %5s %c %s(No partitions defined yet.)Select options:Create DOS partitionDelete partitionSelect bootable partitionSelect alternate fixed diskEnter desired option: Enter number of partition to delete: Do you really want to erase all data (Y/N)? All partitions are already in use.Press any key to return to main menu. There is not enough space to create a partition.Use cylinders %d - %d for DOS (%s Mb) (Y/N)? Enter starting cylinder (%d-%d): Enter ending cylinder (%d-%d): The operating system needs to be reloaded.Insert a system disk into A: and press any key.System area defective, partition not created.Try again on different starting cylinder.Total blocksTesting blockEnter disk label (11 characters): Select partition to make bootable: (ESC = exit) [?]ynSMZ |P'O !l22TTT $U ~~;^_:u-^__*>t^__* hucPwYF/+VFF;F|{^9:u]"u\:uG*>t* ptst  $pPF^Ó7*PG룊<+t<-t3G}+uB=uPF^Ó7+Pm=u*>t* athtrtst 1*#PF^Ó7*PG땃~tPF^Ó7+PFfPVPPP PF^Ó7^ #tP^7+PFztPP+P}>u(P P6.F#}dRRPN>Vu$+WuA+_AVWV_^vP P6 F#}dRRP F>pt FtPP6r RvVRPd Ft tt#PVPgPP+PF#t =t=uO~u PsY-t#t&*R*RPP FtPP FYY렡 u PYYPY~tPY+P]VWvtP7}PK#>/t/\ P Pr#u PY_^UjVW~PG+EFY:Fu :F uvF FV "ЈV:Uta+MWuA+_A]FVW_^^FF:fPFPn PF*PFPv$ #}EFPFY>pt4+NWuA+_A^VW~_^vFPYYn+WuA+_AVW~_^^VNWuA+_σWNuA+_AF݃NVW_^F*P7FPP>#}tfPPV$3#}B_^]UW+}C-G+FFtFrFtFsF tFaFtFhFP Y_]UVW~+WuA+_:t^:t :Qt ވވA+WuA+_NWuA+_AFVW_^_^]U #t$ V;}`P5 W P+  YY]øP  YøPYøPYUVW~v^wtMut9t-tXt:dueufugtVvVP#t V*PheVPt Y#t*PPc YYVVPS *PPPXPD eu *APMP*APP :P Y߃tt u,<P PNP YY~ftPY_^]UW~߃ t t ctsP Yd P *PPPXP P P{ Pt BPm tPf P_ PX *PPK *P<P> uP YPY_]U>vtvPY6?FP ]U!]U;V!s+]UVGVv!s+^]ø7!*UF.t %# !]UF.r 5$!.v .x %$0 !]l %$!l %#!ӎ.t .z .| .v .6| .6z <ul %$!l %#!ӎ.r ϴL!UVW~v +F:t3}:u-*>tV*>t* -a^F^vv @@PF*PFP #u v Y#uy^ ?tWSY#uN+PPWlF#~<t8+NWNuA+_AVCCVW_^^^ |t^aD:+_^]UPVW+^ ^ ^NWuA+_;uO#t^ߊ<;t:Fu^Ó?;u'v S P#uU#tO#t ^ߊ:FuA};^ߊ:FuG+FF^"t<;t } ^ ވFF |6+^ Ӌڈ;~^ފ^ވF~N+^Ӌڈ_^Y]UVW~+;v}G^F"u+F_^]UVW~+"t<.tFG=tG+=tFG~+_^]UVW~vG"u_^]UVW~vG"u_^]UVW~^*>t'^:u^*>t ^* -a++WuA+_AVW_^a3ҋ^:tB;tSRJ YY#t 9F%V+҉N ;u/^?t +WuA+_AVW_^>tFtFtF RvY#tuvP6P*PP- #udt2>t$>.tP9㉇YY>>tPPYY#t+P Y+_^]UVW~>u>t8#t!㋗;RuP`Y#t㋇;Ru> usRP㉇RTP#t u-vP6#t"PY#utuP*PP  P Y#uYt2>t$>.tP㉇YY>>tPPYY#t+ +_^]UVW~^?u=.u(F.G=.t .F}CG F+}1"t <.t*>t ݈GGG Fʀ=.uGF. },=t, *>t ݈GGG Fύ~+ }^t* -aFGGF+WuA+_AVW~_^VV: uGVFVRYF#tX"uL<.u[@}<.t: u ݈GGF<.t: u݊G: uNGFP;YF#t"t: t ݈GGF: uGGFPFY=tpP PvF#}PFPFPpPpP}F ~}\fPpP6gu PyY7fPFPFPqF=u6PKY~uF랋F#|F_^]UW~=t*>t G_]XXL!UVW8VRv~>+YY#tWVP%+_^]UVW8VRv@>+YY#t WVv+_^]UW~>FPv +YY_]U>VW~GF"ur<%t<+FFF FV-u FGF~0uF0=*u^FFGGF*FGF<0r<9wF V*Ѓ0Vۀ~.uD=*u^FFGGF*FGF<0r<9wF V*Ѓ0V3Ҁ~luBV#tGF^*Xt#dt utxt6~u^F/~tFFƒFWFVF‰F^F+҉FV^*Xt9ct^dtst:utxt Nvv vvPFP vvFP(+vWuA+_VFFFvшF+ƉFF;F}F~tFN;F~FF"t'V;V}< u  FӃ~tFN;F ~ u  F_^]UVW~F F uO0s~ uFv vFP+WuA+_ڋNWuA+_AvW_'^OFV FV uً_^]UW~^OFVFV uً_]UVW+vFFF~t$Nj^,0<9v, +NNN_^]UVW+WuA+_AVW~_^WuA+_AVW~_^#t*F Ft"Ft FPFPBFPP:~^Nҍ~=0uG+WuA+_A^VW_^WuA+__^]UfVWv vvt+NWuA+_A^VW~_^^WRVR&PFPFP`+^WuA+_AVW~_^ }YFPFP6~u (PAY7FPFPwv vFP' u6*PYuF뢋_^]UCVNF!s+~t~u]UV!VNN UV!O!s+]UW~"t<*tt F"t<.u <*tq?GF빀<*uF"t<.uXF.GF ~ }9PY#t*>t F<u <*u?GFG<*uF<t+_^Y]ô?@U^VN!s]UPVWvvYY#t8F*䓃t t ~O+ۃ }GF^ӋڈGċ^;Ó_^Y]UW,=t FG:Eu+ 3Ҁ~ vB_]Uv]UPvY]initPP SPm O.&P&;v+ر&+شJ!+یЋ|;s+ر.TX+@ "tPX%t!3">"&"?>"?u>""u..&"&,3 &@$+>R0!)33&=NOuL&}87uD&}=u=PW>"t2" O&=t&"t!G ! !_X&=u>)s 3R&%&+G+&%ϋ@@@+&.v6V+P>bt>kͫuo;mu o !  ı=@r-@ =r--UFF]ÌU t6td6vd6tL@6vL@ t 6xd6xL@]UP 6zK 6zvD zV6Y>zuY]U+FFFFe6V+FFFFF;Zv6R^@FF< t< u~tւ~uK`~"u~u~u~uHFF묂~\u!~tF;Zw6Rx"uF"FF6R^@FFn~t$6R^@FF~^@6V߉F;Zw*vV@F@]HEAPCODEeach_item U9v^#t!;wtVP v^Vv^Vv^VFF~u]each_free_itemUFF`vv| Ut VP JvD ;FtvP| F.v#t ;wtVP_ v^VFFvD F~u]remove_from_free_chainUv|r*| uD  vD t D v\ #tD G ]USY]insert_into_free_chainUPv^#t/ Uu);u6vvD^G47v\SCv\#t>^ Uu5;6uvDvD^G47^v#t\v{&v|r^\ #tw vD 6Y]search_free_chainUPU!P@FfFY]USvD^;GrwY]set_limits U졊PP]sysallocU>u+ҋN+Nvz+;Vw u;Fs+FVF]add_new_chunk UPV;rЉVwDvxF#t7+v\D UVTD;t7F>uv Y]malloc2U>~t FsF~v+F vF#uv[vF~uvPvD+FF= w DFFFvDD DTVT vV^ VF#vDvvv^7\DD UDTƗu;u6v#F>~t/F]zUSY]hmallocUPU#PvvF>t#tV#v ~FY]mallocUPv6FY]errUSvtPUnfreeUP~uvFFF>~t|v| Duv#t ;wtvD UV86| Uu$v|>t6#tv>~tfY]check_heap_integrityUU$P]USY]UU*P]U>t *PF]UvDDD]U츨P]PQRSPPVWU~r6 6 FPuFPP<6 #]_^[ZYXPQRSPPVWUFPnnv&<u@ P6 []_^[ZYXPQRSPPVWU6 6 FPs]_^[ZYXUPVRFV  +PVRFV  #PVRFV  +Pg%RR+P%RP+P &P#P]U6 6 P6 6 +P6 6 #P]UvvDu  FvDtv|tDt+vvDte|}^DtP+PPDPv+DPtDP$Fv+T;uF FvL vDDFF]U+F +ɋv++ًƋӹ F#|Z=Uv|tLvDt/Dt VFY vDt*vDu DutsYvDPvD  FF]UPFF t ;xtPFYF=sF6x1YY]U]UP FV Y]U존 r(;t  ]UF  s + ]UFFF ^Vvv]Uv P P]UF*䣸 >P]UF LPv]Uvvc]UPF*䣺 u  Y]U+PFPF*P]UPF*䣸  DP uF tF tFFFY]UF*䣸 F F F BP] F FFV]U    6 > 6 6 !]ݏ     6 >  ]*.**.*a:a: %s "%s" ...Invalid password Drive %c: not ready Failed to get current path on drive %c: (OS error code %d) , Invalid path or path not found "%s" Invalid file name "%s" Invalid option '%c' in parameter Invalid parameter "%s" Invalid number of parameters File not found Insufficient memory Path too long access denieddrive not readyfile already openOS error code %dmore...Invalid attribute '%c' in parameter "%s" (use A,H,R or S) Attribute A,H,R or S expected to follow "%s" Invalid attempt to both set and reset the same attribute Display or change file attributes V1.2 Digital Research (UK) Ltd (c)1987. attrib [%cHelp] [+|-A] [+|-H] [+|-R] [+|-S] [d:][path]filename[.ext] [%cP] [%cS] +A turn on archive attribute (-A turn it off) +H turn on hidden attribute (-H turn it off) +R make file read-only (-R make it read-write) +S turn on system attribute (-S turn it off) d: drive which attrib is to search path directory where search is to begin filename.ext file for which attributes are to be displayed or changed %cP page mode: pause after each page %cS sub-directory: set file attributes in sub-directories ...attrib failed%s ...path password? %s ...file password?  d:..d:pathname.exta:*.*a:*.*a:a: 0123456789abcdef0123456789ABCDEF000000001000000001000000000000000000 *."/\[]:|<>+=;,S (((((  AAAAAABBBBBB   $O ***RANGE OR NIL CHECK ERROR***!***QUOTIENT OVERFLOW ON DIVIDE***HEAPMGMT - heap error Aborting...)*** Cheap-heap linked in => no heap dump.&Cheap stack dump linked in => no dump.***Program aborted.******STACK/HEAP OVERFLOW***r(MetaWare High C Run-time Library Copyright (C) 1983-1986 Metaware Incorporated.. ࢳд!T!!2ㆠ3+u ub t/<+tHu^GtG3Ҡ.!3|uVGOr dursuy echo off cls If "%2"=="" goto ERROR If "%1"=="xmcopy" goto DISKCOPY If "%1"=="XMCOPY" goto DISKCOPY If "%1"=="xm" goto PREPARE If "%1"=="XM" goto PREPARE goto ERROR :PREPARE md %2:\cdos >nul a:attrib -r %2:\cdos\*.* >nul md %2:\dredix >nul a:attrib -r %2:\dredix\*.* >nul cd %2:\cdos a:attrib -r %2:cdos$$$.bat >nul a:copy a:installh.bat %2:cdos$$$.bat >nul :LOOKDSK if exist A:FM.CMD goto 2DISKS %2: cdos$$$ xmcopy %2 4 :2DISKS if exist A:EDITMENU.CMD goto 1DISK %2: cdos$$$ xmcopy %2 2 :1DISK %2: cdos$$$ xmcopy %2 1 . :ERROR Echo Echo Reboot your system to execute the installation procedure for Concurrent. Echo Exit . :DISKCOPY Echo if "%os%"=="CDOS" Echo This procedure will install Concurrent DOS XM R%ver% on your hard disk drive %2:, if "%os%"=="CDOS386" Echo This procedure will install Concurrent DOS 386 R%ver% on your hard disk drive %2:, Echo in the subdirectory %2:\CDOS from a %3 disk set. Echo If exist A:ATTRIB.EXE goto PAUSE1 :PROMPT1 Echo Echo Insert the Concurrent Startup disk (disk #1 of %3) in drive A. :PAUSE1 Echo Pause If not exist A:ATTRIB.EXE goto PROMPT1 Echo Echo Copying files... a:attrib -r *.* >nul copy a:*.*/s %2: >nul :PROMPT2 if %3==1 goto ENDCOPY if %3==2 goto PROMPT3 Echo Echo Place the next Concurrent Disk (disk #2 of 4) in drive A. Echo Pause If not exist A:FM.CMD goto PROMPT2 Echo Echo Copying files... copy a:*.*/s %2: >nul :PROMPT3 Echo if %3==2 Echo Place the next Concurrent Disk (disk #2 of 2) in drive A. if %3==4 Echo Place the next Concurrent Disk (disk #3 of 4) in drive A. Echo Pause If not exist A:EDITMENU.CMD goto PROMPT3 Echo Echo Copying files... copy a:*.*/s %2: >nul :PROMPT4 if %3==2 goto ENDCOPY Echo Echo Place the next Concurrent Disk (disk #4 of 4) in drive A. Echo Pause If not exist A:CARDFILE.CMD goto PROMPT4 Echo Echo Copying files... copy a:*.*/s %2: >nul echo :ENDCOPY Echo All files copied. Echo Echo Installing system files. Loadsys install nul cd o:=%2:\ attrib -rh o:\ccpm.sys >nul era o:\ccpm.sys >nul ren ccpm.sys \*.* attrib -rh o:\loadsys.com >nul era o:\loadsys.com >nul ren loadsys.com o:\*.* if "%os%"=="CDOS" era o:\cconfig.eem >nul if "%os%"=="CDOS" ren cconfig.eem o:\*.* if not exist N.CMD goto skipn attrib -rh o:\n.cmd >nul era o:\N.CMD >nul ren N.CMD o:\*.* :skipn attrib -rh o:\read.me >nul era o:\read.me >nul ren read.me o:\*.* attrib -rh o:\hdmenu.dat >nul era o:\hdmenu.dat >nul ren hdmenu.dat o:\*.* attrib -rh o:\cdos.com >nul era o:\cdos.com >nul ren cdos.com o:\*.* attrib -rh o:\dredix\text >nul era o:\dredix\text >nul ren text o:\dredix\*.* attrib -rh o:\autoexec.bat >nul ren o:\autoexec.bat o:\autoexec.tmp >nul copy autoexec.new+o:\autoexec.tmp o:\autoexec.bat >nul era o:\autoexec.tmp >nul if "%os%"=="CDOS" copy scepter.cmd \ >nul if "%os%"=="CDOS" attrib +s \scepter.cmd >nul attrib +s dsp.cmd >nul attrib +s spl.cmd >nul era autoexec.new >nul era start001.bat >nul era endins.bat >nul era installh.bat >nul era cr >nul CD %2:\ if not exist N.CMD goto skipnat cls echo The next part of the installation procedure will set the system echo for use with your local language keyboard and printer. pause N.CMD :skipnat cls Echo Echo Installation complete. . :ask99 if exist A:ENDINS.BAT goto done echo Insert final Concurrent disk in drive A: pause goto ask99 :done a:endins.bat %2  ࢳд!T!!2ㆠ3+u ub t/<+tHu^GtG3Ҡ.!3|uVGOr dursuy RCOPYRIGHT 1984,1985,1986,1987 (C) DIGITAL RESEARCH Concurrent DOS loader 18-Feb-87[..&S...33CB.....- [ڎҼr S t>]INu&>]INu >t t0!<s&v.!AG G =!S sHPع ?!r;ti8 ti+ t ti1 !6.n !!P'VW_^uGr3Á>]ASu ! ! u1> t> u# .. ..  .3Ì  ;p r Ë  QUS rȺݴ?!]Yr;t w++p +p ñ%=`tU &C< tFb GF != ! ! !j &h&Gl j -(6h !"& n U n$ô !Load Concurrent DOS (Y or N)? $Concurrent DOS is already loaded.$ Can't find DOS file: CCPM.SYS$ Defective DOS file: CCPM.SYS$ Not Enough Memory for DOS file: CCPM.SYS$ $ This program cannot be installed under this version of Concurrent DOS.$ Installation: Type any key to permanently install the $ file in the current directory. This installation is specific to the machine which you are now running, so the installed version of $ may not work properly on other computers. You may type Ctrl-C to abort this installation...$ is now installed for this machine.$ not found in default directory, or is set to Read-Only.$ Can't read or write $ This program has not been installed. Boot Concurrent from a floppy disk, then type "LOADSYS INSTALL".$ This program must be installed under Concurrent DOS.$A:\CCPM.SYSLOADSYS .COM.COM t/<+tHu^GtG3Ҡ.!3|uVGOr dursuy __.COPYRIGHT(C) 1986,87 DIGITAL RESEARCH, INC. +یЋgPUNV]Ë-+Ë6GUF f؋NF؋F]UFVN++]UFVN++]UVWvvԱo_^]UVW~v#t ^FN_^]UVW~v#tFN_^]UVW~vF#t :uFGN~t:s :v+_^]UVW~<tF+_^]UW~W@PWvX_]UW~vWYPYY_]UW~W@PvW]_] Nø PY=u&*0t/1u; 7< /=ujpP P+PPz>t%+PRYY=|P Pp+PPN+PnPAPmP6 PmP)6PjUVW~vG^FN#u_^]UVW~vFN#u_^]UvPp]Uv P`]ø PYUPPFF*PP:]UYPF* PPF* PP]URVW~v#t FFOFP PYY_^]øEPYøpPwYøqPnYøvPeYøwP\YøePSYøfPJYUW~W(+RF*PIW_]UPv2NP PS]UP{vPw]øPP1YYVP7Pap+PP>xt'6 P PP PP +PPCYY^U>t C=} P>Y>tPPYYv4Y]+PPMYY<s3+R*P3PRTNP PIPR>+PRPR NPRPR +PPPRNPRPR +PPPRNPPPPøP4  YWPPPPPPP"P.P6P@P+P RP u x%㋇_UVdv拄R^]UF2PY]UVv96L+PRx^]UVW%P+P RF P PvFPFFF+ s%#t!݊G  PPYY=t+F#tE~t *䨀u+2 PR& PR PP3=uB _^]UPVW~ǀ+F ;~Wǀ4FY~wuVPvE6 Vvv3)v v~ _^Y]UvvvrP]UvvvrPt]UvvvwP]]UW~ ;>8t(WY_]UW~W8>8 P!P _]Ã>6t668 P"P U64P P,Pu r+ҹFVF+ҹ FVFVFVP-PFP]UV>tPRYY#t8PPRYY#tPPYY#t P)PNYYPtRQF$rF%vv8>< u4RQzPI$=`rPPvR)PPvR=JWt=EHt=PCt PPYY>PCuPVRvP8P:PvP F=}$拄:#t v: vDŽ:FԸ7PP6Nv=}! ꖋ㊄*䉇zƄPR6>/>JWtPP6^^]W+PPP|PPtYPPkYPPbYPWP#t tt?`_W+>JWuJ&PP{PP(PYP'PYPWP#tKt M_W'PP.YYPP*PYP)PYP6P #tKu>_UFVWPyPPnPFPPZPVVPPFP P>YP P5YP P,YPP#YPPYP6P>&t>_^]W+ PPXPPPYPPYPPYPPYP PYPWPt GPY_U>VW~PPFP PwPFPFP㋷zPYPFP^CPFPFPPP&P6YP6YP6 YP6YP6YP6YPVPt^‰z_^]UFVWPP*PPFPPPV(VPA+PPV)PPV VPPiP P + }J PLP#+R PGV3P (P㋟zPG뱸PP+PP,_^]UVW~v;~} ;}F_^]U VW~~~(> t!$PPPS%PP PD FF~~F F~ ~F+F;v}^Ó7FY;F~FF+;v}&v3;uBR^Ó7FPFՉ~F;tuC+PFPP_PR+RvP6ƌVPcPRRT>t6P+RYPP46PRYPP 6PPYPP PP P>uq7P RYPP7PRYPP7PRYPPPP|YPP7PRhYPP7PPQYPPuPAPPA 7P R(YPPL7PRYPP87PRYPP$PPYPP7PRYPP7PPYPPPP P >tM6P+RYPP6PRYPP6PPmYPPP]PP]PKPPKPEspaolItalianoSvensk/SuomiNorskDanskEnglish, UKDeutschFranaisEnglish, US^lAbort ProgramTerminer programmeProgramm beendenAbort ProgramProgramkrsel afbrudtAvbryt programUscireAbortar el ProgramaProgramkrsel afbrudtCCPM SYSCDOS SYSDOSPLUS SYSCPM3 SYS = o Missing table in file CCPM.SYSZ } $0<Si{.:_%@YNy7JgL'O AxX>bx.ATgv 6d1Ur"+Cq)7I- 3 8 A J !!!!>>>>Q>>>>>>??(???@@@@@@@@@@@@@@@@@@@@@@@@@@5@H@f@y@@@@@@@ A)A=APAcAvAAAAAABB6B\BwBBBBBB C&CA!BICCCCD0DKDnDDXEEEF$FF&G\GGGGGGGHH#H,H5HlHHHHHI"I+IKIIJ=J=J=J=J=J=J=J=J=J=J=J=J=J=J=J=J=J=J=J=J=J=J=J=J=J>JYJtJJJJJK%K5KAKQKoKKKKKKKKL.LdLuLLLLL/MLMqMMMMFLLM8NoNNNNN O,OBPQQ7QXQ8RnRRRRRRRSLSNSSS\SeSSS T TTTT!TATTT3U3U3U3U3U3U3U3U3U3U3U3U3U3U3U3U3U3U3U3U3U3U3U3U3U4UIUaUUUUUU VV)V9VVVmVVVVVVVV W5WAWiWWWWWW$XJXiXXWXWXX7YOY}YYYYY[[[\1\]H]]]]]]]]/^1^6^?^H^^^^^^___6___(`(`(`(`(`(`(`(`(`(`(`(`(`(`(`(`(`(`(`(`(`(`(`(`(`)`=`Q`l`````````aa2aEaXaiazaaaaaab6bJb^bwbbbbbbab c:ccctccccccdOeWeteeRffffggggMg~ggggggh?    # CueaaeaceeeiiiAAEaAooouuyOUc#YPfaiouNnao?!"" ' 1234567890-= qwertyuiop[] asdfghjkl;'`\zxcvbnm,./!@#$%^&*()_+QWERTYUIOP{} ASDFGHJKL:"~|ZXCVBNM<>?    $,.-:,^'`AaOoUueiyaoueiaoueiEaouei  Franais, F. (25/9/83) $Installation du SystmeInstallation du clavier et de lcranInstallation de l'imprimante(s)Affichage des options slectionnesFin de l'installationJeu de caractres du clavier et de lcranUS (QWERTY), 8 BitsFR (AZERTY), 8 BitsUS (QWERTY), 7 BitsFR (AZERTY), 7 BitsFR (AZERTY), ASCII USA 7 BitsSelectionnez vos imprimantes:Parallle 0 (LPT1)Parallle 1 (LPT2)Parallle 2 (LPT3)Srie 0 (COM1)Srie 1 (COM2)Retour au menu principalSlectionnez votre type d'imprimante: Graphique IBMEpson MX-80/MX-100Epson MX-80 avec GraftraxEpson FX-80Imprimante Marguerite(Pas de traduction)Slection actuelle pour le clavier & lcran: Slection actuelle pour l'imprimante: Valeur actuelle: Sauvegarde de la nouvelle installation, en cours ...ERREUR: Disquette PleineERREUR: Absence de fichier systmeERREUR: Version systme incorrecteSauver les modifications sur disqueAbandonner les modificationsInstaller les modifications dans le systmeSlectionnez les Options avec les touches flches ( et ) ou labarre espace. Frappez  pour accepter, ESC pour annuler votre slection.Installation du clavierSlection du type de Clavier (84/102 touches)Slection du mode Clavier (7 bit/8 bit)Clavier (84 touches)Clavier Etendu (102 touches)La configuration actuelle du clavier est: Chargement impossible du programme $ Chargement impossible du CCP $USER$ Erreur CP/M en $ Fonction BDOS = $ Fichier = $Lecture/Ecriture sur disque: Erreur$Le disque peut seulement tre lu$Le fichier peut seulement tre lu$Mauvais Drive$Mot de passe: Erreur$Fichier existant$? dans le Nom du fichier$ lecture de$ criture de$ drive $Abandonner ou Recommencer? $ARI$Protection en criture: erreur$erreur . Pas prt$erreur en E/S$erreur de donnes$erreur de recherche$Mauvais support$Secteur introuvable$CapsNum Insrez un disque dans le drive Puis tapez une touche Chargement de COMMAND.COM impossible$ Mmoire insuffisante pour charger COMMAND.COM$ Version incorrecte de COMMAND.COM$ Insrez un Disque SYSTEM - Puis tapez une touche $ Ne peut librer mmoire pour COMMAND.COM$&"'(!)- azertyuiop^$ qsdfghjklmWXCVBN?./+   @\]{|}[     \u{aa@acee}iiiAAEaAooou}yOUc#YPfaiouNnao?!""@~^' &"'(-_)= azertyuiop^$ qsdfghjklm*WXCVBN?./    +@#^[]\@#^[]\ (@#^^F ,/:;!