IMD 1.17: 16/01/2011 9:03:58 concurrent dos 386 utilities and apps 2 of 2 release 2.0 serial# 1118-0000-001458 nov, 1987  'DIGITAL ` :+"&6x&>x&z.|-@|**IF{|P^}w}w++QR|CCPM SYSDOSPLUS SYS^> |9 t}t~ts@;tX}> |AQ6|@@P>"|AV}&|+$|XZYP.|ݱSx[+Q|&|Y.&|XHPu* LoadingCCPM SYSDOSPLUS SYSUse another boot disk CCPM.SYS not 1st file *P|Xsu CCPM.SYS read error |26(|uŰ.ìt@`  @`! #@%`')+/1 3@5`79;=?A C@E`GIKMOQS@U`WY[]_a c@e`gikmq s@u`wy{} @` @ ` @ ` @ ` @ ` ǀ ɠ @ ` ׀ ٠  @` `!Aa   !Aa!!#A%a')+-/1!3A5a79;=?A!CAEaGIKMOQ!SAUaW[]_a!cAeagikmoqsAuawy{}/Aa!Aa!Aa!Aa!Aaǁɡ!Aaׁ١!Aa!Aa " B b  !"!B!b!!!!!"!""#B"%b"'")"+"-"/#1"#3B#5b#7#9#;#=#?$A"$CB$Eb$G$I$K$M$O%Q"%SB%Ub%W%Y%[%]%_&a"&cB&eb&g&i&k&m&o'q"'sB'ub'w'y'{'}'("(B(b((((()")B)b)))))*"*B*b*****+/+B+b+++++",B,b,ǂ,ɢ,,,-"-B-b-ׂ----.".B.b...../"/B/b////0#0C0c00 0 01#1C1c111112!#2#C2%'2)2+2-2/31#33C35c37393;3=3?4A#4CC4Ec4G4I4K4M4O5Q#5SC5Uc5W5Y5[5]5_6/6cC6ec6g6i6k6m6o7q#7sC7uc7w77{7}78#8C8c888889#9C9c99999:#:C:c:::::;#;O;c;;;;;<##>C>c>>>>>?#?C?c?????@$@D@d@@ @ @ @A$ADAdAAAAAB!$B#DB%dB'B)B+B-B/C1$C3DC5dC7C9C;C=C?DA$DCDDEdDGDIDKDMDOEQ$ESDEUEYE[E]E_Fa$FcDFedFgFiFkFmFoGq$GsDGudGwGyG{G}GH$HDHdHHHHHI$IDIdIIIIIJ$JDJdJJJJJK$KDKdKKKKKL$LDLdLɤLLLM$MDMdMׄM٤MMN$NDNdNNNNNO$ODOdOOOOOEPePP P P PQ%QEQeQQQQQR!%R#ER%eR'R)R+R-R/S3ES5eS7S9S;S=S?TA%TCETEeTGTITKTMTO@`  @`! #@%`')+/1 3@5`79;=?A C@E`GIKMOQS@U`WY[]_a c@e`gikmq s@u`wy{} @` @ ` @ ` @ ` @ ` ǀ ɠ @ ` ׀ ٠  @` `!Aa   !Aa!!#A%a')+-/1!3A5a79;=?A!CAEaGIKMOQ!SAUaW[]_a!cAeagikmoqsAuawy{}/Aa!Aa!Aa!Aa!Aaǁɡ!Aaׁ١!Aa!Aa " B b  !"!B!b!!!!!"!""#B"%b"'")"+"-"/#1"#3B#5b#7#9#;#=#?$A"$CB$Eb$G$I$K$M$O%Q"%SB%Ub%W%Y%[%]%_&a"&cB&eb&g&i&k&m&o'q"'sB'ub'w'y'{'}'("(B(b((((()")B)b)))))*"*B*b*****+/+B+b+++++",B,b,ǂ,ɢ,,,-"-B-b-ׂ----.".B.b...../"/B/b////0#0C0c00 0 01#1C1c111112!#2#C2%'2)2+2-2/31#33C35c37393;3=3?4A#4CC4Ec4G4I4K4M4O5Q#5SC5Uc5W5Y5[5]5_6/6cC6ec6g6i6k6m6o7q#7sC7uc7w77{7}78#8C8c888889#9C9c99999:#:C:c:::::;#;O;c;;;;;<##>C>c>>>>>?#?C?c?????@$@D@d@@ @ @ @A$ADAdAAAAAB!$B#DB%dB'B)B+B-B/C1$C3DC5dC7C9C;C=C?DA$DCDDEdDGDIDKDMDOEQ$ESDEUEYE[E]E_Fa$FcDFedFgFiFkFmFoGq$GsDGudGwGyG{G}GH$HDHdHHHHHI$IDIdIIIIIJ$JDJdJJJJJK$KDKdKKKKKL$LDLdLɤLLLM$MDMdMׄM٤MMN$NDNdNNNNNO$ODOdOOOOOEPePP P P PQ%QEQeQQQQQR!