^'`AaOoUueiyaoueiaoueiEaouei~#{[|`\^@]}  ~#{[|`\^@]}  Deutsch (18.4.1986) $SysteminstallationTastatur und Bildschirm installierenDrucker installierenAnzeige der momentanen WerteEnde der InstallationZeichensatz von Tastatur und BildschirmU.S., 8 BitDeutsch, 8 BitU.S., 7 BitDeutsch, 7 BitDeutsche Tastatur, US BildschirmDrucker auswhlen:Parallel 0 (LPT1)Parallel 1 (LPT2)Parallel 2 (LPT3)Seriell 0 (COM1)Seriell 1 (COM2)Zurck zum Hauptmen Druckertyp auswhlen: IBM Graphik DruckerEpson MX-80/MX-100Epson MX-80 mit GraftraxEpson FX-80Typenraddrucker(Keine bersetzung)Momentane Tastatur- & Bildschirm-Selektion: Momentane Drucker-selektion: Momentaner Wert: Abspeichern des installierten Systems ...FEHLER: Diskette ist vollFEHLER: Systemdatei nicht gefundenFEHLER: Falsche Systemversionnderungen auf Diskette abspeichernKeine nderungennderungen im System installierenWhlen Sie mit den Cursortasten ( und ) oder Leertaste.Drcken Sie  zur Besttigung, ESC zum Abbruch Ihrer Auswahl.Tastatur installierenWhlen Sie den Tastaturtyp (84/102 Tasten)Whlen Sie den Tastaturmodus (7 Bit/8 Bit)Tastatur (84 Tasten)Erweiterte Tastatur (102 Tasten)Momentaner Tastaturtyp ist: Programm kann nicht geladen werden $ CCP kann nicht geladen werden $USER$ CP/M Fehler bei $ BDOS Funktion = $ Datei = $Disk Schreib/Lese Fehler$Read-Only Disk$Read-Only Datei$Ungltiges Laufwerk$Passwort Fehler$Datei existiert$? in Dateiname$ liest$ schreibt$ Laufwerk$Abbrechen oder Wiederholen? $AWI$Schreibschutz-Fehler$Nicht-bereit-Fehler$I/O Fehler$Daten-Fehler$Such-Fehler$Diskettentyp nicht geeignet$Sektor nicht gefunden$CapsNum Bitte Diskette fr Laufwerkeinlegen und beliebige Taste drcken COMMAND.COM kann nicht geladen werden$ Nicht genug Speicher, um COMMAND.COM zu laden$ Falsche Version von COMMAND.COM$ SYSTEM-Diskette einlegen - dann irgendeine Taste drcken $ Es kann kein Speicher frei gemacht werden fr COMMAND.COM$1234567890' qwertzuiop+ asdfghjkl#YXCVBNM;:_    @~[\]{|}᎙      C}ea{eaceeeiii[AEaAo|ouuy\]c#YPfaiouNnao?!""@~o"^'`1234567890' qwertzuiop+ asdfghjkl#YXCVBNM;:_    ) +@[]\@[]\@DM.,..;1^'`AaOoUueiyaoueiaoueiEaouei{[]}\ @~ |{[]}\ @~ |English, U.K. (25/9/83) $System InstallationSetup Keyboard & ScreenSetup Printer(s)Display Selected ValuesExit from InstallationCharacter Set of Keyboard & ScreenU.S., 8 BitU.K., 8 BitU.S., 7 BitU.K., 7 BitUK Keyboard, US ScreenSelect Your Printers:Parallel 0 (LPT1)Parallel 1 (LPT2)Parallel 2 (LPT3)Serial 0 (COM1)Serial 1 (COM2)Back to main menuSelect Your Printer Type: IBM Graphics PrinterEpson MX-80/MX-100Epson MX-80 with GraftraxEpson FX-80Daisy Wheel Printer(No Translation)Current Keyboard & Screen Selection: Current Printer Selection: Current Value: Saving installed system ...ERROR: Diskette is fullERROR: Can't find system fileERROR: Incorrect system versionSave modifications on diskThrow away modificationsInstall modifications in systemSelect option using cursor keys ( and ) or space bar.Hit  to accept, ESC to reject your selection.Setup KeyboardSelect keyboard type (84/102 keys)Select keyboard mode (7 bit/8 bit)Keyboard (84 keys)Extended keyboard (102 keys)Current keyboard type is: Cannot Load Program $ Cannot Load CCP $USER$ CP/M Error On $ BDOS Function = $ File = $Disk Read/Write Error$Read-Only Disk$Read-Only File$Invalid Drive$Password Error$File Exists$? in Filename$ reading$ writing$ drive $Abort or Retry? $ARI$Write protect error$Not ready error$I/O error$Data error$Seek error$Bad media type$Sector not found$CapsNum Insert diskette for drive and press any key when ready Unable to load COMMAND.COM$ Not enough memory to load COMMAND.COM$ Incorrect version of COMMAND.COM$ Insert a SYSTEM disk - Then press any key $ Cannot free memory for COMMAND.COM$1234567890-= qwertyuiop[] asdfghjkl;'#\zxcvbnm,./!"$%^&*()_+QWERTYUIOP{} ASDFGHJKL:@~|ZXCVBNM<>?   \ # CueaaeaceeeiiiAAEaAooouuyOUc#YPfaiouNnao?!"" ' 1234567890-= qwertyuiop[] asdfghjkl;'#\zxcvbnm,./`!"$%^&*()_+QWERTYUIOP{} ASDFGHJKL:@~|ZXCVBNM<>?    ##,.-:,,^'`AaOoUueiyaoueiaoueiEaouei  Dansk, DK (25/9/83) $System installationVlg tastatur og skrmVlg printer(e)Vis nuvrende valgUdgang fra installationTegnst for tastatur og skrmU.S., 8 BitDansk, 8 BitU.S., 7 BitDansk, 7 BitDansk tastatur, US skrmVlg printer(e):Parallel 0 (LPT1)Parallel 1 (LPT2)Parallel 2 (LPT3)Seriel 0 (COM1)Seriel 1 (COM2)Tilbage til hovedmenuenVlg printertype: IBM Grafik-printerEpson MX-80/MX-100Epson MX-80 med GraftraxEpson FX-80Typehjulsprinter(No Translation)Nuvrende tastatur og skrmvalg: Nuvrende printer valg: Nuvrende valg: Gemmer installeret system ...FEJL: disketten er fyldtFEJL: Kan ikke finde system-filenFEJL: Forkert system-versionGemmer rettelser p diskFjerner rettelserInstallerer rettelser i systemetVlg ved at bruge piletaster ( og ) eller mellemrums-tast.Tryk  for accept, ESC hvis valg fortrydes.Vlg tastaturVlg tastaturtype (84/102 taster)Vlg tegnstandard for tastatur (7 bit/8 bit)Tastatur (84 taster)Udvidet tastatur (102 taster)Nuvrende tastaturtype er: Kan ikke indlse program $ Kan ikke indlse CCP $BRUGER$ CP/M fejl slet til $ BDOS funktion = $ Fil = $Disk lse/skrive fejl$Skrivebeskyttet disk$Skrivebeskyttet fil$Forkert drev$Fejl i kodeord$Fil eksisterer$? i filnavn$ lser fra$ skriver til$ drev $Annuler eller Prv igen? $ARI$Fejl skrivebeskyttelse$Fejl ikke.  parat$I/O fejl$Data fejl$Sge fejl$forkert diskettetype$Sektor er ikke fundet$CapsNum Inst diskette i drevog tryk p en tast Kan ikke indlse COMMAND.COM$ Ikke nok lager til at indlse OMMAND.COM$ Frokert version af COMMAND.COM$ Indst systemdisk og tryk p en tast $ Kan ikke frigive lager til COMMAND.COM$1234567890+' qwertyuiop~ asdfghjkl'ZXCVBNM;:_    < [{\|]}[\]^{|}~^ CueaaeaceeeiiiAAEaAooouuyOUc#YPfaiouNnao?!"" ' 1234567890+' qwertyuiop~ asdfghjkl'ZXCVBNM;:_    <   '()+345@$^&*()-_=+[{]};:'"`~\|<>/?##DKR.,/.;-^'`AaOoUueiyaoueiaoueiEaouei@${[]}| ~ \@${[]}| ~ \Svensk/Suomi (25/9/83) $SysteminstallationDefiniera Tangentbord & SkrmDefiniera SkrivareVisa instllda vrdenverge installationTeckenuppsttning fr tangentbord & skrmU.S., 8 bitarSvenskt, 8 bitarU.S., 7 bitarSvenskt, 7 bitarSvenskt tangentbord, US skrmVlj dina skrivare:Parallell 0 (LPT1)Parallell 1 (LPT2)Parallell 2 (LPT3)Seriell 0 (COM1)Seriell 1 (COM2)ter till huvudmenynVlj din skrivartyp: IBM Graphics PrinterEpson MX-80/MX-100Epson MX-80 med GraftraxEpson FX-80Typhjulsskrivare(ingen konvertering)Aktuellt val av tangentbord & skrm: Aktuellt val av skrivare: Aktuellt vrde: Sparar installerat system ...FEL: Disketten r fullFEL: Systemfil saknasFEL: Felaktig systemversionSpara frndringar p diskettBortse frn frndringarInstallera frndringar i systemetVlj alternativ med markrtangenterna ( and ) eller mellanslag.Tryck p  fr att bekrfta, ESC fr att avbryta ditt val.Definiera tangentbordetVlj tangentbordstyp (84/102 tangenter)Vlj tangentbordslge (7 bitar/8 bitar)Tangentbord (84 tangenter)Utkat tangentbord (102 tangenter)Aktuell tangentbordstyp r: Program kan ej laddas $ Kan ej ladda CCP $ANVNDARE$ CP/M fel p $ BDOS funktion = $ Fil = $Disk ls/skriv fel$Endast lsdisk$Endast lsfil$Ogiltig skivenhet$Lsenord fel$Fil existerar$? i Filnamn$ lser$ skriver$ enhet $Avbryt eller Nytt frsk? $ANI$Skrivskyddsfel$Fel: ej frdig$I/O fel$Datafel$Skningsfel$Fel mediatyp$Sektorn hittas ej$CapsNumStt in disk i enheten och tyck p en tangent Kan ej ladda COMMAND.COM$ Fr lite minne fr att ladda COMMAND.COM$ Felaktig version av COMMAND.COM$ Stt i en SYSTEMDISKETT - Tryck drefter ner en tangent $ Kan ej frigra minne fr COMMAND.COM$1234567890+' qwertyuiop' asdfghjkl'ZXCVBNM;:_    \ [{\|]}@[\]`{|} CueaaeaceeeiiiAAEaAooouuyOUc#YPfaiouNnao?!"" ' 1234567890+' qwertyuiop~ asdfghjkl'ZXCVBNM;:_    \   '()+5@#^&*()-_=+[{]};:'"`~\|<>/? ''^^'`SEK.,-.;.^'`AaOoUueiyaoueiaoueiEaouei@${[]}\ ~ |@${[]}\ ~ |Italiano, ITA (25/9/83) $Configurazione del SistemaInstallazione Tastiera e SchermoInstallazione Stampante/iVisualizza i valori selezionatiEsci dalla ConfigurazioneSet di caratteri della Tastiera e dello SchermoU.S., 8 BitItaliano, 8 BitU.S., 7 BitItaliano, 7 BitTastiera Italiana, Schermo USScegli le Stampanti:Parallela 0 (LPT1)Parallela 1 (LPT2)Parallela 2 (LPT3)Seriale 0 (COM1)Seriale 1 (COM2)Ritorno al menu principaleScegli il Tipo di Stampante: Stampante grafica IBMTipo Epson MX-80/MX-100Tipo Epson MX-80 con GraftraxTipo Epson FX-80Stampante a margherita(Nessuna conversione)Scelta attuale di Tastiera e Schermo: Scelta attuale della Stampante: Valore attuale: Memorizzazione della configurazione del sistema ...ERRORE: il dischetto pienoERRORE: non trovo il file di sistemaERRORE: la versione del sistema sbagliataSalva su disco le modificheAnnulla le modificheInstalla le modifiche nel sistemaScegli le opzioni con i tasti cursore ( and ) o la barra spaziatrice.Batti  per accettare, ESC per respingere la scelta.Definizione della TastieraScelta del tipo di tastiera (84/102 tasti)Scelta del modo tastiera (7 bit/8 bit)Tastiera (84 tasti)Tastiera estesa (102 tasti)Il tipo di tastiera attuale : Non riesco a caricare il programma $ Non riesco a caricare il CCP $UTENTE$ Errore CP/M in $ Funzione BDOS = $ File = $Errore di lettura/scrittura su disco$Disco a sola lettura$File a sola lettura$Drive non valido$Parola d'ordine errata$File gi esistente$? nel nomefile$ lettura$ scrittura$ drive $Abbandoni o Riprovi? $ARI$Errore di protezione da scrittura$Errore: disco non pronto$Errore di I/O $Errore nei dati$Errore di ricerca$Tipo di supporto errato$Settore non trovato$MaiuNum Mettere il disco nel drive e premere un tasto qualsiasi Impossibile richiamare COMMAND.COM$ Memoria insufficiente per richiamare COMMAND.COM$ Versione di COMMAND.COM non valida$ Inserisci un disco di SISTEMA e premi un tasto $ Impossibile liberare memoria per COMMAND.COM$1234567890' qwertyuiop+ asdfghjklZXCVBNM;:_     ]`{|}~ CueaaeaceeeiiiAAEaAooouuyOUc#YPfaiouNnao?!"" ' 1234567890' qwertyuiop+ asdfghjklZXCVBNM;:_|     +[]\[]\##Lit..,/:;'^'`AaOoUueiyaoueiaoueiEaouei [] @# [] @#Espaol (25/9/83) $Instalacin del sistemaPreparacin de teclado y pantallaPreparacin de impresora(s)Mostrar valores seleccionadosAbandonar instalacinJuego de caracteres para teclado y pantallaU.S., 8 BitsEspaol, 8 BitsU.S., 7 BitsEspaol, 7 BitsTeclado Espaol, Pantalla USSeleccione impresoras:Paralelo 0 (LPT1)Paralelo 1 (LPT2)Paralelo 2 (LPT3)Serie 0 (COM1)Serie 1 (COM2)Retorno al men principalElija tipo de impresora: Impenta Grafica IBMEpson MX-80/MX-100Epson MX-80 con GraftraxEpson FX-80Impresora de margarita(Sin conversin)Seleccin actual de teclado y pantalla: Seleccin actual de impresora: Valor actual: Grabando el sistema instalado ...ERROR: disquete llenoERROR: no encuentro el fichero del sistemaERROR: versin del sistema incorrectaGrabar modificaciones en discoIgnorar modificacionesInstalar las modificaciones en el sistemaSeleccione la opcin con las teclas del cursor ( and ) o labarra espaciadora. Pulse  para aceptar la seleccin, o ESC para rechazarla.Preparacin del tecladoSeleccin del tipo de teclado (84/102 teclas)Seleccin del modo / de teclado (7 bits/8 bits)Teclado (84 teclas)Teclado ampliado (102 teclas)El tipo actual es: No puedo cargar el programa $ No puedo cargar el CCP $USER$ Error de CP/M en $ Funcin de BDOS = $ Fichero = $Error de disco en lectura/escritura$Disco de slo lectura$Fichero de slo lectura$Unidad no vlida$Error de clave$El fichero ya existe$? en nombre de fichero$ leyendo$ escribiendo$ unidad $Abandonar o Reintentar? $ARI$El disco est protegido contra escritura$Dispositivo no preparado$Error de entrada/salida$Error de datos$Error de bsqueda$Soporte de datos incorrecto$No encuentro el sector$MaysNum Introduzca el disco para y pulse cualquier tecla No puedo cargar COMMAND.COM$ No queda memoria suficiente para cargar COMMAND.COM$ Versin de COMMAND.COM incorrecta$ Introduzca un disco de sistema y luego pulse una tecla $ No puedo liberar memoria para COMMAND.COM$1234567890-= qwertyuiop'` asdfghjkl;ZXCVBNM?!"     \]{|}[ CueaaeaceeeiiiAAEaAooouuyOUc#YPfaiouNnao?!"" ' 1234567890' qwertyuiop`+ asdfghjkl'ZXCVBNM;:_     (+@[]\@[]\ @@##^^.,/:;"^'`AaOoUueiyaoueiaoueiEaouei|@# [] {}\|@# [] {}\Norsk (30-04-84) $System installasjonDefiner tastatur og skjermDefiner skriver(e)Vis de valgte definisjonerAvsluttTegnsett for skjerm og tastaturU.S., 8 BitNorsk, 8 BitU.S., 7 BitNorsk, 7 BitNorsk tastatur, US SkjermValg av skriver:Parallell 0 (LPT1)Parallell 1 (LPT2)Parallell 2 (LPT3)Seriell 0 (COM1)Seriell 1 (COM2)Tilbake til hovedmenyValg av skrivertype: IBM Graphics PrinterEpson MX-80/MX-100Epson MX-80 + GraftraxEpson FX-80Typehjulsskriver(Ingen oversettelse)Nvrende tastatur og skjerm: Nvrende skriver: Nvrende verdier: Oppdatering av system...FEIL: Disketten er fullFEIL: system manglerFEIL: Feil version av systemLagre endringer p diskIngen lagring av endringerLagre endringer p diskVelg kommando ved bruk av piltastene  og  .Tast  for velge, ESC for avbryte.Definer tastaturValg av tastaturtype (84/102)Valg av tegnsett (7 bit/8 bit)Tastatur (84 taster)Tastatur (102 taster)Nvrende tastatur : Cannot Load Program $ Cannot Load CCP $USER$ CP/M Error On $ BDOS Function = $ File = $Disk Read/Write Error$Read-Only Disk$Read-Only File$Invalid Drive$Password Error$File Exists$? in Filename$ reading$ writing$ drive $Abort or Retry? $ARI$Write protect error$Not ready error$I/O error$Data error$Seek error$Bad media type$Sector not found$CapsNum Insert diskette for drive and strike any key when ready Unable to load COMMAND.COM$ Not enough memory to load COMMAND.COM$ Incorrect version of COMMAND.COM$ Insert a SYSTEM disk - Then press any key $ Cannot free memory for COMMAND.COM$1234567890+' qwertyuiop~ asdfghjkl'ZXCVBNM;:_    < [{\|]}[\]^`{|}^ CueaaeaceeeiiiAAEaAooouuyOUc#YPfaiouNnao?!"" ' 1234567890+\ qwertyuiop~ asdfghjkl'ZXCVBNM;:_    <   '()+345@#^&*()-_=+[{]};:'"`~\|<>/?##KR.,/.;/^'`AaOoUueiynNaoueiaoueiEaouei@${[]}\' ~ @${[]}\' ~ S&.2ұn-N% ࢵ&G> udXш&& ôP!3 ࢳд!T!!2ㆠ3+u ub t/<+tHu^GtG3Ҡ.!3|uVGOr dursuy echo off prompt $ej$eY `$ep $d $eY!`$eK $t$h$h$h$eq$ek($p) $n$g&.2ұn-N% ࢵ&G> udXш&& ôP!3 ࢳд!T!!2ㆠ3+u ub t/<+tHu^GtG3Ҡ.!3|uVGOr dursuy MAIN HARD CPMINFO  NYNNNN M HARDS}};}} }}}}:}}}}@}} }}}}}}}}}}}}}}}}}}}}}} }}}}}}}}}}}}}}}}}}}}}}}}}}}}}} }}}}}}}}}}}}}}}}}}}}}}}}W}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}} }}}}}}}}}} }}}}}}}}}}}}}}}} }}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}c Ŀ}MULTI-USER / MULTITASKING} Ŀ|y|K}OPERATING SYSTEM} Ŀ|m|K5 Ŀ|g|K Ŀ }from}|c |K|g|K}Press [F10]}  |c |K} to install.} }DIGITAL RESEARCH}  nĿ }from}PNYNNNNAAAA M a:installh xm ca:installh xm da:installh xm ea:installh xm fCPMINFO]6Ŀ}Choose the \DOS drive \to install Concurrent DOS on:}6Z}ͻ}}ͻ}}ͻ}}ͻ}} F1 }} F2 }} F3 }} F4 }}ͼ}}ͼ}}ͼ}}ͼ}}Drive C:}}Drive D:}}Drive E:}}Drive F:}[0Ŀ}If you have \CPM Media \installed on your hard}} disk then press [F9] for furthe/ r information.}0}Press to return to the previous screen}your hard}} disk then press [F9] for furtherNYNNNN A FDISK)Ŀ%}Concurrent DOS now supports Password}%}Protection on DOS media and therefore}%}only needs to support ONE media type. }%}' }%}If you are already using CPM Hard disk}%}Media then you should Backup your files}%}to a DOS partition or to floppy disk,}%}using your existing copy of Concurrent.}%}' }%}When you are sure you have \BACKED UP \}%}your files then rerun this installation}%}procedure and choose option [F10] at}%}this menu - This will run FDISK for you}%}which will allow you to delete your CPM}%}partition and create a new DOS one. }%}' }%} \If in any doubt please contact your \}%} \ Authorised Concurrent Dealer. \}%)t}Press to return to the previous screen}lease contact RRb`Y#2PVZ CP/M V1.35 6/12/85 SMALL Model CLEAR library. Copyright 1983-1985 Digital Research.$UWVVN< *^_]%Ë-++Ë6_Cr Ë6_+́;s;r+ێO$Zero divide error$XYZ+^gVDRQSVRSSSP6 [ZB;v Stack overflow. $+RSñ uPPt<vB AD ÃԱi@t+ P X"r.t " t5 t 5t+ɈH F ùË-UPPPe+]You must link with LINK86 V1.2 or later. $66 UVWv v~v2f_^]Y[ڎ^6-6'6!6666 6SV++4,S$p{ȳ+^t&u+[+u@fUYv PDDPDD%F: upPDDH# 8Fu PcDDJ PWDDH]2=2}>P P$PDDPNDDPWDDP<DDP-PUvDDPDD%FPDD~ w+P)DD~Ar̀~PwƊF2-AFP^XP%PP-PvPtFP-Pc~t PDD~t`ppPP7L?F L^?F~ ~XLPP tp? t|p?upFLM.F L^ F~ ~LPP tfpF^fF L^?F~ ~F PDD]UPDDPNDD%FP|DD8Ft 8Ft+j8Fu@lHLLPP PEDDPDD%F 8Fu n 8Ft PDDFFP PPDDFPF2@@[~uF'FF?0r FF?9v PDDcF~|pF2-0 PF2-0[ÉFF2-0 PF2-0[ÉFF2-0 PF2-0[-PF PF[FhPDDjP+P_PDDPDD%P2[;u,DPDD+PP$PZP PDD]UVW H< P=PPAH<PP@F+Fǃ>fuFp%@ t@Fp@?.t@F~t ~uFn t~up %tF~u"~uPPp@P tFp tpPi DD tF~tTd D PDPp@PT PDPpP?FDD~t^7v<P!DDF~tUD%uFl t ~u6FF t f9DuFDPDDvVXDPDD u4FD%t|u;u^VaDDvF uȋǍf_^]UVWvYE%uM=ulPDDP DDFrPF[؋P< DDF9F|ދ]UJPPPP&&:PP=u V P DDs3vpPIpPDDpÉFF FF FFp;FuP,P-PPPP]UVWv(D%tr-FԊD%ts-FՊD% t-aFFttFPP@ DPDPrPP$ f_^]U^FFf?^FFPFffvvv&PFH[7vP ]U^;hs@]VW p%@tp %tp %tp %tpƓ%t F~ pƓ'F ~_^UVWv+#F tǓG|F%tLF%tL _^]UVWvH@L PMPDPXlLPP t:P DD+_^]UVWvJ@ PPDPPPPP tPP5 DD+_^]UJPDDd+PPP+DD uPDD u Pv]UVWvLL0E%u$E?trP[؉? t ủE%u}uJPPEPDDHPPEPDDrP[؉?EP^DDFHPPPDDJPPh)PlDD~t  tX+f_^]UV$FFF FFFrP[؋ơPDDVDDVDD t+FVDD t+FFttFFvvFF$Fjvv+P@P X tF FFvvLPP`FFFFRPFP FFF;F}vv+PP+ X tvvv+PPG X tLPPFF}~|FFFvvPPFvFPFFF)FFF~t PPx PDDPDD~tzvv+PP X u utPPB  tFPMDD+PP+PPcFPF[؋PDDF9F|ޡP|DDVDDP[؋VbDD t+FttFFFPvv vv+PP X tPPdF^%F t F~u| tD2PPPPn t#D2PMPuWLPPDFۍf^]Uv,P+PPv3P]UF2 uF~u+F]UVWv| tD2PPPPf Ǔ'G ~_^]UF ^73P4ppPP ]UVP,P0 P-PHAPP$ PrR PDDPDD5PDDPHXP%PHPPF~tH&PP|& PP6PS 0" 0!PP1F~u*:PPF~uPP~tP-PpF< wpPP f^]UvBPC]UFF7DD^?u]U F FF^FFFFPoPk]V tơ$P}DDƃuPDDPDD^UVWv6_^]UVWv~ FGN~u_^]U(FـFFPF@[PFF%[F~ |FFPP]U*vDD u+FـFFPF@[PFF%[F~ |FFPPR tgPDDrFF׋^׀?u ^N׸r9Fv^׀?:t^׀?\uvrPrP&DD![PDDTvDD]U&FFۍFPP]UVWv~8t+FGN~u_^]+PP+P PU|FPvYP<|;t|+P|P]UPF[2]UVWv~~v PtPYY6>)>~_^]U"VW PY<2sP PYY=uN|FޑFF,F.FP1RfFFF/V1PLFu~ u ~ u< v WPYYF*H"_^]UV>|tPmP+P "PT PYY<`sdPRpVPi#6"ZPZYY"t+PvPt^]Ã>|t +PmP(Y% PY<`sdP6"[PYY+PY+t;t P%PYYUVW~;>v PtPYY6>)>_^]UVWv"P-P"P%P6"P"t vPAYY>|u)"t vP!YYvFP6"#u v&PYYFtu($&( $&( v>PYY>|u PYN~>t W\P YY#t- Pu6DDD6NUDO͡L@PD+W_Y;u;t P >NY+;$tka*HУ +>t WxPSYY#t< P6DDD6DO͡J&PY+ :86DB@20.,4*;$u";tPY66JPRPF_^]W;>Lr>tuW Y#t WPYY^>t&tWr Y#tw:WP_1$ <u%>t WP?YY. t6Gp>.u 666.P >tDlPY#t >tIm D>t+PPP6.u +PPP6.^P .4.FP+PPRLJJR% D#t*#tQPPR@#t RPP62B#t7RPP6,>t6>6<6>6<"P >.u>t1>tBP68P6:XP66P6.nW>u"+PPhP6.S6+RPXP'>8t'+PPhP6:*8+RPyBPPi0#t+RRzRP+PPR64>t'P06 P%6PP _UPVWvY;>LrvuhW YF#u4VF;&u ߀>t WPYY0-v;6Lwހ'V/ YÓG끃>t> >t PgY+PY_^Y]UVW~vNRPFRPv~RP1YY~v~uvPYYv VWP_^]U*VWvvPFPF։Fv #t,^FFtu^ u FO FFPY_^]UVW~#u+;6Y~V+PYFYYF~v YFL;w F;rFF;LvW P1P*=+FW7 Y#u.VWYY#;uW +YFF;LvF_^]UVW+;>Y~W+P 6YYt PPv P^G t:uw Y#tF^wFvveF~uIi PPivb PPX  #t ^G NGWG^G $*F#t@^G tDB>t^GW<>>t ^w8Y>t)~u#^G#tP] Y#uF;tv"Y+FF^;uQ;Ft Pv ->t^GW uW P[vT PN+F+҉FVw;>LvNFVt~u~F~t2^G t*,Ó>titd Pv * Pj #tF^wVY#uV8FY;&t +PVYYv6&W^GYVYFF;Lw> PJvC P=>uL;>(sF \ P#Y#t( PVLYY+^GЉGWGv PYY~t ~ Pv v P~t,FVW _^wYg>u`FV^+GW|NGW-+FV}7Q FV^GWG P=v6 P0F>u^u~u ~u Pv FP+^YYWY#u\#t PFY~A~ PFYWPFYYWDYB;u;tWPFYYW"뚸P{Y_^]VW+;>Lsߊ$<u VW YY#uFG_^U(VWF >t#v,Y#t :t+WF8vPFP>FF;YwaP+PYY?tO PFPS`#u7wVY#uVU+PVv+PYYFFF;YvP+PWYY"tLs&t>t W< PYY+PWYYG_UVWNRP^GW-RP^G;G:uY+;v^GPY#uBG6Z P:v3P-^#tv@( PWDYYNG_^]UW~+PW PR6q #u4G t*;u% PP SL#uG+t+_]UVW~FvR;>LsL~~+F;u.;6t(FFW YFF;LvW PVPO#tVvYY_^]UPVWP-PYY;>L}cuUPWaYY#tGWWv P#t4߀!VY#uVuF+RVv6&WYYG뗸P-P YY_^Y]UVW~v>tHPW PH.JPFVY@ FV+RPHH+RPv~FV6v&Pvv_^]UVW~v#u)H.JPFV#Ɗ +FVGH.JPFVY@ FV+RPHH+RPv~2FVv~vv#GYY_^]U VW~F#tuRRPvvv~_NF6R+F;~vv vvV6"q #tvv PFƙFV+&F 뇋F_^]UVW~#tpRRPvvv~_NF6R+F;~vv vvV6" #tvv PƙFV+&F _^]UVW~>$t2#F;Gt NJPY+F_0(ǺFt 7 ^7;6&v_^]UW~;>Lw r+*_]UVW~>$t+WQЋ#F_ӋډGY6Ǻ6t%VЉ %F_^]UVW~F6#t+;Lu;Ttv+;Tu;DtLe>tW" P YYtP+҉FVPFVRPeFVDTD;6t^6_^]UVW>u>t=#tg}t>tS>tuu: Pi PEUFV6H#t uPvvRJFVNE듃>t9PFV6H#t!66Jvv JFVN_^]UVW5#tT;VuT;VtD;FuD;FtBV>tvvR Pt6vvFVDTD;6t 6_^]W>tD=#t;}t>tuul P$u6uu%E_UVW"AP PFVW _^FYYF;~m㋿FF#t< t^FGN= t ^F.#t< t^FGN^~uFFPPVF_^]U FFP PP0~tF*  *;u+]Ã>u,>u%P㸆 P㸲 PPUvvRP?]UW~A| Z _]UW~"ttt+PPYYUvY] "t&h&G &N UVWFt~_^]P  u[&t&_&UVWU]~t&O&g_^]ø  UVW>"`s"NnQvv v  ( ]- $^%& &_&G fF (*F&F ,. &.$/_^] 0123456789ABCDEF000000001000000000COPYRIGHT (C) 1986,87 DIGITAL RESEARCH0000-XXXX-654321 CHKDSK 6.00 10-Aug-871 ,./\. .. MXdisk %s A: %s %s %s %s %d %s %9ld %s '' %s '' %s? , %u-%u FILE%04XCHK %c:\%s VX\`dhlptx|JanFebMarAprMayJunJulAugSepOctNovDec4^:CHKDSK v6.0 (18-Aug-87)-----------------------/B Read all files to find bad blocks./C Display cluster numbers of cross linked files./D Find removed directories on the disk./F Write fixes back to disk. (Default = R/O)/L Rebuild cluster links./M Verify disk for bad blocks, map bad blocks./R Recover root directory./S Show actual file space./V Be verbose - displays extra information./H Displays this menu.CHKDSK: %s %s Illegal Option: Not enough memoryRequires Concurrent DOS or DOS Plus$Bad drive specification: Can't select drive There are open files on drive Drive %s is locked or there are open files.Not a physical drive: Drive is not DOS formatted: Dir buffers allocated: %d FAT buffers allocated: %d Reading File Allocation Table Found erased directory in block %04x Directory at block %04x, parent = %04x Cluster lost: %d %d lost clusters found in %d chains. Recover first level directories (Y/N)? Convert lost chains to files (Y/N)? bytes disk space freedbytes disk space would be freed bytes total disk spacebytes inhidden filesdirectoriesuser filesbytes actually used in files recovered directoriesrecovered filesbytes would be inbytes in bad sectorsbytes available on diskNumber of FAT sector reads: %d Number of DIR sector reads: %d Cluster marked as bad: #%d Checking Directory Circular link found after cluster %u.Volume in drive %c has no label Volume %s created %d %s %d %d:%02d Checking directory entryDirectoryinvalid, convert to file (Y/N)Lost sub directory: File size error, please erase file: File contains bad blocks: . Delete it (Y/N)? Circular link found in file Missing end of file, link fixed: File cross linked with another file: on cluster %u File size error, file size adjusted: Cluster numbers for file: Root directory full. Erase some files and try again! Releasing lost cluster: %d Rebuilding chain for file: Cluster %d (%04xh) is bad, remap (Y/N)? Reading clusters %u through %u Disk error while reading track %d, sector %d Disk error while writing track %d, sector %d Reading FAT record %d Writing FAT record %d Reading DIR record %ld Writing DIR record %d yErrors found, F parameter not specified. Corrections will not be written to disk. S t/<+tHu^GtG3Ҡ.!3|uVGOr dursuy X X k6z2PV wZ CP/M V1.35 6/12/85 SMALL Model CLEAR library. Copyright 1983-1985 Digital Research.$UWVVN*^_]+ێOsZero divide error$XYZ+^gVDRQSVRSSSP6 [ZB;v' Stack overflow. $+RSñ uPPt<vAÃԱi@t+ P X"r.t " t5 t 5t+Ɉ%Ë-++Ë6_Cr Ë6_+́;s;rùË-UPPPe+]You must link with LINK86 V1.2 or later. $66 UVWv v~v2f_^]Y[ڎ^6-6'6!6666 6SV++4,S$p{ȳ+^t&u+[+u@fUR[`u]> >=T t dPJDDFPvvF+PvDDDFPDD t FP &DDPODD+P`ADDPPsDPc=DDPPN&[؋GHPPN&[7PN&[؋GPPN&[PJ PCDDPLDDFP DDF+PCDD+Pu PGDD:P=u=u="u=!u=.u{=um=u_=uQ=u==u)=u=u=u=u=u=u=u= u= u=u=2u=1u= u= u= u}= ui=uU=uA=u-=u=u=u=(u='u]U^~~cPF@@7V tPF@@7@ u7>u t P^DD~~vF7~uvF@@7]P>DD8GZ$PnPnUvPP:]P\DD]UvDD@FFFPFHF؊[NF9F}ߋFHF؊F]Uv蹖DDHFvvFF2PN~}ߋ]Uv胖DDPFFHX+@PFHFPFFHFP]UFFFPFF[:t+FFF?uո]UvDD;F|7FF FHFPv tFFFHF؀?u+]UEFFP^?s)^?r!P^2[؊%t ^2^2[F^?u^]UFF+FPF[ 2FFF2 1FFFF?uɋFF2]ø PPZUvDDFFF9FFHF؀? tF FFFPFFHF؊[F9FFHF؊:Fu΋^v F@[]UvFPӓFFPFF2[؊% uFF?-u FFFF fPFF2[-0FFPFF2[؊%uɋFfF^FFF?u@]UvPvZ]Uv[DD u@]++UvvY]øZ2UF2PP]U^]UjvvXF u?vPFPDZvFPWF uvPFPZFPDDF]UFFI^? u/PF+FX+ÉF FF N~}FFP^[F^?u^]Uv蛒DDPPv(PPO PWDD= u]UVWv~GP[FN w_^]UVWv~ FFO _^]UTF~tN**|.v t'j% t(\F2<t<t<t< t^F+6?TF~r$~wPF2[؋F~tFp]UvZDDFJ^? t ^?tFSL t+P8DD0( F F=/t=0t=3t=+t>닋]U FvDDFF*F9Ft*FHF؀? u v|DDFFFF9F~΋F]U v賐DDFFF,^;F~*FHF؀? u v$DDFFFF9F~̋^FF]U PN&[؋GLFPADDFFFFFF? uFFF9F|F]UPNf[ÉFvD)DD^^G^G^GvFP ^GH^GJ]U<P!WDD u PaDDF.FH uFHX FH FŁ~~F#Pv#PNf[ءGLF~~]øPN&[UvP]UvU0DDP\21 DDF]áPDDáUPN&[ÉF^GH;F} ^GHF^F^7PV)F^Gv^G@[GP^GHF؊2[؊% ubvv*DD@[GP^uv^G[G v^G[GvFPv-[GF=t=ugv^GPv[G]U PN&[ÉF^GH;F} ^GHF^F^7PX(FPmDD@F9F~FF^FGv^GPv.[G]øPN&[؋øPN&[؋GHUPN&[ÉF^7P'F^GPv܌DD@[;u-^7^GH[;u+^v^G[Gv^G@[G^GHHF؀? uv^GPva[Gv^G@[G^7P1'F^u!^?u+\P^HPrEv^GH[G^GHF؀? uv^GPv[Gv^GH[G^7^GH[;u+v^@[^7P&F^uv^G[G v^G[GvFPv[G^?u+v^H[^7P &F^uv^G[G v^G[GvFPvE[G F=t=u=u=u]UPN&[ÉF^7P%FFFP^GHF؊2[؊%t+F~tF~uF F=t=tك~uQ^GPv9DD@[;u1^7^GH[;t,^^7P$F^GF@@Wv^GPv[G)FF^u4^?u^^7P$Fvv蚉DD@[GF@@P^GHF؊2[؊2%t+Fh~tE^GPvIDD@[;u!^^7P$F^GF@@F*^uF~uF F=t=t~uv^GPv[GF=u=u ]UPN&[ÉF^GH;F}+ vP_#]øPN&[7DDU *PpDD"=2~#PP+PoDDPPpvJDDQ)]U>tu P4DD19PDDqFvDDPDD+P DD]U PN&[ÉF^7P"F^Huv芇DD u P\4DD~tv DD^F^G^G^Hu"^^GHP^GHP.B^7P "v^GHH[GHr2^7^GH[;~ v^GH[v'DD^GJ]UPN&[ÉFv^7P  tI^7'DDFHY1^^G^G^7^7-^GJ]UPN&[ÉFv^HPP  tH^HP4'DD0FH^G^G^@P^7o-^GJ]UPN&[ÉF7P ~ tGFF~~&F@FPFH؊2[؊% u܋FHPP评FHGPP77,P;DD tGH؀?utPDD@P7P  u7PP譄DD@@F FHPFHH؊[NG;F~ԋGGH؊FPG@[GPGPP[G77+GJ]UPN&[ÉF^7PFPۃDDF~u PDDF^GPF@[;t^7^GH[;u Py0DD^@PPhFP}DDFP^7P^ u^7P6FPv蛂FFPFHF؊2[؊% uFHPPvvvW^F^GF^GF^PDD^F^FG^FGP^GPv^G^7^7*FGJ]U PN&[ÉF^7P8FPMDD@FHF^G;F^_F+@P^GPv^G^7^7)^GJ]U졔 mo.m^?uo^2<\t0PN&[GJ]UPN&[ÉxxHu@ PxPu u*xJu 퉆zzPNvDD u P@DDLxPFPu t3xP|PpuFPxP^u+P|Pw]UPvP6ue uPvPu PvPAu tԍvPFPtFPuDDppHrFr?.t rr}胾r| Fr PFPt P""DDvP)"DD%FPx9DDnuPN&[GJ5 P DD @ P DDދ]U`F@?>u L PV$DDvL$DD+PeDDN PDDvFPsFPDDPP+PDDO PDDvFPrFPFPsDDH[؊F~>t~ tP PFPrFP,DDFF+PDDPPP|DD~t F*N.PDDFPqDDF+PNDD+PqDDPDD|PDDpPDDdPDDXPPHPP7P^P&PMPp+PDDPDDv [^ 7MrDD;F FFS PDD~uP DD t F2P0DD"FPDDFFe PDDtF=t=%t=+t=*ub=&uN=u;=u-= u=u= u= u=u=u=u=uz끃~uu P-DD.v P!DDF]UFP~ PPv% u+Jv v܃ u  PDD-^ ;F| ^ ;F~ PDD PDD뙋]U2 XvFPp PFPpFP PPFP u+vpDD=tz^?s)^?r!P^2[؊%t ^2^2=YtH^?s)^?r!P^2[؊%t ^2^2=Nt PDDL PDD^?s)^?r!P^2[؊%t ^2^2=Yu@]UPNf[؃Ju PDD]UPP+PDD~tPDD u+ PTDDPDD]UvWDD]øPPfPN&[؃H~+P;DDPN&[GJPPXU FFvnDDFPvvv%FFF9F~tك~~@]UFvlnDDFvanDD@FF HF؀?tv vF FFv vFPv tF9F~F6v vF PvvvpF~~FFHF~uF9F}FFF2v vFPvu u FFv vF ~u F9F F]U/*%FHF؊2<tFHF؀?r/PFHF؊2[؊%tFHF؊2FHF؊2FF8Fu FFFNF9F~gF]UFFFFFFHF؀?*u FHFvv?PӃFFFFHF?FFHF؀?tF9FuFvFPvFF?u+FHFcFFPFF[FFKFHFcFFPFHF؊[F"FHF؊2<\t<uPu/9t&>t>t V PDD>u%գPN&[؋G PDDP>uF9}&FFPN&[؋G PoDD]á9uU  u P.DD+ ՉF9u9F|9F} PDD+X^ӡ+FF*FPJDDF+vDD u FF9F~θPF@PӃ]U PP/DD[؋GF+@FYԉF9u9Fu PUDD.9u"9F~ F+FF9F~ F+FF uFPDDF Pf[؃ t9Ft vDD PDDPP:҃PHDDPP[FFF +PDDFF9F~~~PFHPуvDDFFF@PvуPP+PDDPPу]U  u P DDFPDDF Pf[؃ t9Ft v}DD PrDDPP$уP2DDPPEFF PDDFF9F~vDDPP ]U t>PDDF Pf[؃ tvDDPPv? ]U t 9t2>t 9F}>t9F9}g]U t 9t&>t 9F}>t 9F}]á>zUFrPF[؋;FuF F~~߸]Ã>|u P DD~P||[ءzÃ>|~~P||[7DDU Pf[؃ t3vuDDPPYP/DDPPB]Uev*DDF~trPF[ءvDD`rPz[؋FFzPa]U F vGDDF~~]$PPPP P? PPN&[؋GHPPN&[7PN&[؋GPPN&[P UVWLLP<DD%PP# PPP +PDDFPDD=%u >uEf_^]UFz~t vDD trPF[؋]UPDD]UZ P&z[ÉF^G^G ^G'vFPL[FP[DD@F~#~F#FFFP^7g^FGv'PFHX+[G]U PN&[ÉF P&z[ÉF^F^7^G[;|~t#^7^GX+ÉF~}F^G+FF^FG^G;F~>vP^GP^_XHP^GP^7^_X+FHP^7 ^GFHP^GP;^7^GP^_X[;}~t+^7^G[ÉF^GH;F} ^GHF^GP^_XHF+ÉFv^_F+@[G^G;F~?vP^GP^_XHP^GP^7^_XHP^FP ^GP^_XHP^GP^_X+FPA^GP^G [;}v^G[G :^GP^G P^_X[;|v^GP^_X+@[G ^GP^_XP^_ X+P^7^XP^_X+P]UF +F=Ot uPPz@>zt9~ uv+Pv vvv vPv vvv ]U~t t PDD PDD PDD]U P&z[ÉF t>zuF9Ft^G;F~ ^GF^GP^_XH;F}^GP^_XHFFFOvLDDF~uI P^FP^_X+P}v^FP^_X+P_FF9F~]U P&z[ÉFMP^_X+ÉFNʉF^G;F|~u5^GP^G[; ^Gv^GP^_X+[GJ^GP^G[P@[;~vP^_X+@[Gv^GP^_X[GPPRP^GFPȃ]U P&z[ÉF1P^GPǃ+P^GP^_XHPǃ F=t=t‹]Un P&z[ÉFFFv5VDDFFFFk~~ NF BF9FmFHF؀? uvDDHFF@FF FHF؊FF^G ;F FFFF^G P^_XH;F||^>u ^G ^_ +@F^G;F|,~~&^G+F@PvFP^GFHPvh ]U P&z[ÉFPN&[ÉF^7^G[;|j^7^GP^_XH[;}OP@P^GP^_XHP^GP^7^_XHHP^7^X@P^_X+Pw ]U P&z[ÉFPN&[ÉF^7^G[;}^7^GP^_X[;}wPP^GP^_XHP^GP^7^_XHP^7^X@P^_X+P ^GP^_XHP^GP^_XHPJ]UvSDDF~uFHF~2~F2F+@FPDDvPvPP F@+PDD2+@PPK PPP\ PPPPL PB]U+PvV]UPvD]U>zu P&z[ÉFPN&[2 F^G;F~ ^GF^GP^_X;F^GP^_XHFF+F@ ~@FF-^GP^GP^FP^_X+PvFF9F~]UVW t,PDDPPO PPPHHP; +PDD9t+PPPHHP_^]UVWQ PvaQ u)T PPQ]~ uPvQ uvPP P(PxPFvFPPFPIQDDtt(~ Fdžt(tdžv (+t@vFPxPvH[P^P(PPxP)PHP  9F tBF FPv PPW P=PP PHPFP>PP 9Ft0FvY PFP}PPFPAPP 9FuGFv] PFPBPPFPFPPP PPa PKPP9 9F t,F FPv %PPFPLPP f_^]U;}vODDPPvPP ]øPP} U PvPO]UFPd P~um PFPNv PFPF u!x Pz PF u PDD |FPFPODDH[FPODD=}~.t~Kt ~MtPPFPEPFPTN thFPFPNDDH[FPNDD=|-~.u'~MuPPFPﷃFPPM.NPFPONP|DDvVPFP uvVPFPo tvDDG]UPcPvE u +vMDDHF]UVWf9Ft[ t PDD P PA#FPDD t PFPM uF9|ԍf_^]Ul>u uPjDD舾>}F~tF>~HHF~}FP(DD+PDDvDD FPDDFPDD t PFPbL u݃>~#FPHPḃ PDDFPDD PuDDȽ]á---+@@HHH6U~t~u>u+]U+ P PPwP PPePPPPneP PP@P PP.PPPP7PPPP& PSDD=t=uf]U\F+F@FPvFP븃FFvPFPvvA]UVW,P KDDPP,PPHP _^]+ۋUjv PFPvFPFPFPH P J]UVFPvζ~u FPJDDFvFP]Ur PDDF<PNf[ÉFH FFFvDDF~uF F0F^JtFYF 9Fu  tFYF FPFPEIFPIDDF6FPFH[؀?/tFPFH[؀?\uvոPFP NՃ~}čFPIDD=~FPFPPvP^GHPPFPkPFP]PFPOH PXDDF~E PCDDB]á^PXDDUv P.]U+PPF~1r@]U FPPv+PN FPPv+P: FP Pv+P& vF2[vF%[~u~Ou^P^>u0^>}^?Pu F2 u+^P^FFO]UFP*Pv+Pw vF2@[vF%@[^^]UFPFPFPF9FucFPFPvFPFPvx~u;~Pu5~u/~u)F+FFFFFPFPFPFPL]U&~uFF=P~ P+FFPfFFڋF FbFF FbFFFFFPfFFډFܡ`FދF@F`FFFFF^P+PYvPFPFP^PP6]U~uFF=P~ P+FFPfFFF`FF@F`FFFFF^P+PF FP+PvPFP ^PP]UPfFFF`FF@F`FFFFF^P+PIF2PPPPFP% ^PP"]U~OsPfFFF`FF@F`FFFFF^P+PF2FP+P@PPFP ^PP]U FPP^P+PIFPP^P+P4F^FFPFPFPFP]UFd]ø PcDDU]ø PTDD\PP+P\P\@\>\|^dUVW.@@PF[.PF[.PDD_^]ø PDDø PDDUVW~u2F02F0 PDD, PDD!F=t=t=t=t=t=t_^]U.dGd% pd9d d.,d d!F=t=t=t=t=t=t]U2d% d;d%d0d% d"d%dF=t=t=t=t]U vBDDF+F @;F }FFF+F @F +ÉFF F HFFF+F @FdPF HFPvFHPFHPE ~~vFFHPFHP]ø PDDUF*FJFDF>F8F2F,F&F=t=t=t=t=t=t=tPPFPvv]U t P腪DDFFFF +F@PF+FHPFH[P`PFHPFH[P`P FF9F~FFFF +F@PFFHPFH[P`PFHPFH[P`P` NF9F}. PȩDD P迩DDF =t=t=t=u!]U~tpPFHPFHP]U]AU+PnPàP-P趠 uP P衠+PP藠F FF2P^2[ãb+PPi^>^~*P PQ+PPG`PP^P+PXP P$]?dHHHQUVWVN ^?&%?& ^?&%?& Jt)^? ?^? ?v_^]UVW^VN?&%W&#F 3F & _&%?Jt^? ?v_^]UVW^^^ ^S^X^^^ v_^]UVW&^F^&^&v_^]UVWiVwF^ F=u&&v_^]UVW/V<؋F=t &G4 &G46t6F6F2(F2FF2F~uF6F2f_^]U F FF4FFPFPFPFP/fP P;]U +PP(4F FF4FFPFPFPFP]UVWv~vFPF[~ tO ~vDDF=u~u+Ff_^]UVWv~F ~}FP f[ÉFG%uރ~|+=wt=WuvPVm Fe=at=Au;vPVtF }vPV; FP+PPvC =rt=Ruv+PV0F+V~}+L^G^Fv^+G[G=rt=Ru ^G^G~u^OFf_^]U+Pvv]U+Pvv]UPvv]U@ vҚDD]UVWvD%t(VDDD%t DPBDDV+G[GDdPDD_^]UVWvD?|D2V:DD_^]UVWvD%t,D?|DF2#VF2PL _^]UVWv~LLFW2PF=u<uFf_^]UFPv P ]UFPvv ]UVW4F̉VvB=uD2ǍF܉Vv=uh|t% tD2;tDD2W!DDFʍFPPlFvW;~t$+f_^]UVW FDVދFG[GDFPvVV+P;Ǎf_^]UVW }VDDPvVV<DD_^]UVWFH+@VDD u+VW_^]UVWNjƋDP\X3 tPDD+D;Fu;6tǡNjƋD;Fr;6uvDD u PcDD+_ʡNjƋDP\X3 t P9DD+5D;Fr);6uvDD u P DD+_^]UVW^ƋDPF@[;w v[?fÉWD+F[GWE[GW[^?ދFGVD[GFD_^]UVWLLF?FfPLDDƃu+5@RP+P@PjrXZƉߋFGWE[GEP DDf_^]UVWF-ƋDP\X3 tPDD;r9r9r 9v;r;r(DⓋPEⓋ[;w>+lDⓋP[;uVG[GVD[GV[V[EⓋ;uWD[GWE[GW[5>+_^]UVWvVDDFH+@FP3DDF u+R^;t8;s GP[N~uFNjF OPN[N~uvvf_^]UVWvVUDD u F% t% t=% 3 u4EPE PI!X tP+PPV" PPVW`DDFE2PfDDFEPP豔2=uFvE2PrVVDDVDD~uFf_^]UVWvP[؋FD% =u>DP\X+ÉF ~-vDPP&9~tLHD%t|tD%tDDPDؙRPP DVD[G+f_^]UVWv P+Pv'4 P PF@P4 PFPVIƀ<:u,FPvt=u PFPFPƀ<*uP?PF@P3FPF@PFP<.uC PFPFPƀ<*uP?PF Pv3FPF PFPS<;u) PFPFPƸPFPFP%+2< t< t<tf_^]UVWv~4GP0}dž PF2-0[ÉFFF~0r~9vĿ~.u+FFF~*uv^ǃFFF. PF2-0[ÉNjFFF~0r~9vdž~lt~LuFFFFtև::PP PPV ttև::P+P PPV ttև::P+PPPV tPtև::P+PPPVU tv^Fv^2䈆ƆF2PWPVF F2PWPV F2PWPV( vF2P/zF2u:P@@P=uP+PP@P=u@@PPB +P@P&=t@PP ?PW@ u*PW1 uF4PP|PWP)F~u PWMFPF2PvFPDD@P2|DDFFPvvDDPWPF~uWDD2<>u<D2P%DDFDP#PpvvD2P=D0P.+PPX[-F^%uvv+PPX uDPvv)X t-vDD tvvV tDPvv+PP{D4ǍFG;~s=uDPD4+ÙRP DP+PPpCDPF^SP+PP"ODP?D P8X tDPD P%+D PDP DP X[f_^]Z[w7ZYX[GZ[YX[SPZ[YX+[SPUF UFF 3FFF tVV FV FtVVFV F Fu3FFFFVV VVQvvvvYYs$QvvvvOYYYF^VV VVFu"F^Ft ]YSPF^ZX[؃SPZ[YX;[u;uPZ[YX;[u;u+PUN ;N|N;Nwr4F ]+׸ҸYXZ[WYXZ[)WYXZ[!!WYXZ[  WYXZ[11WZYX['WZYX[oZYX[QSPZX[YSPQRX[YZSPRQ&RUVWvFtt+PPXZF+Pvt tX tpVDD tD\%SPD \-%SPX tP+PD4P@F+SPV t$+PvDD D%F+F;~vFu+ vRWvD4FP~DP+PW~)~ @+PvDD F=uVDD t!F~s`FF"PF+SPvF+SPV;FtFFF~DP+PW~)~~wD\%SPD \-%SPX tP+PD4PF+SPV7 t\vvD4P @+PvDD FFDP+PvtFFtttt )X t ttD DFf_^]UVWv~+PvFFFNDP+PPFFDP|vvX tgV$DD tDPWX[%SPD PEX[-%SPX tvvV/ tDPvvD4PD%[ÉF+PvFF:= u ~ tF GFNFFF @DPP}XX9Fs~w9FrVMDD tF^+F^<~u-DPqD PjX tD PDPW]F^ ~vf_^]UVWv~FO _^]Udžpdžn^%t r^%t r^%tFllG% ndžvFFF^? u)džvptF@=|xF FW^? uOntHPv%X+ÉtFt=}WtvxF Ftt uFxFPFF[FNv~} ~tJFHxxPrDD~t$F]UVWv~ v vFF DP+PPFFDPvvX t0V>DD tvvV| tF^+F^ D4PD%[ÉF~^F~u7 DP,D P%vX tD PDPF^+F^ ~ uFDPPXX!GFn^ FDPPXX9Fsv v+PPX tdv v+PPX tDPD PX tD PDPsyF^f_^]UVWv^%t 4P%DD~sFu"+P@PBlƆ uƆP Pl2䉆9s PPk+=u^ +8FPG[N~vwȃ~vF G+Íf_^]UVWv~v vFFDPO+PP=FFDP9X[% uDP"vv[X t'VDD t=vvV t&D4PD%[F%GPFF[n^ DPPXX9Fsv v+PPX uF^ u-DPD PX tD PDPpvF^FVFFv v+PP:FFvv+PPX t!PvvWvvV$FVFPvvDPvv+PPsvv+PPFPevv+PPXZǍDPD PX tD PDPvvvvX t F^+F^ F^ u F^VDD tvvVS tF^+F^ iDPv vD4FGPFF[n^ v v+PPJX u֍DPD P4X tD PDPF^f_^]UVWF `F bv~ _^]UWV+V Fu أ02.F^ ;wr ;vr+v@60>2^_]UVWvLL2ljF2PP^hO Ff_^]U<P4PXv4PD\P4P54P P hPg]UVWv2FF$+v8Ǔ?