%R#ER%eR'R)R+R-R/S3ES5eS7S9S;S=S?TA%TCETEeTGTITKTMTO XCOPY EXE rUXDIR EXE r- HXDEL EXE rR`8DISKCOMPEXE ro`/FIND EXE r?COPYMENUCMD rDSP CMD rEDITMENUCMD rHDMENU DAT rY0HELP CMD rrHELP HLP r_SHOW CMD rSPL CMD r1FIXCB86 EXE r<STOP CMD r$TREE EXE r 6PIFED EXE r&ptSORT EXE ra/REPLACE EXE ryKLABEL EXE r'CPM EXE rPRINTMGRCMD rmCARDDECKBAT rV CARDFILECMD rWCARDFILEDIS rCARDFILETRM rCHSET CMD r*CLEAR BAT r PASSWORDEXE rBREBOOT CMD rSID86 CMD r^ENDINS BAT r1|TOUCH EXE r2p;MZ+ 9P,{s2/ &&%&p&6&6@ $ UP~~}PY]:u']_* t ]_* hucPY;v|:tF^"u:uF^* t ^* av.8$88888888888>6. & FGFFPY3P1^*PtP1+PF>t> tPY>tP-Y>tP$YuhY~~]:tS"PMY#tdPXY+PN]VW Pc$> r +>+<]PfP>/t/\E#PD#o#PA tt2+.uA+ыA$0+BuA+ыA8+VuA+ыAL496P/Y#u PbY _^UW~?:uFPPW #tP.YFPPYY_]UVW~PPBP@PPW #tPW+P>Bu&BPP6@#}hP@PV>u$+dWuA+_AV`W_^<PP6@#}hP@PV`BP#Y@PBP+PDBPP6@#}hP@PV<P#Y_^]UVW}+lWuA+_AVhW~_^~^:t-RWRRRS] #tPv+P>u&PP6#}hPPVwPP6#}hPPVQP"Y#}.ulP@Yu P Y#}ePPV=u}WY#tqaF+PPVR>#}VulPYtPv+PP>Y#u WY#tFPY#}ePFPV=u#+tWuA+_ApVW_^WPYY#tPv+PKPP6#}hPPV%_^]UVW~GFGF=t]v"t:uGGF+:Fu VFFP9!FY#t=uFPLY@~ FP!Y#t+_^]UPVW>u+O+BWuA+_WPBP~!+#~u~t^"t:u+*_^Y]UNVW F>t FFPFP6PvPBPEFt tt$PPBP+PkPY~u ~u+FV @~t~u #u>t+PVRPPP +vFPCYY#unG @ +vvvFPFV t+ #u> t> u >u+* @ 4-|>:uFPFPFYY~uPY_^]U~VW~+WuA+_AVVW_^^SRPP FF:+^WuA+_AVVW_^RVR6>FP#}@ 6>FPWb #}uiPFPV P+PPVFV"} FPv YY+Pv vVZFV"} FPvY YYFVN^+N^ N^+}FVFVFFFV V t F~tNvWvvF*PXFPvvVFPVYP ~t+ FV FV_^]UVWPY#u+|WuA+_AVxWd_^ad.RR! FPP6 #}hPPWy džtnxP SRBRxP #}@ulP@ YudPPYP xP#}ePxPW dž?u džxhƆi:jPKSR > tjPxPn YY+xWuA+_AVxW_^jRQPxR S & # u3PjPKS%#ufP+ YtIPhPYY#} PV YYP+PPVFV"|Pvu GtƆ G*PhR ]YYu hPxP##}XukPt Y>tD+PPhR #|0t*hPR+RP P*PhP#} PVYYP PVYYPYY tgP Y6pPwwV3tPGPCCSVPCPdYYPVtYPUYYut)Gt" RR*PhP PYY+; tZO WuA+_AG VW_^KSRmG$߈RQ*PRE PPY#tfFPP8YPYY_^]UVWvv'YY#t6~v"t uuLuH>u> tF t4>t E;r$> t!Pv~+PP#u+_Y]UPVWP Y#u46>PMYY#|"FPWWL#|FtgPkY_^Y]UVWP!4Y#u PGYFFP%F+ҹ,.Y-} PYFPY<u PYF+҉ "_^]á "(*$&,.02486:2á02UVFP6&6$<$&T)02^]UFP6*6( (*]U VFV $Nv+NvNv+Nv^wFV$ NFVFV^]UPVW~ v F6FVGW+WuA+_AW VW_^;tBTWTWTW΃WNuA+_AFKVW_^SY6Z:_^Y]UV8;6u+688Z^7^]UVWF Ftm++FV|FV6&6$v;t v WYY+RP6&6$FV$&FV)02)FV_^]UVWF Fus++FV|FV6*6(v<;tv v W YYPNY+RP6*6(FV(*FV)FV_^]UVFV $Nv+NvFV FVFV$ NFVFV^]UPVW~*P*PP~t PY=uuJF^* tF, F:t F:t #u+uuPbY#t *P *PPYY_^Y]UPWvPlYYP#Y=uu@,F^* tF, ^:u+ F:uuİPY#t *P *PPYY_Y]UW~=t vY_]UvYPY=uv]UPVW~+WuA+_AFW_vPnVXV_^]UVW~5E$*E$*^7_^]øP?YøPYøPYUW~#|a߃t/t4t*t/6tt u'&: HZlP P|PYY_]UVW~v#}/a<t VPYYWiK66PPW _^]UVW~v^wt>tYt.t#euhtYiujuVPVJ$PY#t*P4P YYVVHP*PPXu*APrPY@P*APPVPWe<t VPYYWhJY~jt66PPzP_^]UW^w5uv.Tc vo. t+FPPP-P*PDf?4P*PP#`ZRJBPY|Pv*PPiPbbP[PTPM*PPP@*PfP34P*PP"*PP *P P*P8 P*P P*P P*P P*P P*P P+P66PPW_]UV>t##tP YP+PPIVa ><t<POY>tP@Y>t6F Y6 FP#YY^]UCVNF!s+~t~u]U!]U;V!s+]UVGVv!s+^]ø7!*UF.%#$!]UF.5$!..%$A!]}%$!}%#!ӎ.....6.6<u}%$!}%#!ӎ.ϴL!UV8!s+]UW~"t<*t t Ft Ft F J vY#tuv P6 L P *P P #uda t2> t$>j .tj PJ 9J ㉇ YY> > t Pj PYY#tL +L PsY +_^]UVW~> u> t8J #t!㋗ ; uJ P'Y#tJ ㋇ ; u>J usJ PJ ㉇ P#t u-v P6 #t" PY#utuJ  L P *P PX L P_Y#uYa t2> t$>j .tj PJ J ㉇ YY> > t Pj PYY#tL +  +_^]UVW~^?u=.u(F.G=.t .F}CG F+}1"t <.t* t ݈GGG Fʀ=.uGF. },=t* t ݈GGG Fύ~+ }^!s+]UVW~5 WFP #t*P P~YY#~uvFP YY#t^7*P P~YY#~uvFPn YY#t^tt FFFFFFFvFFFFvPr cwlr:3w4F=r,= w'u  F=r ^ *;s^7FGFG+_^]U VW~vF+FF5 WFP #t*P Pv~ YY#v~uvFPZ YY#t"tf*P Pv~e YY#v~tJ^SFP YY#uO"t/*P Pv~. YY#v~t^SFP YY#u~w~;w ~;w~cvFFDFDFD+_^]UV!u]ô!ô!ø3!˜UV3!]UAV!s+]U.F!]ôT!U9V!s+]UB^VNF !sؙ]Ugu PeY7fPFPFP\F=u6t  P7Y~uF랋F#|F_^]UfVWvvUYYt+NWuA+_A^VW~_^^WRVR PFPFP+^WuA+_AVW~_^ }VFPFP6\ C~u PkY4FPFPvFPu6t  P=YuF륋_^]UW~=t* t G_]XXL!UVW8 VRv~> +YY#tWVP+_^]UVW8 VRv@> +YY#t WVvD+_^]UW~> FPv +YY_]U>VW~GF"ur<%t<+FFF FV-u FGF~0uF0=*u^FFGGF*FGF<0r<9wF V*Ѓ0Vۀ~.uD=*u^FFGGF*FGF<0r<9wF V*Ѓ0V3Ҁ~luBV#tGF^*Xt#dt utxt6~u^F/~tFFƒFWFVF‰F^F+҉FV^*Xt9ct^dtst:utxt Nvv vvPFP vvFP(+vWuA+_VFFFvшF+ƉFF;F}F~tFN;F~F  F"t'V;V}< u      FӃ~tFN;F   ~ u      F   _^]UVW~F F uO0s~ uFv vFP+WuA+_ڋNWuA+_AvW_'^ OFV FV uً_^]UW~^ OFVFV uً_]UVW+vFFF~t$Nj^,0<9v, +NNN_^]UVW+ WuA+_AV W~_^ WuA+_AV W~_^#t*F Ft"Ft FPFPBFPP:~^Nҍ~=0uG+WuA+_A^VW_^WuA+__^]UfVWvv.YYt+NWuA+_A^VW~_^^WRVR PFPFPd+^WuA+_AVW~_^ }VFPFP6\ ~u PEY4FPFPvFPzu6t  PYuF륋_^]UV!VNN UV!O!s+]UW =t FG:Eu+ 3Ҁ~ vB_]UW~< t< uG_]UVW~v* u'* t Ӄ0Љ+_^]ô?@U^VN!s]UPVWvv)YY#t8F*䓃t t ~O+ۃ }GF^ӋڈGċ^;Ó_^Y]UvM ]UPv Y]U+~uA+BV~uA+BVF;r‹V;rPvv ]U+~uA+щVBF~uA+щV;VwF+]init:P|2P Pm .q2&( &;v+ر&+شJ!+یЋ9;s+ر.2TX+@("tPX%t)3*>*&*?