$u-^?$t v Pg$PPg@ÉFG;~|Ë9Ft v PgFf_^]ZX[Ww7ZX[)_w7ZX[w7WZX[w7)_UF f؋Ff؋FfډF^ ]F FF2n=uDu&t t =ut u Etu Eut+؉^TV@^ RPFXY؃㓇ҋʋV҃VR ҃R FFufVVVV 3FFFFFߋOOO/ }^FuNfVVVF2n=uDutuEu=ut=tC^5VPF=uDuNu Eu:tV2u Eun=tuD\LE]M;} FNFTVTVTVVF2͈NV+=5vdE]M5r֊͊ߊĴt NuFu%VN^FF tFn^^^^N6V+VN^FsڃVuNJ݊Ίs^4u N6vF^NV t;#y ؃u3u ԊKs]UEË\ݱxT}`LTD| <$ Ċ֊tu"y؃33ҷt"ú"y@Bx"y"t -x@BËD-y-4|D$ \LU ֊͊ߊtEuDt]ENJ݊Ίu ]Mܓ3Dt̀24E3ۉ]]=t Dt]ËDEDEDEÁFsFuFuFF tFFF==|FtN2F4EF^NE] E%-D%-þB RPB BXZB R FFuþRs BuBuBFFGG uËGW/_uF ^VNNNð n3FtM]]ð3UVW؎~*ʋ~OvJsF_^]UVW؎~+ыv~tH@UVW؎~+ыv~t|&]awaawa:t밋W؎6*ыH_UVW؎*~V+ы~vOs\UVW؎+~V+чʋ~vss+UVW؎+~V+ыv~t H@F_^]UVW؎N~vs_^]UVW؎~FNs_^]UVWv؎~F~ ī_^]UVW؎^vN ~s_^]û+VW؎6|*6Du6|OuA_^+_^$@Y@@@@j@.AcAחA7yACyCxDnF\)c=Hsȡ1I=P1PK?O8M20HwZ$gAAI0G`+OI~.G ~0GIJuO=0tG^_ä.G`Ib: Response too longInvalid commanddefaultNumber requiredOut of range (y/n)? Invalid responseOK to lose changespatsizememfullText capacity exceededMax line length reachedSource block marked in some other bufferWaiting for second mark ...No source blockBad targetBad targetNo source blockWindow stack overflow..Press space bar to resume editing ... ..O....B%4d%5d/HELP.EDXhelp.edxrrl:help.edxNo help filerl:lsn.edx@@You're now on Lesson Can't fenestrateDR EDIX Release 1.00 (C)Copyright 1984 Emerging Technology Consultants, Inc.%%%dsFile Bfr Lines Wnd Chg MrkEYrcjkefVDverout is disabledVDscroll - VDsaveonVDscroll: D_LEFT is disabledVDscroll: D_RIGHT is disabledRequires Concurrent DR EDIX cannot be run from external terminal.67CprogramCON:LST:<>.,=:|[]* : unmatched quoteCannot open Cannot append Cannot create : No matchStack Overflow $Raw I/OC RTL - program not linked for Program terminating $77@ECopyright (C) 1983, Digital Research, Inc.Serial No. XXXX-0000-654321$؎k>  - X >t 33| {  tutq . tb32u | Ytyu Etu w v w 6w ta 6w iþ 6 X} ~ y (tZu Zzu tI<tCPtJtlv uX+<uX!Uv {t X<t <ttY 6 qÀ>| u >} u~ t+ ?u؎Gugt BtN㋟u &v Pu &v t'y u { # t { l tXu &v 3I{ }  ,tLutQ u w Pta 6w û3s y u { t%Rt<d u @;k w  ` so y 6R{ t u~uItþ 2q{ . Q Q Q Q Qy m( &UP^Xá @;k w, g ȡo @;i wo   2ððáq s ás q o û+ ?u Om  e g q 3Ҋ6e Hi 33ɋG@OPO3YG Hk   þ+ + u X H v 2# ڈA$& W_ t ؎!Fò< )PS7[X u33òmw+ PtP3XË)e2ËkmOËkmgñ-]VmMk&Gq=2s,&Toqm(U&tێێË Ž3S&O[S&g[(ñ ຘ- ?COPYRIGHT(C)1983,84,DIGITAL RESEARCH(05/02/84)XXXX-0000-654321PSQRR&K&ZػC?u3&1GV[3&1SZY[XUVN u)+-/]Z[َѼSRË$22122V72 PEPP4 PI3>I3u{P_PI3>I3u6 2s2PT>72u2RPA2| 72872u2F2QQd<u92I 22sP2 PP5UPP]UPFP]U Pv]U Pv]UPFP]U PP]UPv]U^G G PS]UPvz]UPvj]UPvZ]U^G G PSA]U!Pv1]UPv!]U$Pv]U PFP]U6$<t]à]U6PvAPFs]UNv~]U333< r@3΋^P u@Y"s"^:t:s333 3뷠3]Y11QU3>1u-31]Á>1vH133;1w}1H=v-3+3^1@-3u]Ã>1vB33;1w21@?v-331/@-3u]U3383wS31Í-P'3Q<tP1PDPB33uP]UFF<vP<t2FF]U3 2"2sf^:2v][P^^?u P^wP^?uP^o!^? t3^ ^ P]3]U11PP]U3>u33:w#À t 3,uƇ 3u33:r@3P t@Y"s3֊3.u 23Ƈ 333>3 wPQ3ÍF2P3u333"3#33u@"3"r u 33P< u@YP[u@Z"Pu@Z"P> 3 r@P>3 r@Z"Z"s@`v{s 333 3öֈF23 3u33< w#3s"3H3[u;3ȱÀF2 u3Ȣ33ƇF2[33#33 2 22283w 3 3< rÀF2[uoU2Cu2 3ÀU2Eu 2.3@ 3ÀU2Nt 3ÀU2Lu  2 2͠ 3ÀU2 u3 3  3s3]U2(3'322$3< s>2u2122'32+222QP 2'3rn2À-$u'32Ê.:$3t(3r(32P%3>$3u'3sqP2PP]>$3v?222PPt2P2H[.:.tٸ2PPM2)2>$3w '3sP2P%3Pw21u2Pj%3 PE%3>%3 w%3Ƈ)3 %3u63$ P2Í-P)3PP)3P22Ê.:$3s'32P622(3s2P%3PP]U;38393<3 2@:3>92uS73 73ÀF2 u7373,273ÍF2P2ÍF2P:32ÊU2=3>:3t >92t>92u2ƇU2 83Њ93"r 2À-$u28.t2ƍF2P-P":3>:3t P 2Í-P2ÍF2P22<3s 2>3<32<wÀF2 tF2[u ;383? 2PP;3-<3s 2Ê>3:.r93 2PP;3sX 2@1P 2Í.PP/P 2Í.@PP 2Ê.2.2>92u2Ê=3U29393]U?3?3:Fr@2"sE2P22s@3@3:?3w PY@3u?3ÍF2PB?3]U P622s 2P!22sP<tPe2P P2]D3D3Ѡ2"PQG<t@Y"sѠ2ȢA3A3A3<v@D3"rA3C3<u2B3D3Њ2"P>B3r@A3P/t@Y"Y"s%B3S!A3B3˷SA3[E3먀>B3uD3 B3ƇE3$2ЊD3"s6>C3 u 2s 2P26C3>B3vE3PB3 2UP!PHP2PH3"PHPƇ2)H3>H3t 2s2PbH3]Ìi3g3&e3R]&6h&\ L3Z(d3&CSQS[Y< u< t<u t͠(b3V<u<u t&K<u QSd3<u[d3:(s(<u[&e3g3b<u7Q}Y[SQ tC&QS:[YSb3 t*(b3Fb3u<u؎(:sC&QS[Y-C& [&/i3 i3g3G&e3á_3 u Q8Y Qѱ,Yá_3 t>a3t ua3Êa3_3 ua3_3< t< t < t<t< t0<u _3t<u<u _3`<u3_3ã_3b3ud<t(< s(t<u(< u(Êxs P^Y@ u ($u  #(:d3s  zQYË<$tAQY! ERROR: $ $Reading file HELP.HLP.$ Press RETURN to continue $ $ $ Topics available:$ For more information, type a period and one of the following subtopics:$ $ $ $Reading file HELP.HLP.$ HELP (Enter topic, ESC to exit)> $HELP HLP HELP UTILITY V2.0 At "HELP (Enter topic, ESC to exit)> " enter topic {,subtopic}... EXAMPLE: HELP (Enter topic, ESC to exit)> DIR EXAMPLES $? HELP HELP Topic:$Not found$No HELP.HLP file on the default drive.$ This program cannot be run from a menu from the Serial Terminal.$ DATE OF LAST CHANGE 05 NOV 87 Requires Concurrent $#Concurrent Disk Maintenance Program* DSKMAINT cannot run in the background. DSKMAINT $I O ` #U Main Menuf S E L E C T F U N C T I O N F3  $ F5  $ F7 $  Verify a diskette" Copy from one Diskette to another Format Diskettes  DATE OF LAST CHANGE 05 NOV 87  w G I N S E R T A N D S E L E C T D I S K E T T E T O V E R I F Y G I N S E R T A N D S E L E C T S O U R C E D I S K E T T E GI N S E R T A N D S E L E C T  D E S T I N A T I O N D I S K E T T E# Verify a Diskette # Copy from one Diskette to another    F2  $  A: F4  $  B:F6 $  C:F8 $  D: & 9Source and destination diskettes are not of the same typeg &Could not lock drives - already in use C   B A D D I S K  Press any key to return to Menu C C - Z  Z  %Copying from the Diskette in Drive :3 % to the Diskette i5 n Drive : ` <This will erase data on the destination diskette in drive :  )Is this what you want to do (Y or N)s?t C ,INSERT DESTINATION DISKETTE AND TYPE ANY KEY, INSERT SOURCE DISKETTE AND TYPE ANY KEY GNT  .Z  Reading track  Writing track  Checking track Verifying Diskette in Drive :C - 3The source and destination diskettes are different. =Do you want to format the destination diskette (Y or N) s?t^C - hn*The destination diskette is not formatted. DATE OF LAST CHANGE 05 NOV 87 ! E =;da  #A_} (P(js' PP=Pj'(P[('PPzP'(P(js'PP=Pj'TjO PjO$ljO      @h  p  ` :p x@ $&BX!'J-Format Diskette in Drive :PG S E L E C T T Y P E O F D I S K E T T E T O F O R M A T    F3  $ F5  $= F5  $[F7 $[F9 $zF7 $ F3  $ F5  $ DOS single sided, 9 sectors DOS double sided, 9 sectors CP/M single sided, 8 sectors CP/M double sided, 8 sectors DOS hyper (1.2Mb) DOS 720Kb 3.5" Disk DOS 1.44Mb 3.5" Disk# Format diskettes B S E L E C T F O R M A T D R I V E # Format a Single Sided Diskette # Format a Double Sided Diskette #Formatting the Diskette in Drive :Formatting track Formatting Diskette in Drive :Ȏ؎м|-Q|Q|s S|u.O|T|+u *** Error while reading Loader *** Try another diskette. Ȏ؎м<:<4%:<4Otu@O.@u=6<,>tt >AE#.E ð.]AuSQ+gY[CCNJN@%!E E CN JIAN@Q6:>A>Yt A Ë.+6G+E0E+&>}u.02ËGG6E tG 8Ë6:D nul8؎..4K&263N G:IuâI<(rO*CJrôKu ôtx&z.|-@|**IF{|P^}w}w++QR|CCPM SYSDOSPLUS SYS^> |9 t}t~ts@;tX}> |AQ6|@@P>"|AV}&|+$|XZYP.|ݱSx[+Q|&|Y.&|XHPu* LoadingCCPM SYSDOSPLUS SYSUse another boot disk CCPM.SYS not 1st file *P|Xsu CCPM.SYS read error |26(|uŰ.ìtDSKMAINT FORMAT DATE OF LAST CHANGE 05 NOV 87 E a 255NPĿ --I hl F1 w HELP     (ESC2 Exit this program (ESC2 Go back to previous menu(ESC2 Stop current operation +HELP STRING NOT INITIALIZED $ DATE OF LAST CHANGE 05 NOV 87 MXdisk DATE OF LAST CHANGE 05 NOV 87 Yw6fE Eqt7evsttpqru ef 5 -VCMXQ@ HELP FACILITY TAKES OVER AT THIS POINT. PRESS ANY KEY TO GET BACK TO PROGRAM. $E$ Printer Busy $&.2ұn-N% ࢵ&G> udXш&& ôP!3 ࢳд!T!!2ㆠ3+u ub t/<+tHu^GtG3Ҡ.!3|uVGOr dursuy  6苯2PVZ CP/M V1.35 6/12/85 SMALL Model CLEAR library. Copyright 1983-1985 Digital Research.$UWVVNT-*^_]+ێOsZero divide error$XYZ+^gVDRQSVRSSSP6 [ZB;v' Stack overflow. $+RSñ uPPt<v.A.ÃԱi@t+ P X"r.t " t5 t 5t+Ɉ..%Ë-++Ë6_Cr Ë6_+́;s;rùË-UPPPe+]You must link with LINK86 V1.2 or later. $66 UVWv v~v2f_^]Y[ڎ^6-6'6!6666 6SV++4,S$p{ȳ+^t&u+[+u@fU+PPFFPPv+Pgh~t&~tvqDD=u PDDPDDvv=]U\uvˢDD]Uj2Ph2P+PPPPj vDD]UƆz PDD @NP{PP u n$u+PPzPPxxtxuxutP PƆz PHPzP+QFP Pe @ppP PKƆz {PqjDDvvtmKQ vv7]UFPrtDD t(F^F2F2-2䓠2㢐 tP̣DDPãDD2PDD2PDDFF>F*FPF[FFPFf@[F2;FF2;FFFN FPR^ [2f;F~)~uFF FPFN=} .[FF2;F FPR^[=>F2HCDvv`bPDD]U~u PiDDvPPF% t +PPePDDF% t5F% t PDD]UFHP>fDD t#JPv4DDP+Pv@B]UP F^?uv _2-@[F9Fu^2PDD~} v [vmDD]BP`P UOF@>Bu(H؃?uء2BPDDP@2P]+PPPDD PnDDU FPlPPnPP@DDP4DDP(DDPDD|PbDDqPWDDfPLDD[PADDPPDDE+D?F2@v @2P_DD@P DDP@2P @h>@w@P@2;~@[ u@2FF@oFHB؋FEP DDFB>D tcL+PDD(^GP2P2<t<t<tF=t=t=u|@2FBF@2H@؋GF@2H@؋F^ tF9F}|F9FtP@2PP @2HFB؋FBvFPPPF>؋ЃF u^GPv@R t^GPveF~uFF9F~6FF~tv4DDB>LPDDPvPPmF~~@P9F@[# tN tBd0%hP2P"2<t<t<tF=t=t=tB=uB=u#=u]UH>FYF|F|FrFoFgF_FWFOFFBFF5= t= t= t=t=t=t=t=t=ut뾃~tHvFP˃ PFPʃF t^vFPʃvFPʃFFvYDD]UF2HPP=t@]Ux u~ZP褚DDbP蛚DD`P蒚DD^P艚DDFFx7pDDFv9FrxP\DDFF|7CDDFz9Fr|P/DDPH DDx@P9 DD|v PvPzP|PxPF2PF2PBvvPDD^vPDD`vPDDbvPDDZFF^PFx؋[Fv9Frٸ PvPxP PzP|P0x]U F@FFFFFF~}FF2%F< u֋F F^? t FF.FFFFPFF2%[FF~| FF FF= |^]U^F2PDD+IGFPvF2 [~t' FPF@P u ~t+CtPPvPFItPF[؊:FttPF[G tPF[@PQPǃ~t%CutPF[؊G2%@t+E t#GF P PDD[NG IFPvDD[NINPtPF[P~uGEt=~utP6 F[PLLPv`]PNPƃvF2 [vPF~t F9I}CuPF@PƃvF2 [vPyFdžGtPF[G tPF[؊G2%@tu Pv Pv+]Uvv vPF&Pv~t@]Uvv  vP5F&Pv\~t@]UvPFPF@P)~t@]U^FG!^G#{PPv!PFPF@P~u@]UvP~vPqFPF@P~u@]UvP>vP1FPF@PV~u@]U 9|h  tmFFF vvJ u FFF9F|ظF > u2]U^F~}+FFFFFv@DDF"FF/-FFPF[FF= t= t=t=tӃ~u FH;F^F~u ~t+ ^]+PP@øP PUF2P P]U*FPv ~tF2 FF2 FFPPmF׸Pv~t@]UVW&G@_^]UlRvvbqR]UURvviZR]U6cvv/j]-Ra;R#Ri1RøP-P+P-PUvDDF uP6 DDPDDF]Uv&DD@PDDFvvmF]UvDDPvDD[;t+ydFFF PF2[؊2%t F2-aAF2P PF2[؊2%t F2-aAF2[;t+FFF u]UF +F~ rv vvF +P^;F }^7F0[^^+]U^HF^~},F؉F^;F}^-^^+ vvvvFF^F]U ^G F^GFFFFFF9F|^G ]UvDD^G FFFF؋HFFF9F|ۋ^FG ]U ~PKDD PvPxPFPhDDF uPDDF*FFPFF؋Hx؋[FF9F|θ PvPxPFWFF؋FFFv9FsFx؋;Fuv9FrFFFPF@[FF9F|v腍DD]á -UF~th2PHDD2PHDDoN;PPJPDD;PPqJPDD~|;PFPQJPDD4Nvv]U P:]DD[Ɔfr~u  tPrP耼PrPoPrP` GPrPMrPDDP 2[;~+rP 2[PPrP 2[dž  t]P PvOfPPPq t't6PfP賻:PfP袻L+PPL\rP\DD +PP*\fP\DD PP\P\DD|'1 2-PP[P\DD P+P[PXFDD PP[PBFDD P+PXHP,FDD PP[PFDD+PPw[#L P+PHPEDD+PPR[PP 2Pv[ 2@PPGPEDD+PPGPEDD+PP[P 2P [~t PPZPgEDDvKS]UFFFFFFFF t~ t ~,t~ rϋ^F]UF*F^PFF؋Hx؋[FF9F|΋]U@$PFPxv FPe~t,~~FPvvvFPDDv^[^]UvvPF^ 2PPPv]Uvvv]UFP0YDD=>F2HCD E?RGA459;]U@F=P^GP uPFP=^GPFP,j^G2PPPFP]U=Z,ZvZDDZtQ]UvDD ZHPFHPvZFG{ZF]UvDDY}CF PF2[؊2%t F2-aAF2F0ZF2]UYYvQYDDXPHYDDYPHPFP$ZY]U F2PCDDFFF u]U2PBDD2PtBDD+PPQD)H FvDD/H]UZPDD+PP&DGPDD~t*PPDvdDD PPCvODDG]UVPPvFP@PPvFPFP]UVW~@+FHlj~F;}&vFF7F7# ~O;~&vFF7F7 };}8F؋FFPF؋[F؋F;}cF؋FFPFF؋[FF؋FFH+;~+vVvvFH+P@FP)vFH+P@FPvVvf_^]UF ~F\vPZP]UFFFPFF[FF9F|]\UFFPFF[^?u]U FFFFFPPZ܃=tPF@Po t+F^^G F]U&FFFړ?*u PFPvڍFPⳃ vFPٳFPAP/vv]U~t~u,vEDDPvP^ GP|P u+|P^ GP|- t+]Uv vvv t+F]U^ GPDDF]UFF^;FuFFF2;F+]U~tvDDⓡ ]U~~FHPvDPDDv DDvDDFv,DD t7]UPv@\PvF t5F^?t*vvFNN^?:t F^]U.+P4DDFFFҸl PFPo t8'FFPFF7FP0 t F~|ӍFPDDj2P]UTvFP^HPD u@[G NP^GPFP:^GPFP^GPFP]U^GF^^GPv Pv^GP^G[7vЯ]U^F^ t+^GPFHP\DF tv2DDvDD5v[Gv2[G^GP^GPvvv;DD]U FGFjvDD PDD]U^F^tvF PC u PDDFHPWCDDF^G;Ft9^FG^t ^GvF PCvDD+]U FvDD tY^tvF PjC ttP4 PEPPnFL t F14 \P?IB;4-&F=t=t=t=t=t=t=tvDD+]U` F G F GF  P`DD+ GFPDD PzDD^FFvvvF@PF tvFH[FH;Ft@,~u+!^G4 HF+ PHP4PZPP  PDDPP  PPF^Fvv tv`DDv P^ ^xGvDD^qP@PvPUPPvP8PPd~t1 PFP,P^ tFPv: t+ PDDPP~tЃ uNF'F#PhPiЃ tFF#9F}~uˍhPDD$P%P u džFvDDvDD~tJ GPPvPDDPDP΃ uL%PDDdžF PDP΃PDPPσPPHփF6F#PDPσ uFl%PyDDdž FF9F|DPDDFhPDDF~ttJPv$PՃ~t%PDDvDDvDDFv P udžuP^$PoՃPDDPh$PUՃ~u$PDD PDD`vvv  t+F#GPPґ#GPP近PPԃ~tP#%P|DD#P ]DD# tF GPFF؋H[7FPԃFF~ u%PP0$PlPPPFPlP"PP4PlPFf2FPFPlPEփ uF>uzA~:u&FF2-@FP=DDjjGFFP芎DD= ~@F PFFPFP FFPFPHك t~t<PFP ׃F~u( $P/DDFFPFF؋[FFPFPXF9Fu PP-##F viDD##PDD~t)v vvFPvvFPyF t+F tFFPFF؋[FF9Fu#FF9F} ~u"FFPFF؋[FFF9F|֡#P\DD6$Pvvv҃F]UFfvDDFPDDd]Uv DDP^GP˃F t%~tF^GP2[;~2+]U F&FFhfҸ&PDDPvʃ~t##Pvv^҃F$PPԃf2HPDD u frPDD&~~ &9F}+Pvvvv BFF4$PP0Pփ&PDDF7 FPDDFPDDFPwDDFPfDD _2-@Fɸ,&PDD+P&PFP[ tv)DDFFѸ$PPӃoFhFPDDWFPDDFF =ɡ PDDd-&P DD+P&PdPF uF1Ѹ$PPӃFPHPvvv+ +$PP迴2P˸DD t+&P_DD=t=t= t= uE=u==u$=u=u=u=u=ux=up=uW=uO=u6=u.=u=u =u=?u=u>5]UdžX+FFFZ>ty GPFF؋H[؋FPFP΃PP.&PFPPPFPFP0PP4PFP PFPFPbЃF+~u~:unD&PDDZPFPӃ u<PFPуnpFPFPƒ t?džXFFF׉F`&PvEӃ FFFFFF uFFPFF؋[FFFPFF؋[FFF9F}8&Pvvv̓Xt vvȃF]U^ G PvvH΃v vvv,]UF~LP&Pf&P΃&P&P  t%FFFF؋HF GPF[7'DD u"FFPFF؋[FwF.vFF* GPF[P GPF@[؋[Fv9FrF$FF؋H;F~FF؃/FF9F|FF9F}-&PvvvŨԱ~t vveǃ~~vvЃыFFF]U^ G Pvṽvvvw]ø(P(PUv vvv!ӃF0F]U.PvF t+Fvvă tFFF u+]UV(PFP鄃)PFPՄFPgDD]U.Pv| u4)Pva uƆx ƆyvxP聄^?t(PxPjvxP\$B)Pv  t$PPxPvcvu@F!Pv߃ txPMDDF&PPxPvvu@+]UvF[PPǫ vDDF~u +PP觫PP蚫^ ~t(~utP Pz~uP Pf~tPPRF]UXbF2A)vFP(Pv)Pv )PvFPv䂃vvvF]"%U (Pv諂*^PHPvF^ vv腂!Pv:F u¡PPo~u@]U GP^H[7FPȃ4)PFP u(PFP: t+F]U^) t+ tf)PT)Pb)PT)P豁+]+D@F@HBD>JL2䣽U@DP@RBN>TV2䣽fF]U FFSFF؋HFv GPF[7k u FFPFF؋[FFF9F|)Pvvv;ǃF]Urfdr2PDDF^ t^ u+P>ru@[ tF9 u j)PDD+wvDD+PPvvv F uR^ G PvvNǃf2P^DD+PcDDPvvvFh2P5DDj2P7DDF]U^ G PvvƃPvvvv]U^ G Pvvƃ+PvvvK]Uv vvv@̓]        UZ~ Q~F QF FFPFPv誼 tYFPv 謾 uHv v vvv ^P*DDFP^[vFP@DD[G^F]UF^F t~ tF]U ^7DDFFF fPF2-0[ÉFFF^F t ~0r~9v˃~t^F^FF]U^FF^FFFFFF~=tF~Q} ^F u֋^~=t+>F-FP+PF[7S t^FF@ F<+9F|+]UvDDFPvcփF^G]UdžkiPyPtPrPo|v{oPGDD u S|<r|P|2HPotPPlP P`nPPR*PFPi u(r2PDD+PDD*PFPD umu|FuowPuP tw QwPuP tw 3wPuP tw wPuP~ tw wPuP` tw wPuPB tw wPuP$ tw wPuP tw wPuP tw awPuP tw CwPuP tw %wPuP tw wPuPp tw wPuPR tw wPuP4 twwPuP twuPkDD=t=t=t=ud=u>=u=u=u=u=u=uZ=u4=u=u=u=u=udžmQmPFPFP肷 tZFPߵDDyyPDD  qdžwwP DD uqPPw[؋[GqPw@[qPPwX#i t@[G t qGqP{2[GqGqP2[GqP[G P_DDsqsG>+PsPxOP8DDsqsG P DDsqsG PDDsqsGqww}  芤贷PȷDDP輷DD2䣽P褷DDF@FP萷DDHBFP|DDD>FPhDDJ}PSDDLdžwvPw[؋G[vPw[؋G[GFFFPPw[؋[FFPPw[؋[}}PPw[؋G[PPw[؋G [w2;w~G2PxDDPF2PeDDRF2PRDDNF2P?DDT}2P+DDVdžwvPw[؋G[vPw[؋G[GFFFPPw[؋[FFPPw[؋[}}PPw[؋G[PPw[؋G [w2;w~GD t +PPPPr{2PLDD|2PDDl2PPQn2PPA|2PDD֋]UN~u^FFPFF[ u]UFPP胝B+'F2䓡p+؊:B+uD+PF2[؊B+FF2䓡p+؀?uɠB+2]øPP1øP&DD u@| | P DDU| tF2PP]s G<"øEPDDU졆 t PF2[؊2P^DD PF2[؊2PFDD]U졀 u~ PF2[؊2PcDD]U졀 u~ PF2[؊2PDD]Uvt+[vr+[]á t  .T  },wrmhc2V?2IB)2t+tt+"r+@;+rãr+d U~VW^]_VLPF+F+\|+O,|+Fr+Ft+믡t+@;+rt+à|+ t~+ ++ à|+ t ++ ~+̀}+++ LF$++:+tu +++ +++'F$++:+t u+++ +++Vr+Ft+N ^ 3FVr+Ft+N ^ 1؎FVr+Ft+N ^ ,+<ux++Ë.3r+t+x+‹++r+r+t+#It Bx+‹r+t+SQ++ȋ+bY[>x+SU+MBnu]SU+Px+XGBnu]SU+Px+X;Bnu]PQ.9&+ YXPQ.9 YXPQ.0 YXZ +7 fF+ 5 e/òY)r+ *t+ !76RZRZëí@ `@ ` @ `+PP&=`|@U FPPv+P+PFPPv+P+PFv+FFPFPFPFPJ]áv+P+PD+áv+PP/+á+ t v+P+Pá+ tv+PPU; u+P P[+PPQF FF2P^2[ãz++PP#v+x+PPv+P+PFP,Pv+P+P~t@]U u+P P̕+PP•F FF2P^2[ãz++PP蔕v+x+]UVW^^^ ^S^X^^^ _^]UVW&^F^&^&_^]UVW7 VF^ F=u&&_^]UVWNV_؋F=t &G4 &G4q tfu q IfD=u =tS6[ 6   ע ע a> rp.  > u s u  SWB+yJMt%u @Bu 3'Pû Xt_V< u0^[ÅuO= t G03GG G23xà  } uE 0E:á 3ɃK  } uE 0E-E --3ҋ-<r @+ȋ3һm uHmP3۹ ; vSKƋσuu @;uB+ XYRZÉ x w Ëx gx g x 'x gx gx gx gx g x g x gx gx g x W É x W É x W É x W Ë FFÏ Р X& UWV^_]P3& 3r+t+  UVWR_^]>Y u >Y uUWV&t+r+@^_]UWV>  t 1x ^_]> & t1Uã WSގƾd <u[_2K> t + ø FFsPRUVыSrC+ӃuRPP9 tyX> 8& t 2& t;6 u &; t'. t3& &. t3q &׊YQR> Ou@tQ+ZY_^]ZXR > & uZ_ZS > Pr  > r  tWS&u( & 6$ o$ [_&&Pt ެ؊ (( & X 'ˈ& 2& t1W_UVWF9 < r 0C0P4 4 u9 4 uX #4 uU R,XPL1 u" б4 t,ߎǿd 6 =PCu&Y  u ǎg02 Awt &&6  t02 Awǎ߻d t 'Ș؋ t t ؊ " >X u P4 XPx >Y t=p+Z+X+˸+;tXP؎X󤿲 * mX_^]?Rӱ[u? u uøðâ   > ENM G C.C.C 󪱜G&_.t^2䠌 &tM& &OtSQY Q  u\O:O A3Ë E2 Ӄ N;t'  t;s!È O;u;s!.O;s!\ȋ +È ( t > t+ t^GPDD ^GPDDPDD]U$PF[G$_"$G=u $G $G& u $P [G&$G( u $PP [G( PF2PP]U^G ubv& DD^G2P^G2P^G u*F^G%2PADDF^G28Fr-^G!2PDDF^G%2P DDF^G28Fr^G"2PDDFq^G2P^G2PF2XP^G&2PDD^G2P^G2XHP^G2PF2XP^G'2PwDDF^G 28Fv^G2P^G2P^G2XHPd^G#2P3DDF^G(2PDDF^G28Fr^G$2PDD]U^G tYvDD^G 2P^G2P^G2P^G2P^G2^GG2+PPv]U^G^GvDDvyDD]U^GF^G FF^GF~t^GPF2X t+ t"v^GPF2XPF2X[GvF2[)GF^GP^G[;~vF2[GF^GP^GP^G2X[;ЋF tY^GPF2HXPF2XPF2XP^G2X+ÉF^G;F~ ^FGF tvDD]U^GF^GF^G FvDD^G u^G+Pv^G uQ^GF t ^G P^GPXF t'^G 2P^G 2Pv0vv8F t^G2䓋FÉF*^GP^G2[;} ^GP ^G2PXFFFc+PPvvv ^G t^GPFX؋ t+ t"F+FP^GPFX7vfFF9F|^G9F} ^GP^GPXF u(^G2P^G2Pv,vFP3]U^GF^G F^GFF Fv7DD^G* tl^G*PF HX؋F tR^GPDDvDDvF2PvFF vDD^G tv^G DDvDDF u vv ]U"^GF^GF^G F^G^G(FGFF^G u"^GFPvF2PvF. vDD^GF^G u^GPv~u+ +Pv ~u vDD+ +Pv ^G"FPbPDDFF FF^GF^_F+ÉFF t FFF v!DDFFF t!^GPFHX7ODD8Ft+ u^G t^G P^G XPF[^G=u ^G =^8 G PFHX؋ t@ t^G PFHXF +Pv vvF2PvOF u^GPv FF u F t+ tFFNF2䓋F؊FF tF t F t+ u+ u"F2F2䓋FP PF2X؊2% t. PF2X؊2% tF2-aAPF2PF2PX[^G$28FrNF2䓋FvFPvF ubF9FuF2Pvj F2PvvdF t(FFF@PFPv t@ tF 'F uF u^GPv +FFF2P^G9FuPF@PvF^G=u^G vDD+e^G PFHX؋ uN^G PFHX^G t^G P^G XPF[F +Pv] 4F~u'~~F29F~ F2)F NF2Pvv FF2P~u ^GPFHPvF^G9Fu~F2Fv^G[;j^GP^G2XP^G[;}H^GPvv^G[GPv8vF2䓋F+[G+PvQ(FF2Pvv)F t0NF<u^<uFFNF2Pv^G=~^G PFHX؋ t+ u^G PFHXF +Pv^G upFF^G9F}^G PFX؋;Ft+ u*^G PFXP^G PF@X؋[F^GH9F|~uFF2PPv^G9FuFF2P^GPv^GPv+^GPv^GPv^G t)F^G PFXF^G9F|ދ^G vDDDFF2PPv-^G=u^GPvF tvDDv:DDـ~t ~t+ tF~t ~t+ t vDDNF2F2䓋FPF2[F2䓋F+PPv8 vv= vDDF< u$~,uF2PX t+ t+ t3~,u@F5؊F u^FfFFFFFP PF2X؊2% t. PF2X؊2% tF2-aAPF2PF2PX[FF29F|Fb^G PFHX؋ uK^G PFHX^G t^G P^G XPF[F ^FGvFPvdF uvDDvDDFF2P^GPvF t2vvF2PvjF u^GPvFF2=*ui=u=u=u=u=ux=uM=u5= uu=uC= u=,ua= u-=u= u= uF2䓋FQ]U^GFGPv^FGPv+PvF2Pv]U0^G9F|+^G"FP.FDDFvF2[F^<u@F tF~u ^F@VC^GPFX؋Fո PF2X؊2% t0 PF2X؊2% tF2-aAPF2PXFՋF u^28Ft+ u~uF@ P^GPFX7PF2X+ÓXPFP΃FP&EDDFF PFPF2X؊2X؊2% ubFPF2XP PFPF2X؊2X؊2% tFPF2X؊2-aAPFPF2X؊2PX[F؊F28FsgF uF2@PF2X+ÈFFIF2PFPF2XPF2HFPD uvF2䓊F2H[F@Fظ PF2X+8F},FPF2䓊F2PF2X+2X؊ t+ tp F2HPFPF@P2D uF@F^G9F}+]U^GF^GF^G F^G uҋ^GHF^GFF t F+FPF+FPXFvDDF u/^G F2P^GF2Pv vDDF t^G=u+PF u^G=u+Pvvv ]U^GF^GF^G Fҋ^G(FGFP DD^G F+PPvF t}^GP^GHX؋FP=BDDPF2X+ÈFv!DDF2PvvvDD^G F^G FF2PF2䓋FPv^G& t^G&Pv^G tRF u^GP^GHX7v-Pv^GP^GHX7v^G 2P^G2[;s^G2P^G 2X+Pv F tF2PF2Pv8vZ DD]U^GF^GF^G F^GF^G Fz t ~~+ u | t^G t+ u+F^G PF+FX؊2@P^GPF+FX؊2PvF tF tz u ~u+ t+ th~u&~u^GPF@[;u+ t+ u+~~^G PFX؋ t+ u+ u+ t+ tvDDFF t PvVF^GPP^G u vX t+ t ^G2HHP ^G2P^G9F| -P^GPFX7v F tvDD]U^Gz t<Pv]UvF2[G vF2[G ^G2F^G2F^G 28Fs^G28Fs+ t(^G2䓊F2P^G2䓊F2P)˃]U^Gz t>Pv <]Uv, DDFF2PvFF28Frv DD]UF uvvv*DD^G 2P^G2XP^G 2[;rF t'F tv=DDF;F}+ t+ t"F2䓋F+FPvQ F2)FW^ t:^G 2P^G2XP^G2[;sFF2PvF t PvFN u(v.+lDⓋP[;uVG[GVD[GV[V[EⓋ;uWD[GWE[GW[5>.+_^]UVWvVDDFH+@FP3DDF u+R^;t8;s GP[N~uFNjF OPN[N~uvvf_^]V+Z-P [PDDF|^UVWvdž~u]džFFF^?t^?%u郾~vPv FFFF?%tdžFFF<-uFFFF ~0uFFFFFdž~*uv^FFF>0}dž PF2-0[ÉFFF~0r~9vĿ~.u+FFF~*uv^ǃFFF. PF2-0[ÉNjFFF~0r~9vdž~lt~LuFFFFt PP PPV tt P+P PPVO tt P+PPPV tPt P+PPPV tv^Fv^2䈆ƆF2PWPVF2PWPV^F2PWPVvvF2PH/zF2u<DP\X+ÉF ~-vDPPp9~tL*.V-HD%t|tD%tDDPDؙRPPDVD[G+f_^]UVvDD u]~u+S% t*. V-9%tvvV#%tvvV vvV^]UVW=uzV7DD .P[؋ǃ~u D-Pv% u BJ-Pv  u )PvV t*.#V- _^]U+Pvv^]U+PvvJ]UPvv5]UVvDD u+ % t@^]UVvDD u+%^]UvDD tD-+]UVvdDD u*. V-]DPvvbDPvvSD Pv~DDSPDPD Pvv)*.V-BF =t=t=tׁ$DP+PPX t DPPPDPX[^]UPHPPv(]UVWv .PF[؋FFWV  t*.V-}t vE[G~u$?P@PZ t*.V-^G2P DDF~u WPl>~u^%tEWvK>F~u%^% uE %tWFP>v^G2P ~u*.V-*~t~uF~+*.V-f_^]UVWF F v~_^]Z[w7ZYX[GZ[YX[SPZ[YX+[SPUF UFF 3FFF tVV FV FtVVFV F Fu3FFFFVV VVQvvvvYYs$QvvvvOYYYF^VV VVFu"F^Ft ]YSPF^ZX[؃SPZ[YX;[u;uPZ[YX;[u;u+PUN ;N|N;Nwr4F ]+׸ҸYXZ[WYXZ[)WYXZ[!!WYXZ[  WYXZ[11WZYX['WZYX[oZYX[QSPZX[YSPQ X[YZSPRQ& UWV+V Fu أ...F^ ;wr ;vr+v@6.>.^_]UVWvFtt+PPvXZF+Pvt tX tpVVDD tD\9 %SPD \-%SPX tP+PD4P>F+SPV[ t$+PvDD D%F+F;~vFu+ vRWvD4FP~DP+PWO~)~ @+PvDD F=uV~DD t!F~s`FF"PF+SPvF+SPV;Ft*.V-FFF~DP+PW~)~~wD\%SPD \-%SPSX tP+PD4PF+SPV  t\vvD4P @+PvDD FFDP+Pv'FFtttt X t ttD DFf_^]UVWv~+PvFFFNDPE+PPFFDP/vvhX tgVDD tDP X[%SPD PX[-%SPhX tvvV tDPvvD4PD%[ÉF+PvFF:= u ~ tF GFNFFF @DPPXX9Fs~w9FrV#DD tF^+F^<~u-DP$D PnX tD PDP F^ ~vf_^]UVWv~FO _^]UFFF^G2PDDFF:v P97F0Pvv+PP@vv +P@PX t,.%`u~~n,.% t,vv +PPX t +۸SPF ^SPXZF*vv +PPkX t +۸SPF ^SPXZFFv,P6FPv6F~t;~~ ,.% t  F FFFPFRP%FFPFRPF PFRPFPFRPFF vv +PPX tv^G2P]~t P,P5F^]UVWv%@t?"P+P@PD4PDPV-SP+P@P1X t*.V-$+_^]UVWv!P+P@PD4PvvVSP+P@PX t *.V-DPvv$+_^]UVWv P+Pv] P PF@PK PFPVIƀ<:u,FPvt=u PFPFPƀ<*uP?PF@P FPF@PFP<.uC PFPFPƀ<*uP?PF P FPF PFPS<;u) PFPFPƸPFPFP%+2< t< t<tf_^]UVWv~4GPD2P DDFDP#P0vD2P%D0P+PPX[-F^%uvv+PPRX uDPvvX t-vDD tvvV tDPvv+PP7{D4ǍFG;~s=uDPD4+ÙRP DP+PPCCDPF^SP+PP"DPD P X tDPD PD PDP DPX[f_^]UVWvLL2ljF2PPV/O Ff_^]UVWv2FF$+v8Ǔ?$u-^?$t v P/$PP.@ÉFG;~|Ë9Ft v P.Ff_^]ÃF FF2n=uDu&t t =ut u Etu Eut+؉^TV@^ RPFXY؃㓇ҋʋV҃VR ҃R FFufVVVV 3FFFFFߋOOO/ }^FuNfVVVF2n=uDutuEu=ut=tC^5VPF=uDuNu Eu:tV2u Eun=tuD\LE]M;} FNFTVTVTVVF2͈NV+=5vdE]M5r֊͊ߊĴt NuFu%VN^FF tFn^^^^N6V+VN^FsڃVuNJ݊Ίs^4u N6vF^NV t;#y ؃u3u ԊKs]UEË\ݱxT}`LTD| <$ Ċ֊tu"y؃33ҷt"ú"y@Bx"y"t -x@BËD-y-4|D$ \LU ֊͊ߊtEuDt]ENJ݊Ίu ]Mܓ3Dt̀24E3ۉ]]=t Dt]ËDEDEDEÁFsFuFuFF tFFF==|FtN2F4EF^NE] E%-D%-þB RPB BXZB R FFuþRs BuBuBFFGG uËGW/_uF ^VNNNð n3FtM]]ð3ZX[Ww7ZX[)_w7ZX[w7WZX[w7)_+VW؎6|*6Du6|OuA_^+_^úUVW؎~*ʋ~OvJsF_^]UVW؎~+ыv~tH@UVW؎~+ыv~t|&]awaawa:t밋W؎6*ыH_UVW؎*~V+ы~vOs\UVW؎+~V+ʋ~vss+UVW؎+~V+ыv~t H@F_^]UVW؎N~vs_^]UVW؎~FNs_^]UVWv؎~F~ ī_^]UVW؎^vN ~s_^]$@Y@@@@j@.AcAחA7yACyCxDnF\)c=Hsȡ1I=P1PK?O8M20HwZ$gAAI0G +OI~.G ~0GIJuO=0tG^_ä.G I Enter one or more Concurrent command lines; ESC returns to the File Manager.S O R T I N G ...READING DIRECTORY... (Press ENTER):*HELPn@n@>n@>(5BO\iv,9FS`mz csBB~v <!I#xPq_PH((X((4(;(vF|F) F)&^4iT)r!:)L:z)z)Q!))Zg)  <  )B s Q F)n&:;Q;|?ALIQRSS.VH&H&H&VVWXXXH&H&H&H&H&H& `(|D$@\x <Xt ERROR: Cannot read disk!Read only diskPhysical disk error Press Esc to Return to File Manager $A>$Insufficient Memory $File not found $Out of Memory DOSCP/M Media| You are here  DIR #1Subset of files = Main1 2 FILEMANAGER These files were MBk*.*HELP.CMDToo many files selectedChange DirectoryHelpView FilesSet Directory 1Set Directory 2Make DirectoryRemove DirectorySelect the highlighted directoryon changing directorieson the highlighted directoryto the highlighted directoryto the highlighted directoryEnter the name of a new onedelete the highlighted directoryChange DriveHelpView FilesSelect the highlighted driveon changing driveson the highlighted driveYou can only delete subdirectoriesDIR #1 set to: Enter a new directory name: No Space, try another diskDirectory not emptyFiles on ...\\ You are here Subdirectories . . . Dir above You are here Subdirectories . . . Select a directoryn@Error on drive USER.TXTSelect a driven@n@ *.*This command requires DOS mediaInvalid pathCannot change directoryInclude ? or *, 12 characters max.Enter wildcard (? matches any character, *.* matches all): Press return for next pagePress return to type Last page of Press any key to quitTyping NOT typed Printing, Press ANY KEY to stop printingPrinter not availableNOT PRINTED HelpCopy to A:Copy to B:Copy to C:Copy to D:Copy to DriveCopy to Dir #1Copy to Dir #2Copy to DirCopy to New Nameon duplicating filesyour selected filesyour selected filesyour selected filesyour selected filesfor drives other than A: - D:f: irst set Dir #1first set Dir #2select destination directorycopy the file, but give it a new nameCOPYTMP.$$$>>> CHOOSE A DESTINATION FOR THE FILES SHOWN BELOW >>>> NOT CopiedCopy NOT COPIEDPress ANY KEY to stop copyCopy doneCopy abortedRenaming temporary fileWriting Creating to Reading on Single drive copy (Y/N)?press enter (any other key ABORTS): Insert source diskette Insert destination diskette Error opening source file Error making destination file Error writing destinationDestination must be different than sourcenot enough memory for a copy buffer NOT copied, READ ONLY file on destination n@Rename, NOT RENAMEDYou cannot specify a drive. ERASE, are you sure (Y=yes) ? YNOT ERASED CLEAR: 2,27,69 ATTRIBUTE: start screen: 9,27,99,0,27,97,3,27,98,2 ATTRIBUTE: leave screen: 3,27,98,7 ATTRIBUTE: general: 3,27,98,2 ATTRIBUTE: errors: 3,27,98,15 ATTRIBUTE: message: 3,27,98,14 ATTRIBUTE: data: 3,27,98,3 ATTRIBUTE: input: 3,27,98,12 PRINTER INIT: 1,13 FORMFEED: 1,12 LENGTH: 60 WIDTH: 80 REPORT PRINT: true SHOW SKIPS: true ID:Concurrent DOS Hard Disk Backup SPLIT: true ERASE: true Backup/RestoreBackup and Restore your hard disk filesBACKUPBACKUP.CMD&&&'!'A'b''''''''(*(8(F(Bad file type, only Run a ProgramCMDBATCOMEXECMDBAT !A:\CDOS.COM /C .CMD, .COM, .EXE, or .BAT files ((((((DSKMAINT.CMDSize/Date ON ON OFFSystem disk undefinedNOT set*SETUPSYSTEM ATTRIBUTESFUNCTION.CMD!SETUP /PARAMFDISK.EXEFM.CFGEND DRIVES=OVPMODE=MENU POSITION=OBJECT FG COLOR=OBJECT BG COLOR=COMMAND FG COLOR=COMMAND BG COLOR=PROMPT FG COLOR=PROMPT BG COLOR=MENU SIZE=PROMPT SIZE=TOP MARGIN=BOTTOM MARGIN=LEFT MARGIN=RIGHT MARGIN=KEY FG COLOR=KEY BG COLOR=NO FM.CFG file on drive A: user 0, ABORTING ))))))))))))))))))* *2*D*U*f*q*~*******.* D+P%iIncorrect Concurrent DOS version.$Incorrect Concurrent DOS version.$PCTmpUse sysdisk d: to define a system diskDirectory already exists--------------------------------------- *** V I P *** 06/01/84 VER 0.40 SERIAL NO. XXXXX ALL RIGHTS RESERVED COPYRIGHT (C) 1984 DIGITAL RESEARCH,INC --------------------------------------- (,R,|,,,, <> ... CprogramCON:LST:   --: unmatched quoteCannot open Cannot append Cannot create : No matchStack Overflow $<>.,=:|[]* sp.-bkspc.TERM DAT FILE MANAGER COLOR CONFIGURATION This file, if present on the system drive, allows you to override the default File Manager Colors for the Object Window (WINDOW), Command Menu (MENU), Prompt Window (PROMPT) and Function Key Legend Window (KEY). As an example, this file contains the default colors used for File Manager if this file is not found. That is, in this case the file need not be present for these colors to be in effect. Feel free to experiment with different color combinations. The colors 8 - 15 are special colors, in that they only apply to foreground. Foreground colors assigned from that range are converted to the corresponding background color by subtracting 8 from the color number when the display is reverse video mode (highlighted). Similiarly, background colors assigned the 8 - 15 range below, assume the corresponding background color in normal mode and are the specified color only when displayed in reverse video mode.  (Note the colors must be specified as numbers and the rest of the color specification command, e.g. "WINDOW FG COLOR=" must be exactly as shown, no additional spaces, etc.) ********************************* * File manager colors * ********************************* (WINDOW means the object window) (MENU means the command menu window) (PROMPT means the prompt line) (KEY means the key legend) Colors must be entered as a number as follows: Standard colors for both foreground and background. 0 -> Black 1 -> Blue 2 -> Red 3 -> Magenta 4 -> Green 5 -> Cyan 6 -> Brown 7 -> White Special (high intensity) colors for Foreground only (These colors are converted to the above standard set when displayed in background) 8 -> Grey 9 -> Light Blue 10 -> Light Red 11 -> Light Magenta 12 -> Light Green 13 -> Light Cyan 14 -> Yellow 15 -> High Intensity White OBJECT FG COLOR=0 OBJECT BG COLOR=5 COMMAND FG COLOR=14 COMMAND BG COLOR=1 PROMPT FG COLOR=15 PROMPT BG COLOR=3  ࢳд!T!!2ㆠ3+u ub t/<+tHu^GtG3Ҡ.!3|uVGOr dursuy Concurrent DOS Serial Terminal Configuration file for EDITMENU, COPYMENU, RUNMENU, and FILE-MANAGER. Digital Research, Inc., 1985. Terminal type: Zenith Z-29. ^ >< ~ kh !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~. : fc ii`tttcct`cdddceusvabvvefusvabuusseeffbbdfi p,- * /+ g @ o 2l FFFFLLFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFLLLLLFLLLFIIIIOOIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIOOOOOIOOOIRURRRRRRRURRRRRRRURRRRRRRURRRRRRRURRRRRRRURRRRRRRURRRRRRRURRRRRRRURRRRRRRURRRRRRRURRRRRRRURRRRRRRURRRRRRRURRRRRR^URRRRRR^URRRRRRR[XXXXXXR[XXXXXXX[XXXXXXX[XXXXXXX[XXXXXXX[XXXXXXX[XXXXXXX[XXXXXXX[XXXXXXX[XXXXXXX[XXXXXXX[XXXXXXX[XXXXXXX[XXXXXXa[XXXXXXa[XXXXXX: "%(+.2:=@C6Y EKJvwy5x5s0ABCDFG &.2ұn-N% ࢵ&G> udXш&& ôP!3 ࢳд!T!!2ㆠ3+u ub t/<+tHu^GtG3Ҡ.!3|uVGOr dursuy Concurrent DOS Serial Terminal Configuration file for EDITMENU, COPYMENU, RUNMENU, and FILE-MANAGER. Digital Research, Inc., 1985. Terminal type: PC Type Terminal (eg Wyse 60)PC  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@C@@@@@@@C@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@C@@@@@@@C@@@@@@@"%(+.147:=Y EKJvwefABCDqp&.2ұn-N% ࢵ&G> udXш&& ôP!3 ࢳд!T!!2ㆠ3+u ub t/<+tHu^GtG3Ҡ.!3|uVGOr dursuy ECopyright (C) 1983, Digital Research, Inc.Serial No. XXXX-0000-654321$؎\&p >tN M    |   x ! < u<taP 33 VE ^ tu =`uú 33ౙ<úB  33>tZ4QV^YFFíI&V ^DL 6Qo Y+OþZ4ȭ;\|+\2Xȭ;|+SX+;tR[SV>Q ^[ C .WËt[SVRL8 X^_L|D ÿ DW|L+Lڎ_VQ  o É QW _YQW3 _Y<u<u ; }<\tQ_YQWSCCSW@2 _<u;~}YYY2;~|YYY}00tËC;X|3ۉÌ )))(؋_.ڎ‰XQV^YíQV^YÀ>u>DD |L66QWV4^6_>YËDDDL >>À>uŽ)& u QV^YZŽ) t< v<~w-P\!XP X $'@'ê>u Wб<_ì<\uPX$ ÊL|QWt/<\u t&rPt[r _Y<tX_Y-ab>e t">et\ uþ=t/ ePfFgK>tD,aY\Q t<t'  t3Ɋ̸ᣑ2ð6;6r t<tƖ6<^3ɿv' !|  8  G GÃ3FVQ  G6< t<\t"\G0G0GY^AB;t6AVRZQY^þ!GWP_0GES<t_.&G..+Ȋ؊ S[ӿ2 . S2؋[û<t4dt1Uu([KtS[K?:td[[Kt.CPCFCKC CZ|V[LuKCA|ȀPÀ@dSt< t0<.t,<:t(<t$dtA<.tGC t GAò ñ-dd=u1,dP,X<ud, Tu u0u )"u u Cû'^íV3^V&K&C^4K&73P&WW'tP3Xm(.2þ((s(m(g(2((U(OmD(Aò3))OË))gË))t3OË))g) u ) )2)3ñ )À>)u)À>)t))&G)}2 ),&T)))(&#)RS)J!)&G):)2,&T39)"%)&G')&_(P*))08=Z#)&#)R))8Y|4-Z))`ñ8ñﱋ6%))&L&\))39&GPS&g)p[X&GË*)'),)3یŽ؎&>))tێێË*) Ž')3S)!)&O[S)!)&g[))(ñ 8 ?COPYRIGHT(C)1983,84,DIGITAL RESEARCH(05/02/84)XXXX-0000-654321PSQRR&K&ZػC?u3&1GV[3&1SZY[XUVN uR)+-/]Z[َѼSRË$X=?><=@>V=V}= PEPPP>>>u{P_P>>>u6R=sA>PT>}=u>>RPA?>3 }=8}=u>>=QQd<u= >PX= PX=sh?>PX=X=sU P?>PX= P|6}= ?>PX= Pe?>PzX= PUPa?>PcX= P>>>X=sPW= PP5UPP]UPFP]U Pv]U Pv]UPFP]U PP]UPv]U^G G PS]UPvz]UPvj]UPvZ]U^G G PSA]U!Pv1]UPv!]U$Pv]U PFP]U6$<t]à]U6PvAPFs]UNv~]U[>\>\>< r@\>΋^P u@Y"s"^:t:s[>[>\> \>뷠[>]Y>=@=QU]>>>=u89`>@=]Á>>=vH>=_>_>;>=w}@=H=v89]>+`>^@=@89_>u]Ã>>=vB_>_>;>=w2@=@?v89]>`>@=/@89_>u]Ua>]>8a>wSa>1Í:9P'`>Q<tP>=PDPB`>a>uP]UFF<vP<tX=FF]Ub>S="V=sf^:@>v][P^^?u P^wP^?uP^o!^? tb>^ ^ P]b>]UB=D=PP]Uc>>uc>c>:w#À t c>,uƇ c>uc>c>:r@c>P t@Y"sc>֊c>.u >>d>Ƈ d>d>c>>c> wPQc>Í=Pc>u۠d>c>e>h>i>e>u@h>"r uf>e>P< u@YP[u@Z"Pu@Z"P>f> r@P>c> r@Z"Z"s@`v{s c>c>e>f>öֈ=e>f>uc>c>< wi>sh>He>[u;c>ȱÀ= uc>Ȣc>c>Ƈ=[e>c>i>e>R=S=T=U=8c>wf>f>< rÀ=[uo=CuT=f>À=Eu U=.c>@f>À=Ntf>À=Lu R=S=͠f>À= uc>f> f>sc>]UF=n>m>L=>>j>< s>>>uF=:=F=N=m>F=+H=J=H=QP F=m>r%H=À:9$um>H=ÊI9:j>tn>s[n>?>Pk>>j>um>s+PH=PP>j>w m>sP?>Pk>PN=1u?>Pk> Pk>>k> wk>Ƈo> k>u|>$ PH=Í:9Po>Po>P_N=H=ÊI9:j>sm>H=P6L=L=n>s?>P'k>PP]U>~>>>P=>>=uS}> }>À= u}>}>,=>}>Í=P=>Í=P>=>Ê=>>>t >=t>=u=>Ƈ= ~>Њ>"rP=À:9$u>>8I9t>>ƍ=P:9Pk>>>t PP=Í:9P>>Í=P$>>>>>s >>>>>><wÀ= t=[u >~>?P=PPJ>->sP=Ê>:I9r> P=PP>sXP=@:=PP=ÍF9PPxPP=ÍF9@PP^P=ÊH9W=I9>>>=u=>Ê>=>>]U>>:Fr@X="sE?>PX=X=s>>:>w P>uꠅ>Í=P>]U Pe6>>X=s ?>PjX=X=sP<tPW=P PDX=]>>ѠX="PQ<t@Y"sѠW=Ȣ>>><v@>"r>><uX=>>ЊX="P>>r@>P/t@Y"Y"s%>Sj>>˷S>[>먀>>u> >Ƈ>$X=Њ>"s6>> uS=s ?>P6X=6>>>v>P> W=UP!PHP$?>P>"PHPƇ?>r>>>tR=sA>P>]Ì>>&>R]&6h&\ >Z(>&CSQS[Y< u< t<u t͠(>V<u<u t&K<u QS><u[>:(s(<u[&>>b<u7Q}Y[SQ tC&QS:[YS> t*(>F>u<u؎(:sC&QS[Y-C& [&/> >>G&>á> u Q8Y Qѱ,Yá> t>>t u>Ê>> u>>< t< t < t<t< t0<u >t<u<u >`<u3>ã>>ud<t(< s(t<u(< u(Êxs P^Y@ u ($u  #(:>s  zQYË<$tAQY! ERROR: $ $Reading file HELP.HLP.$ Press RETURN to continue $ $ $ Topics available:$ For more information, type a period and one of the following subtopics:$ $ $ $Reading file HELP.HLP.$ HELP (Enter topic, ESC to exit)> $HELP HLP HELP UTILITY V2.0 At "HELP (Enter topic, ESC to exit)> " enter topic {,subtopic}... EXAMPLE: HELP (Enter topic, ESC to exit)> DIR EXAMPLES $? HELP HELP Topic:$Not found$No HELP.HLP file on the default drive.$ This program cannot be run from a menu from the Serial Terminal.