>*?u>**u..3*&,&3&"@$+>R0!1&33&=NOuL&}87uD&}=u=PW>*t2* O&=t&"t!G ! !_X&=u>1s 3R&-&+G+&-ϋ&"@@@+&.q2v6. +P>: t>C ͫuG ;E u G ! ı=@r-@ =r--:UFF]ÌUt6L d6N d6L L@6N L@t 6P d6P L@]UP 6R i 6R vD R VY>R uY]U+FFFF= 6. +FFFFF;2 v6* ^@FF< t< u~tւ~uK`~"u~u~u~uHFF묂~\u!~tF;2 w6* x"uF"FF6* ^@FFn~t$6* ^@FF~^@6. ߉F;2 w*v. @F@]HEAPCODEeach_item U^ 9v^#t!;wtVP v^Vv^Vv^VFF~u]each_free_itemU\ FF`vv| Ut VP JvD ;FtvP F.v#t ;wtVP} v^VFFvD F~u]remove_from_free_chainUv|r*| uD \ vD t D v\ #tD G ]USY]insert_into_free_chainUPv^#t/ Uu);` u6` vvD^G47v\SCv\#t>^ Uu5;6` u` vDvD^G47^v#t\v{&v|r\ ^\ #tw vD 6\ Y]search_free_chainUPU8P@FfFY]USvD^;GrwY]set_limits Ub Pb P]sysallocU>b ub b +ҋN+Nvz+;Vw u;Fs+b FVb F]add_new_chunk UPV;rЉVwDvxF#t7+v` \D UVTD;t7F` >^ u^ v Y]malloc2U>V t FsF~v+F vF#uv[vF~uvPvD+FF= w DFFFvDD D| TVT vV^ VF#vDvvv^7\DD UD| TƗu;` u6` v#F>V t/F]zUSY]hmallocUPU:PvvF>X t#tV#v W ʋ~FY]mallocUPv6Z FY]errUSvtPsnfreeUP~uvFFF>V t|v| Duv#t ;wtvD UV86` | Uu$v|>b t6` #tv>V tfY]check_heap_integrityUU;P]USY]UU~ *P ]U> t ~ * P  F~ ]UvDDD]U츀 P]PQRSPPVW:U~r6v6tFPFP PZ6A]_^[ZYXPQRSPPVW:UFPnnv&<u^ P6[]_^[ZYXPQRSPPVW:U6~6|FP]_^[ZYXUPVR1FVtv+PVRFVxz#PVRFV|~+P;P]UFLPv]Uvvc]UPF*䣒uY]U+PFPF*P]UPF*䣐DPuFtFtFFFY]UF*䣐F FFBP]FFFV]U6>66!]ݏ6>]dd/mm/yydd/mm/yydd/mm/yyyy/mm/ddyy/mm/ddmm/dd/yymm/dd/yy*.**.*d:d:*.**.*d:\d:\ (%c/%c)? %c%c%c %c %s ..."%s" %s ..."%s" ...%s YNFDInvalid file name "%s" Invalid path or path not found "%s" Invalid number of parameters Invalid option '%c' in parameter Invalid parameter "%s" Invalid password Drive %c: not ready Failed to get current path on drive %c: (OS error code %d) Path too long Insufficient memory Insufficient disk space file not foundpath not foundtoo many open filesaccess deniedfile already openlocking violationdrive not readyOS error code %d Does "%s" specify a file name or directory name on the target (F = file, D = directory)? Press any key to begin copying file(s) Reading source file(s)... Writing destination file(s)... %9ld File(s) copied Cannot perform a cyclic copy Unable to create directory "%s" ...File cannot be copied onto itself Cannot xcopy to/from a reserved device Invalid combination