$ DATE OF LAST CHANGE 26 AUG 84 Requires Concurrent $@R"Concurrent Function Key ProgrammerFUNCTION $@ # Main Menu!S E L E C T F U N C T I O NHS^ F3  $i F5  $F7 $ Assign Function Keys Save Function Keys in a File Reset Window Switching Keys DATE OF LAST CHANGE 26 AUG 84 4 0123456789aAbBcCdDeEfFf jpv |  8 B F1: F2: F3: F4: F5: F6: F7: F8: F9: F10: #  Home: : Pg Up: -: -: End: : Pg Dn: Ins:  Del: -! Alt F1: Alt F2: Alt F3: Alt F4: Alt F5: Alt F6: Alt F7: Alt F8: Alt F9: Alt F10: # Shift F1: Shift F2: Shift F3: Shift F4:  Shift F5: Shift F6: Shift F7: Shift F8: Shift F9: Shift F10: - Ctrl F1: Ctrl F2: Ctrl F3: Ctrl F4: Ctrl F5: Ctrl F6: Ctrl F7: Ctrl F8: Ctrl F9: ;  Ctrl F10: -Press the Function Key you wish to program 9or Carriage Return to display the other sets of keys  2 BJP-You are now Programming the selected Key. 6To terminate the sequence enter Ctrl @ or \00 -Type -- to erase a character ; The file specified in the command line was not found. = The file specified in the command line cannot be opened. $ Error while reading input file *F1 * *F2 * *F3 * *F4 * *F5 * *F6 * *F7 * *F8 * *F9 * *F10 * *HOME * *UP * *PG UP * *LEFT * *RIGHT * *END * *DOWN * *PG DN * *INS * *DEL * *ALT F1 * *ALT F2 * *ALT F3 * *ALT F4 * *ALT F5 * *ALT F6 * *ALT F7 * *ALT F8 * *ALT F9 * *ALT F10 * *Shift F1 * *Shift F2 * *Shift F3 * *Shift F4 * *Shift F5 * *Shift F6 * *Shift F7 * *Shift F8 * *Shift F9 * *Shift F10 * *Ctrl F1 * *Ctrl F2 * *Ctrl F3 * *Ctrl F4 * *Ctrl F5 * *Ctrl F6 * *Ctrl F7 * *Ctrl F8 * *Ctrl F9 * *Ctrl F10 * *Scr swtch */ / //--   4 .PFK 3  4I SAVED" -3M 9:Invalid Drive  -- Press any key to continueyM ;Directory Full -- Press any key to continueM ?Bad Sector on Disk -- Press any key to continueM #;Read Only Disk -- Press any key to continuedjM p6Disk Full -- Press any key to continueM ;Unable to Open -- Press any key to continueM <Unable to Write -- Press any key to continueGC I()*,:;<=>?[\]|KEYS PFKFUNCTION SAVEFUNCTION SWITCHChanging Window Switching Keys !,7(F2 2B F3 P (F4  2Y F5  ` (F6 2h F7 w(F8 2 F9  Keypad Only Shift Alt Ctrl Shift + Alt Shift + Ctrl Alt + Ctrl Shift + Alt + Ctrl Z9{CSave Function Key Assignments?You can enter a file name to save your function key assignments ?:in. At any future time you can restore these function key 9assignments by entering the command: FUNCTION +where is the file entered below. L FUNCTION KEY FILE NAME is: 4IKEYS.PFK `kF3 $vF5 $ Change File Name Save Function Keys DATE OF LAST CHANGE 26 AUG 84 p b v&y&&&y&&N&PĿ --I '''''' F1 ' HELP ''' ' ' ' '!(G((ESC2( Exit this program (ESC2,( Go back to previous menu(ESC2R( Stop current operation o(HELP STRING NOT INITIALIZED $ DATE OF LAST CHANGE 26 AUG 84 Yw6fE Eqt7evsttpqru ef DATE OF LAST CHANGE 26 AUG 84 MXdisk < 8VCMXQ@ HELP FACILITY TAKES OVER AT THIS POINT. PRESS ANY KEY TO GET BACK TO PROGRAM. $E$ Printer Busy $&.2ұn-N% ࢵ&G> udXш&& ôP!3 ࢳд!T!!2ㆠ3+u ub t/<+tHu^GtG3Ҡ.!3|uVGOr dursuy .K default CURSOR MOTION COMMANDS KEY ACTION up arrow Up down arrow Down left arrow Left right arrow Right PgUp Page up PgDn Page down Ctrl-left arw Word left Ctrl-rght arw Word right Home Beginning of buffer End End of buffer F3 Beginning of window F4 End of window F5 Beginning of line F6 End of line Alt-g Go to line (prompts) This is the first of 4 help screens; press Alt-h again for second screen. .M default2 EDITING COMMANDS KEY ACTION Backspace Delete character to left of cursor Del Delete character at cursor Alt-d or F9 Delete entire line Alt-F9 Delete line to right of cursor Alt-u Insert last deleted line above cursor (undo) Alt-a Get blank line below cursor Alt-i Get blank line above cursor Ins Toggle between insert and overstrike mode FILE COMMANDS KEY ACTION Alt-e Edit new file (prompts) Alt-f Change file name for next write (prompts) Alt-r Read file into buffer below cursor (prompts) Alt-w Write contents of buffer to file (might prompt) Press Alt-h again for third help screen. .M default3 BLOCK COMMANDS KEY ACTION Alt-k or F8 Mark lines to copy, move or delete Alt-c Copy marked lines below cursor Alt-m Move marked lines below cursor Ctrl-d Delete marked lines SEARCH AND TRANSLATE COMMANDS KEY ACTION Alt-s or F10 Search for characters that match a pattern (prompts) Alt-F10 Continue search Alt-t Translate characters that match a pattern (prompts)  Press Alt-h again for fourth help screen. .M default4 WINDOW AND BUFFER COMMANDS KEY ACTION Alt-1 or F1 Edit in window 1 Alt-2 or F2 Edit in window 2 (split screen if necessary) Alt-o Restore screen to one window Alt-b Swap to different buffer (prompts) MISCELLANEOUS COMMANDS KEY ACTION Alt-x Exit from DREDIX or exit from prompt Alt-p Display status of files, buffers, windows, etc. Alt-h or F7 Get help Characters typed on the alphanumeric keyboard (including tab) are ins< erted at the cursor, pushing the rest of the text on the line to the right. Inserting a RETURN splits a line; deleting a RETURN joins two lines. Additional help is available whenever DREDIX prompts you for additional information (for example, a file name). You may press Alt-h at any time, and DREDIX will give the help that you need. .M default .K Pattern Type a pattern to be searched for followed by a RETURN. If you want to cancel this command, press Alt-x after pressing the space bar. Simple patterns consist of letters, numbers and most special symbols. Upper and lower case letters are different. Special characters can be used to build more complex patterns. If you don't want a character to be special, precede it with \ (backslash). CHAR SPECIAL MEANING * Matches any string of zero or more characters. ? Matches any single character except end-of-line. \ Makes next character (*, ? or \) non-special. .K Replacemen Type text to replace text that the pattern matches, followed by a RETURN. The RETURN isn't part of the replacement text. If and when a match is found, you will be prompted to enter one of three responses: RESPONSE ACTION Alt-x Terminate the translation process. Translations that were already made will remain made. l (local) Perform this translation, and go on to the next match. g (global) Perform this translation and all other translations. [space bar] Skip this translation, but go on to the next match. Hitting any other key is equivalent to hitting the space bar. If you want to cancel this command, press Alt-x after the space bar. .K treply DREDIX is ready to make the translation you requested, but first it wants your approval. You must respond with one of the following: RESPONSE ACTION Alt-x Terminate the translation process. Translations that were already made will remain made. l (local) Perform this translation, and go on to the next match. g (global) Perform this translation and all other translations. [space bar] Skip this translation, but go on to the next match. Hitting any other key is equivalent to hitting the space bar. (The most likely response is pressing "l" or "g".) .K File Type a file name followed by a RETURN. If you want to cancel this command, press Alt-x after pressing the space bar. .K Line Type a line number (from 1 to the number of lines in the buffer) followed by a RETURN. If you omit the line number or use a line number of zero, you will go to the first line of the marked block. If you want to cancel this command, press Alt-x after pressing the space bar. .K Buffer num Type a buffer number or file name followed by a RETURN. The buffer you specify will be brought into the current window. If the buffer was previously associated with some other window, then the two windows will exchange buffers. Otherwise, the old buffer will not be associated with any window. In any event, the old buffer will remain undisturbed, and you can change back to it later. If you specify a file name and there is a buffer associated with that name, then that buffer's number will be used. If the file you specify isn't associated with any buffer, then an error message will be given. If you want to cancel this command, press Alt-x after the space bar. .K OK to lose If you just issued an edit (Alt-e) command, then the problem is that you haven't yet written out the changes you made to the current buffer. If you respond with "y" followed by a RETURN, then you will lose the changes.  To get a chance to write out the changes with a write (Alt-w) command, respond with "n" or any character other than "y". If you just tried to exit (Alt-x), then the problem is that some buffer (not necessarily the one associated with the current window) hasn't been written out. If you're not sure which buffer it is, type "n" followed by a RETURN and use the Alt-p command to get a status display. .K memfull Memory to store text is full! No more text can be read in, and no more editing can be done. You should exit from DREDIX immediately and start over. If you have made changes that you want to save, you may issue a write command. If you haven't made any changes, just exit.  ࢳд!T!!2ㆠ3+u ub t/<+tHu^GtG3Ҡ.!3|uVGOr dursuy  Mr. Bob Thomas 279 Apple Wood Blvd. Tarzana, CA 91356 Dear Mr. Thomas: On Tuesday, March 31, our Tax Department received three shoe boxes via Express Mail which they assumed contained your tax records. Instead, the boxes contained the following: one pair athletic shoes, powder blue with white swoosh, size 12 one pair wing tips, brown, size 12 EE one pair ladies dress sandals, red patent leather, size 7 We are returning the shoes via registered mail to your home address. Mr. Thomas, you may want to check with your shoe repair shop to see if they are in possession of the boxes containing your receipts. If so, please expedite the records, as April 15 is fast approaching. Sincerely, Suzanne Johnson  ࢳд!T!!2ㆠ3+u ub t/<+tHu^GtG3Ҡ.!3|uVGOr dursuy Welcome to DREDIX! We'll be explaining how to use DREDIX in a series of short, simple lessons. Each lesson will appear here, at the top of the screen. You'll be able to try out what you learn at the bottom, where the cursor is. When you're finished with a lesson and ready to go forward, hold down the Ctrl key and press f. If you want to go back to an earlier lesson, press Ctrl-b. Now, press Ctrl-f and the lessons will begin ... @ ENTERING TEXT Type something on the alphanumeric keyboard. Did you notice how each letter was entered onto the screen where the cursor was, and then the cursor moved to the right? This is the basic way you enter text using DREDIX. Now try using the RETURN key. Notice how it ended the line and moved the cursor to the start of the next line? Try entering some more text, and when you're ready to go on, press Ctrl-f. If you want to go back to the previous lesson, press Ctrl-b. @ MOVING THE CURSOR UP, DOWN, LEFT AND RIGHT To move the cursor around, you use the arrow keys at the right of your keyboard. Press the up arrow to move up, the down arrow to move down, the left arrow to move left and the right arrow to move right. Try it. Did you notice that sometimes pressing an arrow key didn't do anything? If there's no place to go (for example, UP when you're already at the top), then that's where the arrow key takes you: no place. Press Ctrl-f to go on, and Ctrl-b to go back. @ INSERTING TEXT If you move the cursor to somewhere WITHIN a line of text and then type, the new text will be inserted where the cursor is. Since the old text has to go somewhere, DREDIX pushes it to the right. Give it a try. Try this too: Move the cursor to the middle of a line and press RETURN. The line is split! You can think of this as inserting a "RETURN" into a line. Press Ctrl-f to go on, and Ctrl-b to go back. @ DELETING TEXT One more lesson, and you'll know all you need to start typing a manuscript or a program. What if you want to erase something = you've typed? If you notice a mistake right away, you can just backspace over it with the backspace key. Or, you can just move the cursor under the character you want to delete, and press the key marked Del. Try it out. So now you can enter, insert and delete text! Press Ctrl-f to go on ... @ JOINING LINES Remember how you could insert a RETURN as though it were an ordinary character? You can delete a RETURN, too! Try moving the cursor to the far right of a line (not the last line, though), and pressing Del. Two lines are joined into one! So inserting RETURN splits lines, and deleting RETURN joins lines! There's lots more to come, so press Ctrl-f and we'll continue... @ GETTING HELP One of the most useful commands is the HELP command. You can issue this command at any time to get some help from DREDIX about what to do in whatever situation you`re in. Try it: hold down Alt and then press h. Are you back? Do it again, if you want. Commands like "hold down Alt and then press h" will be abbreviated "Alt-h" in these lessons, on the help screens and in the DREDIX User's Manual. Now press Ctrl-f ... @ EDITING FILES Tired of typing? Want to get a lot of text in a hurry? The EDIT command tells DREDIX to read in a file of text (or a program, or some data, or whatever). To issue this command, press Alt-e. (Remember: hold down Alt and then press e.) Answer "y" (followed by RETURN) if you get an "OK to lose changes" question. DREDIX has displayed the prompt "File:" and placed the cursor after it. It wants you to type a file name. Type the name "text". (Don't forget RETURN.) You should have a window-full! Press Ctrl-f to do some things with this text ... @ SCROLLING Now, there's more text in the file "text" than DREDIX is showing (you probably suspected as much). Move the cursor with the down arrow. Notice what happens when you reach the last visible line? DREDIX scrolls the text automatically! Now go back with the up arrow. DREDIX scrolls it back up. In fact, you're free to move the cursor through the text any way you want, and DREDIX will move the window to keep up. Practice a while if you like (go ahead and change the text if you want to--you can't hurt anything). Then it's Ctrl-f and more ... @ SCROLLING SIDEWAYS DREDIX not only can scroll up and down, but it can scroll sideways, too! To see this, you'll have to help out by editing the file "text" a little, but you've already learned all you need. First, join two lines together by moving the  cursor to the end of a line and pressing Del. You've probably made the line too long to fit on the screen (more than 80 chracters). Move the cursor to the right (as though you were moving it off the screen). The window moves with it! You might want to play around with this a while. It's fun! And then Ctrl-f ... @ THE SCREEN It's time we explained a few things about the screen. As you can see, it's divided into two windows. You've been working in the lower window, and we've been displaying lessons in the upper window. At the lower right DREDIX tells you what file you're editing, the column you're in, the line you're on and the total number of lines. It also tells you what "buffer" you're in (B2), but we won't worry about buffers right now. Messages show up at bottom-left, and prompts above messages. Now, Ctrl-f ... @ JUMPING AROUND Moving the cursor up and down a line at a time can get pretty tedious if you have a large file. Here's how to move around in a hurry: the Home key moves the cursor to the very first character in the file, and End moves it to the very last character. Try it (you should still have "text" in your window). PgUp moves the window a bunch of lines up, and PgDn moves it a bunch of lines down. How much is a bunch? It's however big the window is: 10 lines right now. Of course, if there's nowhere to go, you go nowhere. Ctrl-f ... @ DELETING LINES If you want to delete a whole line, you could delete a character at a time. But there's an easier way: use Alt-d. If you delete a line by mistake you can "undo" the damage with Alt-u. You can think of Alt-d and Alt-u as opposites. Try to undo the deletions you just made. Then delete them again, and undo them again, and ... Enough of this game ... onward with Ctrl-f ... @ WINDOWS DREDIX actually has two windows, numbered 1 and 2. We've been in window 1, and you've been in window 2. You have to stay in window 2 while you're taking these lessons, but when you use DREDIX for real, you can edit in a full-screen window (window 1) or in split-screen windows (1 and 2). You'll use the F2 key to go to window 2, the F1 key to go back to window 1, and Alt-o to restore the screen to one window. A full explanation is in the DREDIX User's Manual. Press Ctrl-f to go on ... @ SEARCHING Scanning the whole file to find the text you're looking for is OK, but there's a nice of way of getting DREDIX to do the hunting for you. You type a pattern, and DREDIX finds the text that matches it. Here's how it goes: press Alt-s, and DREDIX will prompt you for a pattern. Try it! Now, type the pattern. How about the letter "e" for starters? (Don't forget RETURN.) DREDIX has moved the cursor to the first "e" it found. You can edit there just as if you had moved the cursor yourself. Ctrl-f for more ... @ MORE ON SEARCHING Frequently, when DREDIX finds something that matches your pattern, it's found the wrong match. Maybe it wasn't the first one you wanted, but the next one? You can tell DREDIX to look further along without retyping the pattern. Just press Alt-F10, and DREDIX will find the next match. Go ahead, try it. Try more patterns (they're not limited to single letters, of course). There's more to patterns than we can go into here, so on to translating (Ctrl-f) ... @ TRANSLATING Automatic translation is one of DREDIXs most powerful features. For this you use Alt-t. DREDIX will prompt for a pattern and then for a "replacement". Whatever the pattern matches will be replaced by the text you supply. Do this: press Alt-t. Then type the pattern "girl" (without the quotes), and after RETURN, the replacement "young woman", followed by RETURN. DREDIX will stop the cursor at "girl" and display a message. To decrypt it, press Alt-h to get help (we thought you'd like to use help for once). Then Ctrl-f ... @ MORE ON TRANSLATING You can make the replacement string empty, and thereby just delete whatever the pattern matched. You supply an empty replacement string just by responding to the "Replacement:" prompt with an immediate RETURN. There's too much more on translating for us to go into it all now. So we'll move on. If you'll press Ctrl-f ... @ SAVING YOUR CHANGES When you're finished making your changes, press Alt-w to rewrite the file you're editing with the version you've created inside DREDIX. Until you press Alt-w, your changes aren't saved. Since a power failure or other glitch can terminate your editing session at any time, it's a good idea to write your changes with Alt-w every few minutes, even if you're not finished editing. That way you stand to lose only your most recent changes if things go wrong. Press Ctrl-f ... @ QUITTING Feel like quitting? Well, even if you don't, you might want to later, so here's how: press Alt-x (the same keystroke that escapes from Alt-t). If you try to quit without writing your changes (Alt-w), DREDIX will ask you if it's OK to lose your changes. If you answer "y", you'll quit anyway. If you answer "n= ", DREDIX won't quit and you'll get a chance to save your work first. This is a nice safety feature! If you don't want to quit, school's still in session, so press Ctrl-f ... @ GOING PLACES Would you like to go directly to a line by specifying a line number? Try Alt-g. It'll prompt you for a line number, and if you supply one the cursor will go there right away. It's a little like searching, but via a line number instead of a pattern. Useful if your compiler just gave you an error message and you want to see what the line in question looks like. Now, we'll move on to moving, with a gentle press of Ctrl-f ... @ MARKING LINES TO BE MOVED Moving lines from one place to another is a three-step procedure: 1. You mark the line or lines you want to move (with Alt-k). 2. You place the cursor anywhere on the line where you want the marked lines to be moved to. You can do this with the arrow keys, with searching (Alt-s) or with the go command (Alt-g). 3. You press Alt-m, and DREDIX moves the text you've marked. Press Ctrl-f and we'll go through it step-by-step ... @ MARKING Do this: put the cursor someplace, and press Alt-k. Notice that DREDIX tells you that it's waiting for the second mark. Then place the cursor a few lines away, and press Alt-k. DREDIX will highlight the lines you've marked with a reverse-video bar in column 1. After you've marked things, press Ctrl-f and we'll move them someplace ... @ MOVING Now that some lines are marked, place the cursor somewhere else (above or below the marked lines), and press Alt-m. DREDIX will move the lines. They're still highlighted, though, so you can easily see what DREDIX has done. To turn off the highlighting (and cancel the marks), just press Alt-k again. Notice that DREDIX moved the lines to FOLLOW the target line. (A useful fact to keep in mind.) Copying lines is just as easy. Press Ctrl-f and you'll see ... @ COPYING Copying is exactly like moving, except that the lines you've marked aren't disturbed in any way: they're still marked, and still highlighted. But a group of lines just like them will be appended after the cursor. Follow the steps we did for moving (use Alt-k to mark, and then position the cursor to where you want the copy). Then press Alt-c. Presto, a copy. You can move and copy BETWEEN windows, too. Just place the cursor in another window before pressing Alt-m or Alt-c (try this later). And now, for Ctrl-f ... @ DELETING A GROUP OF LINES There's another useful thing you can do to a group of marked lines besides move them or copy them: you can delete them. The marking part is just like it is for moving and copying. To delete the lines, you press Ctrl-d (instead of Alt-m or Alt-c). If you've deleted the marked lines by mistake, you can use Alt-u (undo) to get them back--one line at a time. Try Ctrl-d for yourself, and then press Ctrl-f to move on... @ CONGRATULATIONS!!! If you've gotten this far, you've passed the course. Not that there isn't more to learn, though. After you've used DREDIX for a while, you'll want to read the User's Manual thoroughly so that you can use DREDIX to its fullest. Press Ctrl-f for a list of some more handy DREDIX features that you can learn about from the manual. @ ADDITIONAL DREDIX FEATURES * Using multiple buffers * Appending/inserting blank lines * Jumping to start/end of lines * Status of files/buffers/windows * Merging files * Fancy, "wild-card" patterns * Additional cursor motions * Moving right and left by words * Overtype mode * Using multiple windows @ THE END Press Ctrl-f to start the course over, or Alt-x to exit. Emerging Technology Consultants, Inc. 1877 Broadway Boulder, CO 80302 303-447-9495 Tutorial and program (C)Copyright 1984 Emerging Technology Consultants, Inc. }}ECopyright (C) 1983, Digital Research, Inc.Serial No. XXXX-0000-654321$؎t uY>t\.19 2V33;V^6ﾪXR>tPF>tPFPù tu =`uú^ 33ౙ<úB  33i&C\_S<t ^V[n2S㋏ 6 :@~223ҳ [P 6 ^$À>u J R>uh 9À>u ~>u  k3DD D  ؎>t/$ȋ߾߀>u;9Ⱦ߹>t  %  úu u ò$IJڎ¿ QZ*ц$ ڎ2P65XP$)) (XP$X$ ÈCCú GGPR uGZX2PXP$蓋 X$؎>tf< wF66 uȬI< tNA6>tҦuIu>t< u든>t5LV>tȬ^þ2<u2À'À'À'À'þ3PN<' 6Y*" &+ j '= =  4 1  3 0 |o \_Sq<t ^V[2$ t 6 } ɀ}ЈS[3Ҹ 2pV^4eþ 6 r 6 }ùػrùC؎ 7CCù  &?CC (ûPS[X 3ۊðĹN! ~,P& cvͿNxãQYKYV'^ 3ۊÉ3ۭ t VS [^;tCCíQSV^[YíV^ VQsY^QV^Yÿ؎V^íV3^V&C^473WW3Ҹ;<t<FQYQYí6o 6pO +0Otñ t <t<Ã>:tP3X.2þYUs~mgs2}zUeOmD[Aò3OËgËt3OËg u23ñÀ>uÀ>t&G}2䢯,&T(&RSJ&G:2,&T!"&G&_(P0!=Z &R8Y|4-Z`ñr!ñﱋ6&L&\!&GPS&gp[X&GË3یŽ؎&>tێێË Ž3S&O[S&g[(ñ ຄ! ?COPYRIGHT(C)1983,84,DIGITAL RESEARCH(05/02/84)XXXX-0000-654321PSQRR&K&ZػC?u3&1GV[3&1SZY[XUVN uR)+-/]Z[َѼSRË$%&%&%V#& PEPPP5'>5'u{P_P5'>5'u6%s&PT>#&u&RPA&3 #&8#&u&2&QQd<u%&   P>&%sP% PP5UPP]UPFP]U Pv]U Pv]UPFP]U PP]UPv]U^G G PS]UPvz]UPvj]UPvZ]U^G G PSA]U!Pv1]UPv!]U$Pv]U PFP]U6$<t]à]U6PvAPFs]UNv~]U'''< r@'΋^P u@Y"s"^:t:s''' '뷠']Y%%QU'>%u!'%]Á>%vH%'';%w}%H=v!'+'^%@!'u]Ã>%vB'';%w2%@?v!''%/@!'u]U''8'wS'1Í!P''Q<tP%PDPB''uP]UFF<vP<t%FF]U'%"%sf^:&v][P^^?u P^wP^?uP^o!^? t'^ ^ P]']U%%PP]U '>u ' ':w#À t  ',uƇ  'u ' ':r@ 'P t@Y"s '֊ '.u & 'Ƈ  ' ' '> ' wPQ 'Í2&P 'u۠ ' ' ''' 'u@'"r u ' 'P< u@YP[u@Z"Pu@Z"P> ' r@P> ' r@Z"Z"s@`v{s ' ' ' 'öֈ2& ' 'u ' '< w's'H '[u; 'ȱÀ2& u 'Ȣ ' 'Ƈ2&[ ' '' '%%%%8 'w ' '< rÀ2&[uoA&Cu% 'ÀA&Eu %. '@ 'ÀA&Nt 'ÀA&Lu %%͠ 'ÀA& u ' '  's ']U%''%&'< s>&u%%%%'%+%%%QP %'r%%À!$u'%Ê!:'t's['&P'>'u's+P%PP>'w 'sP&P'P%1u&P' P'>' w'Ƈ' 'u"'$ P%Í!P'P'P_%%Ê!:'s'%P6%%'s&P''PP]U''$'%'('%&'>%&uS#' #'À2& u#'#',&#'Í2&P&Í2&P&'&ÊA&)'>&'t >%&t>%&u&ƇA& $'Њ%'"r%À!$u&8!t&ƍ2&P!Pk&'>&'t P%Í!P&Í2&P$&&('s &*'('&<wÀ2& t2&[u ''$'?%PPJ''-('s%Ê*':!r%' %PP''sX%@%P%Í!PPxP%Í!@PP^%Ê!%!&>%&u&Ê)'A&%'%']U+'+':Fr@%"sE&P%%s,',':+'w P,'u+'Í2&P+']U Pe6&%s &Pj%%sP<tP%P PD%]0'0'Ѡ%"PQ<t@Y"sѠ%Ȣ-'-'-'<v@0'"r-'/'<u%.'0'Њ%"P>.'r@-'P/t@Y"Y"s%.'Sj-'.'˷S-'[1'먀>.'u0' .'Ƈ1'$%Њ0'"s6>/' u%s &P6%6/'>.'v1'P.' %UP!PHP$&P4'"PHPƇ&r4'>4't%s&P4']ÌU'S'&Q'R]&6h&\ 8'Z(P'&CSQS[Y< u< t<u t͠(N'V<u<u t&K<u QSP'<u[P':(s(<u[&Q'S'b<u7Q}Y[SQ tC&QS:[YSN' t*(N'FN'u<u؎(:sC&QS[Y-C& [&/U' U'S'G&Q'áK' u Q8Y Qѱ,YáK' t>M't uM'ÊM'K' uM'K'< t< t < t<t< t0<u K't<u<u K'`<u3K'ãK'N'ud<t(< s(t<u(< u(Êxs P^Y@ u ($u  #(:P's  zQYË<$tAQY! ERROR: $ $Reading file HELP.HLP.$ Press RETURN to continue $ $ $ Topics available:$ For more information, type a period and one of the following subtopics:$ $ $ $Reading file HELP.HLP.$ HELP (Enter topic, ESC to exit)> $HELP HLP HELP UTILITY V2.0 At "HELP (Enter topic, ESC to exit)> " enter topic {,subtopic}... EXAMPLE: HELP (Enter topic, ESC to exit)> DIR EXAMPLES $? HELP HELP Topic:$Not found$No HELP.HLP file on the default drive.$ This program cannot be run from a menu from the Serial Terminal.$ DATE OF LAST CHANGE 26 AUG 84 L# Main MenuS E L E C T F U N C T I O N F3  $ F5  $(F7 $: Port Configuration Port 0 Protocol Port 1 ProtocolPf Requires Concurrent $|,Concurrent Serial Port Configuration Program/ No Serial communications options installed. SETPORT When running this program from a Serial Terminal you must specify the configuration and protocol parameters in the command line. Type SETPORT HELP for an example of how to use the command line $ DATE OF LAST CHANGE 26 AUG 84 SETPORT CONFIG Nyyyy Printer 35 Printer 4* Serial Port 03? Serial Port 1T#Press function key to advance value  Baud rate  Word length Parity  Stop bits)4?F3  )J F5  )PF7 )VF9 )\7F4  Bh 7F6  Bn7F8 Bt7F10Bz         P3 P4 110 150  300@ 600`1200240048009600NONE ODDNONEEVEN 1 2 5 6 7 8HELPINNN&IDNN&INRN&IDRN&INNX&IDNX&INRX&IDRX&ONNN!ODNN!ONRN!ODRN!ONNX!ODNX!ONRX!ODRX!)  )  `0 ?  =Question mark is under invalid identifier in command tail  Absence of command tail arguments invokes screen mode If a command tail is present all arguments must be separated by spaces. Valid device identifiers are: P3 P4 Valid speed identifiers are: 110 150 300 600 1200 2400 4800 9600 Valid word length identifiers are: 5 6 7 8 Valid parity identifiers are: NONE ODD EVEN Valid stop bit identifiers are: 1 2 Valid protocol identifiers are I(input) or O(output)followed by: DNN NRN DRN NNX DNX NRX DRX The following example sets Printer 3 / Serial Port 0 to: 1200 baud 7 bit ODD parity 2 stop bits input protocol is NO DTR/DSR + RTS/CTS + XON/XOFF output protocol is DTR/DSR + NO RTS/CTS + XON/XOFF SETPORT P3 1200 7 ODD 2 INRX ODNX  $;JYit" Serial Port $ Printer Input Protocol2*Output Protocol ADTR/DSR PRTS/CTS _XON/XOFF F3  $ 7F4  B F5 $ 7F6 BF7 $7F8 BSETPORT PROTOCOLON OFF D> ATE OF LAST CHANGE 26 AUG 84 <XoruN~PĿ --I RiV F1 a HELP qw}    (ESC2 Exit this program (ESC2 Go back to previous menu(ESC2 Stop current operation HELP STRING NOT INITIALIZED $ DATE OF LAST CHANGE 26 AUG 84 Yw6fE Eqt7evsttpqru ef DATE OF LAST CHANGE 26 AUG 84 MXdisk !VCMXQ@ HELP FACILITY TAKES OVER AT THIS POINT. PRESS ANY KEY TO GET BACK TO PROGRAM. $E$ Printer Busy $ (ûPS[X 3ۊðĹN! ~,P& cvͿN ࢳд!T!!2ㆠ3+u ub t/<+tHu^GtG3Ҡ.!3|uVGOr dursuy rr)Copyright (C) 1984-1987, Digital ResearchXYU{r3 t.a"QÃÍ6 tu =`uú 33ౙ<sÍ 33؀>uTVWXþ h >)t>j*uL ^.(T\J0>)t>j*u Í6(66  u0C?  v Y*.w65Q=s=vQQ-=u=sQ !5 ÊƱ$Q+6R*X*6Ę6P t 0X<`r, t *ðp(qCw \uH +.w6AbSSҾ Su  D }.AYV<O{6NX뽾" ?KX.{wX,Xvt!>t>Stmu ~ ~4W1t _~.*G& >6{ 6Y À61Zyu Xi >Qu T T .T 8#>T u2 2m2 .&>{sT 8uT u52؍}u|tQT QSÍ6i X }QQW_Yt  +#1+#A##x$9.x6 XšS#8r #1Ê0me'T$t<t''70/0Ê2eڊut" tDÊ2]ڊ2m#&&t:&󤾂$2t]ڊu<w"%2#$J%t ^%<tr%$%t%/$%t%I$eڊ%tu uc$þ'N&4u  ''  '' ' $1'n.g { s { 6 À6XԀ6X̾' ' t n'c't'T(t((t(þ((aT("(. % T  {6$ þ((5($13(& )(f(] )T )K%)B,)9>)t); 2 (t(7s(8(1s(2؁㋷6)((t`)P)(('(6(.& m2 5 8 F I { 4Ê$$ 4Í6X))($13*&**7*. I*% Q* Y*>j*tj* (b*tf*)b*tf*)b*tf*)󤊇b*tf*)b*tf*)b*tf*)S) ) ^.E eU h { {$4 uÊ$4 uÊ$4 uÊ$4 uÊ$4 uÊ$4 uÍ6zX*#V u "t#!󤨀u+f!"PS*v m *d [X@f!"Z" tt"!󤾎"t"!"@t"!PSf! "X [X. a { v<u >u "+<u>t>uۊȊmsр0L"@"&"n!؊o4 o4o4@o4oÍ6CX*#*#<v :Sv*#2þF 38 t^3 4n3/u33u 33 333  3t).643?u3O 4 .W{jt? 6//u * X:77T 9Q+qY9d8 8 .GOb{9>9u9Ë9AӅ{uy3ãyu 1{1{Í6 Xo9P=u98 {֡y拴9 X=u99S [þ*3.i / v 0 .@w/0B 1 <u==&@fz M6A@@e:`<~6;AuK+6QAu66QAu&6Au6gAu bpmq6C4-=>A@At*&A@ãA,@!Í@"Í@ò,t A@á=P%AX>=>A6Í>=>AÍ6OÃ6Q,þ= @@:t >t{=4>u)(؍>7CCBBCu(B JJJ $ٱ ۋþ FLP7.6F<w6;&QXf 9- $ౚ&>t&G&G@(p uDO󥾂,>Q&>Qt& >phÀ>tt-íVQY^þ f  NH@8:O2 YM N HD Q1YQR#ZY* $N  F X xċV f^V" U^QP3^;uþ Ѿ) RVQY^ZP suðYa a Z GQWP,_Yt=+K۴9uöKOƀvðruPXSQRVWЊ_^ZY[?COPYRIGHT(C)1983,84,DIGITAL RESEARCH(05/02/84)XXXX-0000-654321PSQRR&K&ZػC?u3&1GV[3&1SZY[XUVN uR)+-/]Z[َѼSRË$EFEFEVE PEPPPF>Fu{P_PF>Fu6EsFPT>EuFRPAF3 E8EuFEQQd<uE FEsPE PP5UPP]UPFP]U Pv]U Pv]UPFP]U PP]UPv]U^G G PS]UPvz]UPvj]UPvZ]U^G G PSA]U!Pv1]UPv!]U$Pv]U PFP]U6$<t]à]U6PvAPFs]UNv~]UFFF< r@F΋^P u@Y"s"^:t:sFFF F뷠F]YEEQUF>EuAFE]Á>EvHEFF;Ew}EH=vAF+F^E@AFu]Ã>EvBFF;Ew2E@?vAFFE/@AFu]UF? F8FwSF1ÍAP'FQ<tPEPDPBFFuP]UFF<vP<tEFF]UFE"Esf^:Fv][P^^?u P^wP^?uP^o!^? tF^ ^ P]F]UEEPP]UF>uFF:w#À t F,uƇ FuFF:r@FP t@Y"sF֊F.u FFƇ FFF>F wPQFÍEPFu۠FFFFFFu@F"r uFFP< u@YP[u@Z"Pu@Z"P>F r@P>F r@Z"Z"s@`v{s FFFFöֈEFFuFF< wFsFHF[u;FȱÀE uFȢFFƇE[FFFFEEEE8FwFF< rÀE[uoFCuEFÀFEu E.F@FÀFNtFÀFLu EE͠FÀF uFF FsF]UEFFEFF< s>FuEEEEFE+EEEQP EFr%EÀA$uFEÊA:FtFs[FFPF>FuFs+PEPP>Fw FsPFPFPE1uFPF PF>F wFƇF FuF$ PEÍAPFPFP_EEÊA:FsFEP6EEFsFP'FPP]UFFFFEF>EuSF FÀE uFF,FFÍEPFÍEPFFÊFF>Ft >Et>EuFƇF FЊF"rEÀA$uF8AtFƍEPAPkF>Ft PEÍAPFÍEP$FFFs FFFF<wÀE tE[u FF?EPPJF-FsEÊF:ArF EPPFsXE@EPEÍAPPxPEÍA@PP^EÊAEAF>EuFÊFFFF]UFF:Fr@E"sEFPEEsFF:Fw PFuFÍEPF]U Pe6FEs FPjEEsP<tPEP PDE]FFѠE"PQ<t@Y"sѠEȢFFF<v@F"rFF<uEFFЊE"P>Fr@FP/t@Y"Y"s%FSjFF˷SF[F먀>FuF FƇF$EЊF"s6>F uEs FP6E6F>FvFPF EUP!PHP$FPF"PHPƇFrF>FtEsFPF]ÌGG&GR]&6h&\ FZ(G&CSQS[Y< u< t<u t͠(GV<u<u t&K<u QSG<u[G:(s(<u[&GGb<u7Q}Y[SQ tC&QS:[YSG t*(GFGu<u؎(:sC&QS[Y-C& [&/G GGG&Gá G u Q8Y Qѱ,Yá G t>Gt uGÊG G uG G< t< t < t<t< t0<u  Gt<u<u  G`<u3 Gã GGud<t(< s(t<u(< u(Êxs P^Y@ u ($u  #(:Gs  zQYË<$tAQY! ERROR: $ $Reading file HELP.HLP.$ Press RETURN to continue $ $ $ Topics available:$ For more information, type a period and one of the following subtopics:$ $ $ $Reading file HELP.HLP.$ HELP (Enter topic, ESC to exit)> $HELP HLP HELP UTILITY V2.0 At "HELP (Enter topic, ESC to exit)> " enter topic {,subtopic}... EXAMPLE: HELP (Enter topic, ESC to exit)> DIR EXAMPLES $? HELP HELP Topic:$Not found$No HELP.HLP file on the default drive.$AST SETUP =>M@rrrr5;{CKQV[bipw}"/PARAM/PFKSAVE/PORTSAV/MDISK/HEAD/DISK/VERIFY/SERIAL/MEMORY/SYSDAT/CLOCK/HDISK/SCROLL/LIMSetup Buffer ==>d  0` Requires Concurrent $ SETUP can't be run from a Serial Terminal. $SETUPSETUP SYSDATSETUP PARAMSSETUP MDISKSETUP VERIFYSETUP DISKSETUP MULTIUSERSETUP MULTIUSER MULTIPORTSETUP MULTIUSER MULTIPORT CONFIGSETUP MULTIUSER FEATURESSETUP SERIALSETUP SERIAL PORTSETSETUP SERIAL CONFIGSETUP SERIAL PROTOCOLSETUP MAXMEMSETUP LIMSETUP HI-MEMSETUP SCROLLSETUP UPDATESETUP DISK MOTORSETUP DISK STEPSETUP DISK SETTLESETUP DISK LOADSETUP DISK UNLOADSETUP CLOCKSETUP HARDISKEwfqtu6Eve7OOOConcurrent System CustomizationĿ  AruC Main MenuPrevious Menu SELECT SYSTEM CUSTOMIZATION OPTION   a F1 rHelpu*F2 Reserve System SpaceF3 Save System Parameters*F4 MDisk F5 Diskette Drive Parameters *F6 Verify After Diskette WriteF7 Setup Serial Consoles*F8 MENU TWOF9 Color Monitor Scroll Mode*F10rUpdate and ExituEscrQuit without UpdateuSELECT FUNCTIONF1 Help*EscReturn to This option controls the amount of memory in the system spacethat is reserved for use by DOS-compatible device drivers. Concurrentwill stop the device driver installation with an appropriate errormessage if the space available is not sufficient for the size ofthe device being driven. Many drivers will require no extra space,but if the driver will not load, you may wish to increase this valueby 128 bytes and retry. Any space reserved here reduces the memoryavailable to application programs.The amount of System Space currently reserved is: bytesF3 Enter a new valuea Enter a four digit decimal number to set a new value in bytes.The new value must be between 0 and 9999. To enter a value less than1000, be sure to start with a zero. ___e This option allows the current state of certain system parametersto be saved, and reinstated at the next Power-On or System Reset. Tocancel the Save command, retype the appropriate function key. F3 Save Programmable Function KeysF5 Save Serial Port ConfigurationsSaved a This option allows you to reserve a portion of memory to be usedas a Logical Disk Drive, or MDisk. You may increase or decrease thesize of the MDisk.Current MDisk size: Kb 0123456789ABCDEFF3 Increase MDisk size*F4 Decrease MDisk sizea:0000 Invalid Starting Address TYPE ANY KEY TO CONTINUE This option controls the Verify After Write feature of the syste@ mDiskette software. When enabled, the Diskette is verified after eachwrite operation, with automatic retries for verification errors. TheVerify feature results in greater data security at the cost of speed.F3 Enable Verify After WriteF5 Disable Verify After WriteThe Verify After Write feature is: Enabled Disableda This option permits customization to support non-IBM diskette drives. Type rESCu now if your system consists of IBM drives.r CAUTION: A customized version of Concurrent may not run correctly on other machines.u Be certain that a back-up copy of CCPM.SYS exists. F1 rHelpu *F2 Motor Startup TimeF3 Head Step Time*F4 Head Settling TimeF5 Head Load Time*F6 Head Unload Time*EscrReturn to Main Menuua This parameter specifies how long Concurrent will wait beforeattempting a diskette read or write after turning on the drive motor.If this interval is too small, read and write errors will result. Ifthe startup time is excessively high, diskette accesses take longerthan needed.F3 Decrease Motor Startup TimeF5 Increase Motor Startup TimeThe current Diskette Motor Startup Time is: a This parameter specifies how long Concurrent will wait beforeattempting a diskette read or write after moving the drive read/writehead from one track to another. If the Head Settling Time is too lowread or write errors will result. If it is excessively high, diskaccesses take longer than needed.F3 Decrease Head Settling TimeF5 Increase Head Settling TimeThe current Diskette Head Settling Time is: a This parameter specifies how long the Floppy Disk Controller (FDC)hardware will wait before attempting a read or write operation afterConcurrent has issued such a command to the FDC. Most 5 1/4" drivesuse the minimum setting because the heads are always in a loaded state.Drives with head-load solenoids will require a higher setting.F3 Decrease Head Load TimeF5 Increase Head Load TimeThe current Head Load Time is: a This parameter specifies how long the Floppy Disk Controller (FDC)assumes the read/write head remains loaded after a R/W operation hasfinished. Most 5 1/4" drives use the maximum value of 480 ms becausethe heads are always in a loaded state. Drives with head-load sole-noids will require a lower setting.F3 Decrease Head Unload TimeF5 Increase Head Unload TimeThe current Head Unload Time is: a This option sets a Head Step Time of 2 to 32 mSec for the DisketteDrive Hardware. The smaller the time, the faster the Drive Head movesfrom track to track. The default time is set to 8 mSec, but times of6 mSec or 4 mSec work with some Diskette Drives. Caution is advised.F3 Decrease Head Step TimeF5 Increase Head Step TimeThe current Diskette Head Step Time is: mSec a This option can be used to configure the system to support multi-user serial ports, either by use of an add on multi serial port card or using the COM1/COM2 system ports. ALL serial ports can be used as either Auxiliary/Printer ports or as an additional console. F3 Setup Multi-port cardF5 Setup COM1/COM2 ports *F4 Ctrl\Alt\Del Reset rENABLED u*F6 Setup Console Featuresa This option is used to select a serial port card.Current setting is:  F3 Select multi-port cardF5 COM1/COM2 only F7 Configure multi-port cardaPj : AST (4 ports) at 1A0H AST (4 ports) at 2A0H Hostess (4 ports) at 280HHostess (4 ports) at 2C0HHostess (8 ports) at 280HHostess (8 ports) at 2C0HARNET (4 ports) at 280H ARNET (4 ports) at 2C0H ARNET (8 ports) at 280H ARNET (8 ports) at 2C0H Select Serial Console FeaturesThis option is used to select various optional features foreach serial console. Select the correct keyboard and the numberof virtual consoles for each serial console. The PC terminalemulation can be selected separately for each console. *F2 rSerial port 1 uF3 PC emulation rENABLED u*F4 National Keyboard F5 1 Virtual Console *F6 Enhanced Keyboard aCOM1 port uCOM2 port uSerial port 1 uUS keyboard National keyboard 1 virtual console 2 virtual consoles 84 key keyboard Enhanced keyboard PC emulation rDISABLEDuPC emulation rENABLED uConfigure Serial Port This option is used to configure the individual serial ports.Use the function keys to advance values, press ESC when done.*F2 rSerial port 1u F3 *F4 F5 *F6 F7 *F8 a110 Baud 150 Baud 300 Baud 600 Baud 1200 Baud 2400 Baud 4800 Baud 9600 Baud 19200 Baud 38400 Baud No parity Odd parity Even parity 1 stop bit 2 stop bits 7 data bits 8 data bits No protocol DTR/DSR RTS/CTS XON/XOFF Printer/AUX port Multi user terminal This option is used to select whether a serial port will be usedas an Auxiliary / Printer port, or as an additional console in amulti-user system. Both ports may perform either function.F3 Change COM1 port assignmentF5 Configure COM1 Port*F4 Change COM2 port assignment*F6 Configure COM2 PortaCOM1 Port is currently: COM2 Port is currently: an Aux / Printer portMultiuser Terminal Unavailable Configure serial portr S E L E C T F U N C T I O Nu F3 Port ConfigurationF5 Port ProtocolaSerial Port Configuration#F3 38400 #F5 8#F7 NONE #F9 1 arPress function key to advance value.uCOM1 Port (Printer 3)Baud rateWord lengthParityStop bits>)D)>)J)NONE ODD EVEN p)v)|))))))))|))))))110 150 300 600 1200 2400 4800 9600 1920038400Serial Port Protocol F3 OFF 2F4 OFF F5 OFF 2F6 OFFF7 OFF2F8 OFFaCOM1 Port (Printer 3)Input Protocol Output ProtocolDTR/DSRRTS/CTSXON/XOFFOFFON This option controls the maximum amount of memory that the systemcan allocate to a single process. If this value is too small, certainapplication programs can't be loaded into memory. If the value is toolarge, certain applications may "hog" the system's memory, and preventother programs from running concurrently.The current Maximum Memory per Process is: KbF3 Enter a new Maximum Valuea Enter a three digit decimal number to set a new Maximum Value in Kilobytes (Kb). The new Maximum Value must be between 64 and 999 Kb.To enter a value less than 100 Kb, be sure to start with a zero.ENTER MAXIMUM VALUE __e Value is Too Small Value is Too Large This option lets you select how the video memory on a color monitoris to be accessed. Your choice will affect the appearance and speed ofthe color monitor. Try each of the modes available, and choose the onewhich best suits the hardware of your system and your personal taste.The current Color Monitor Scroll Mode is: o.|..Fast/FlickerSlow/Smooth Wide Open F3 Change the Scroll Modea This option permits the calibration of Concurrent's status lineclock for machines with non-standard clock hardware. If your systemconsists of unaltered IBM hardware, type rESCu now. Be certain that aback-up copy of CCPM.S@ YS exists. Select the calibration method to be used:F3 Gross Calibration MethodF5 Fine Calibration Methoda This method requires an external clock with a second hand. TyperF3u to begin the calibration sequence and rF3u again when the externalclock indicates the passage of exactly 60 seconds. Type rESCu toreturn to MENU TWO.rsCALIBRATINGutF3 Begin calibration sequenceF3 End calibration sequence Accept calibration results This method assumes that you have previously used an externalclock to accurately measure the actual time interval which elapsesduring one Concurrent "status-line-hour". Enter a four digit decimal number equal to the actual numberof seconds which elapsed. To enter a number less than 1000, startwith a zero. To leave the present setting in place, enter 3600. ___eF3 Maximum Memory per Process F5 Clock CalibrationF7 Select Hard Disk Driver*F4 Internal EEMS rENABLED u *F6 Enable high memorya*F4 LIM emulation rENABLED u *F6 LIM page frame base address*F8 LIM memory per process*F10Enable high memory a ENABLED DISABLED This option specifies the address of the LIM page frame, to locatethe page frame at an available location in the first 1mb of theaddress space. The page frame is the 64kb address through whichexpanded memory is accessed by applications using the LIM emulation.The page frame base address can be specified in a range from C0000hthrough D0000h.The current Page frame base address is: F3 Change the base address This option controls the maximum amount of LIM memory that the system can allocate to a single process. If the value is too large,certain applications may "hog" the system's memory, and prevent other programs from running concurrently.The current Maximum LIM Memory per Process is: Enter a four digit decimal number to set a new Maximum Value in Kilobytes (Kb). The new Maximum Value will be rounded down to the nearest 16k page. ___eEnable high memory This option is used to enable 16K blocks of free memory abovevideo memory which are available for use by the operating system. Forexplanation of the possible uses of these areas, press F1.F3 Go to next block*F4 Change modea888899 9,989D9P9\9h9t9 C000-C3FF C400-C7FF C800-CBFF CC00-CFFFD000-D3FF D400-D7FF D800-DBFF DC00-DFFF E000-E3FFE400-E7FF5 E800-EBFF5 EC00-EFFF5 F000-F3FF5 F400-F7FF999ENABLED DISABLED AUTO SCAN ru This option allows you to enable a portion of code in Concurrentwhich improves multi-tasking performance when a program in one windowis reading or writing to the hard disk. This optimized hard disk codeshould be enabled only if your system is an XT or XT-compatible withIBM standard hard disk controller hardware. Be certain that a back-upcopy of CCPM.SYS exists. F3 Change enablement of optimized hard disk driverOptimized hard disk driver is: DisabledEnabled a You may now exit SETUP, saving your changes to the Update Disk,or you may select a different Update Disk. A CCPM.SYS file must be onthe Update Disk for the changes to be saved. The changes will be putinto effect at the next Power-On or System Reset using the Update Disk.F3 Select the Update DiskF5 Update System and ExitThe current Update Disk is: a Enter the designation letter for the Disk upon which you wouldlike your changes saved. You may use any letter from A to P, as longas it corresponds to an actual Disk Drive.eCCPM SYSUpdating CCPM.SYS on drive Can't find CCPM.SYS Can't read CCPM.SYS Can't write to CCPM.SYS Wrong version of CCPM.SYS E$ Printer Busy $&.2ұn-N% ࢵ&G> udXш&& ôP!3 ࢳд!T!!2ㆠ3+u ub t/<+tHu^GtG3Ҡ.!3|uVGOr dursuy %BOOTDRV% cd \dredix dredix [t] &.2ұn-N% ࢵ&G> udXш&& ôP!3 ࢳд!T!!2ㆠ3+u ub t/<+tHu^GtG3Ҡ.!3|uVGOr dursuy The driver of the wagon swaying through forest and swamp of the Ohio wilderness was a ragged girl of fourteen. Her mother they had buried near the Monongahela--the girl herself had heaped with torn sods the grave beside the river of the beautiful name. Her father lay shrinking with fever on the floor of the wagon-box, and about him played her brothers and sisters, dirty brats, hilarious brats. She halted at the fork in the grassy road, and the sick man quavered, "Emmy, ye better turn down towaA rds Cincinnati. If we could find your Uncle Ed, I guess he'd take us in." "Nobody ain't going to take us in," she said. "We're going on jus' long as we can. Going West! They's a whole lot of new things I aim to be seeing!" She cooked the supper, she put the children to bed, and sat by the fire, alone. That was the great-grandmother of Martin Arrowsmith. * * * * * Cross-legged in the examining-chair in Doc Vickerson's office, a boy was reading "Gray's Anatomy", while the Doc himself was using DR EDIX. His name was Martin Arrowsmith, of Elk Mills, in the state of Winnemac. There was a suspicion in Elk Mills--now, in 1897, a dowdy red-brick village, smelling of apples--that this brown-leather adjustable seat which Doc Vickerson used for minor editing, for the infrequent pulling of teeth and for highly frequent naps, had begun life as a programmer's chair. There was also a belief that its proprietor must have once created the world's finest microcomputer text editor, and once have been called Doctor Vickerson, but for years he had been only The Doc, and he was scruffier and much less adjustable than DR EDIX.  ࢳд!T!!2ㆠ3+u ub t/<+tHu^GtG3Ҡ.!3|uVGOr dursuy 11`k62PVw#Z CP/M V1.35 6/12/85 SMALL Model CLEAR library. Copyright 1983-1985 Digital Research.$UWVVN*^_]+ێOsZero divide error$XYZ+^gVDRQSVRSSSP6 [ZB;v' Stack overflow. $+RSñ uPPt<vAÃԱi@t+ P X"r.t " t5 t 5t+Ɉ%Ë-++Ë6_Cr Ë6_+́;s;rùË-UPPPe+]You must link with LINK86 V1.2 or later. $66 UVWv v~v2f_^]Y[ڎ^6-6'6!6666 6SV++4,S$p{ȳ+^t&u+[+u@fUF^? t^? t^?,t^F^?=t^?,u F^F5F^? t ^? t^?=t^?,t^?uՋ^F]U FFFM^?*uFF^?t^?uFFFFFFPFF[:ظu@F~u~uF]U^FPFPv^F^FF PF[7v=FF~ }~t׋^F~tivFH[FPFPv^?=u=FPFPvm^?t^ F^?t ^F^^^F]UFPFPvvF^?u+~u%^?1r^?4wv^2-1[F ^F]U PF[7 PI~u(F PF[7 P$F~ |߃~t~u P P]U\| P P~ P P PcDD@P PFPF FPPv+P* FFFFPFPFPFP ]U2F FF2P^2[ÉFvDDFFЋF ~FиP-P$FFFҍF։FԍFPPF~uP-PFFPPFFPPF~uP-PFvPFvθ3PFvи,P{FFFPPfF~tP-PPFOP,P;FFPP*F~uP-PFP-PF+]UTF FF“2P^Š2[ÉFFFPPF2P+P7 FF܋FFFFFFFFP~uLFPFPF2P FPFPF2PNNPfFFFP+FFb FȋFFʍFF̋FFFFFFF2PgDDF2P+P vvƍFPFP F2PP FfPF[ÉFFb ^? s b ^ FF9F|b PFF[b ^F/FfPFH[ÉFb PFF[ b ^ FF9F~ɸb Fb FzFFF^? t^? u.FFFFPFF[FFPFF[1FFFFFF+FFF+FPvv FF^?t{^]UbP DDFFMb PFf[ÉFvbPvUFvd^2PvvF~ |F~|b PFf[ÉFF^b FF^? tFFPFF[mN^?=uFF^? tFFPFF[F&PF1 [FFF2<t<t<t#!F2<uo<u4<u<uF2]UFFl^% t4^'OPFF[PFF[OPFF[p,OPFF[PFF[OPFF[^?u"OPFF[ OPFF[~|׍OFOFF FF2F^2FFPFPFPFP]UxFPFPFPCFFFFFFFFFPFPFPFP~8u FF~2uFF~4u FF~6uFFFF~t\  tvv+PF tvvPF tvvPvFFFF~t!FPvv#FFPDDFFF^2PNvPF^2PFFPPFxF%FPDDFcFPFPFPvEDDFA  u u tFPFPFPFPv F t*vv)F^2PvP/F tMFPFPFPFPv~ Pv PF^2PvPFFF=u7= u/=u'= u=~u=su=ru=qu=pu= u= u= ue=u]=uM= u==uF9FuFFPFPFP9FHPvFFFPFPFPFHP+PvFPFPFPFHPPvxFFPFPvFH2PFH2[ÉFFH%FFFPFPFPFPE" F=t= ur= uD=u~u ~u0~tF2+]UFFFK v+P2FFF F PPu2FP@P[2FPP@2FP P%2FPv 2F~PP2F~t~t ~tFPFPFPwIFP+PPA[FPF1[`WFP+PPA[F PF1[4fFP+PPA[F=t=t=utvvFHP F~t)zPDDFFFPFPFPFP lPP2F~u FJHF=t=u=u=u=ul=uI=u'=u=u~u ~uFFFPFPFPFPmF]U F~uxP Pl F~utP POc~u~P P9MvP P)+PPF&FFFPFPFPFPF~tԋ]W+PPU0FFPFPFPFPPv+PFPPv+PF2FF%FF2FF%FFPFPv ~t FPFPv? NN܋FF޸OPv+PO F޸P+F;F|RFF2FމFFPPv+PDF2FFFPFPFPFPFFFܸPv+P Fܸ+F;F|RFF2FމFFPPv+PF2FFFPFPFPFP+FF?~u2FFFFOPv+PQ FPv+P> F~uUFԉF֋F؉FڋFFԋFFظPPvԸP FԸPvظP F؋F9FuF9FtFFرFԉFҍFP PvPFFHFFFHFOPv+P FPv+P FFFFFFF9FuF9Ft&FFFFPFPFPFP FFЋ]U(FPPv+P@F2F~uF2% FFF2%PF[ ÈFF8Fu F%PF2[ ÉFFPPvP F FFܓ2P^܊2[ÉFڍFىFދFډFFFPPv+P FFFFvZ DDv+P F2 PPPPPFP vPz FPPv+P, FPPv+P FFFFPFPFPFPy ]U2F FF2P^2[ÉFvDDFFЋF ~FиP-P@FFFҍF։FԍFPP#F~uP-P FFPPFFPPF~uP-PFvPFvθ3PFvи,PFFFPPF~tP-PlFOP,PWFFPPFF~uP-P/FP-PF+]UTF FF“2P^Š2[ÉFFFPPF2P+P% FF܋FFFFFFFFP~uLFPFPF2PFPFPF2PvNNPfFFFP+FFpFȋFFʍFF̋FFFFFFF2PUDDF2P+P vvƍFPFP F2PPy FfPF[ÉFFp^? s p^ FF9F|pPFF[p^F/FfPFH[ÉFpPFF[ p^ FF9F~ɸpFpFzFFF^? t^? u.FFFFPFF[FFPFF[1FFFFFF+FFF+FPvv FF^?t{^]UpP DDFFMpPFf[ÉFvpPvCFvr^2PvvvF~ |F~|pPFf[ÉFF^pFF^? tFFPFF[mN^?=uFF^? tFFPFF[