of options A and M Invalid date parameter (use %cD:%s) "%s" ...invalid file name "%s" ...invalid path name Extended file copy V1.2 Digital Research (UK) Ltd (c)1987. xcopy [%cHelp] [d:][path][filename[.ext]] [d:][path][filename[.ext]] [options] The first file specification is the drive, path and name of file(s) to be copied (wildcard filenames allowed). This specification must be present. The second file specification is the destination drive and path to which files will be copied. Files will be renamed if a destination file name is specified. Valid options are... %cA only copy files with the archive attribute %cD:%s only copy files modified since specified date %cE allow empty sub-directories to be created %cH copy files with hidden or system attributes %cM only copy files with the archive attribute, reset the attribute %cP prompt before copying each file %cR overwrite read-only files %cS copy files in sub-directories %cV verify that data is written correctly %cW wait for disks to be changed F %s ...path password? ^ %s ...file password? v d:..d:pathname.exta:*.*a:*.*/.-:..,a:a: 0123456789abcdef0123456789ABCDEF000000001000000001000000000000000000 *."/\[]:|<>+=;,S ((((( AAAAAABBBBBB   , ***RANGE OR NIL CHECK ERROR***!***QUOTIENT OVERFLOW ON DIVIDE***HEAPMGMT - heap error Aborting...)*** Cheap-heap linked in => no heap dump.&Cheap stack dump linked in => no dump.***Program aborted.******STACK/HEAP OVERFLOW***d?MetaWare High C Run-time Library Copyright (C) 1983-1986 Metaware Incorporated..MZ % ]Pp&+0 ooojo0o2    $U~~;^_:u-^__* t^__* hucPY23F4+6zFF;F|^9:t"u:uG* t* bv.888888888888 88(880\TLD<4,$PF^Ó7*PR G2<+t<-t3G}+uB=uPF^Ó7+P =u* t* awP.2 8212*2#2PF^Ó7*P Gn~tPF^Ó7+Pd FPzP6P4PPF^Ó7^ #tP^7+P F23tPP+P >6u(6PP64?F#}eR4RP >zu$+WuA+_AVWz_^>tgPP64F#}eR4RPm >u P Y>tf PP664@P+Pv ]VW*PC>+r +0P P PW >/t/\PP" #u P Y_^U VWFPFPVRv+RP+RPF+RP~ %RP%_^]UPVW F>u FR6R6QPzPRP߃t tt#PzP6hPP+P #t tt}u PY]#tSPhY#tM#t6P6+ P6YYGuGWP6PhYYr_^Y]UPVvDF2t+>3u F"3*^Y]UPVW+F;>s3Ǻ6>tV>t FPVYVYGǃ>uV>tPzP+P66P+P66P{+P66h>t 6(PUYY_^Y]UVW~P Y>t9E t P*Y)EP5 PuuH.P V2PEP5YY_^]UVW^^;t/#tPY^^P4P:YY>:u:P`Y:#t =}<P~Y^G t*P@PgYDP]Y+~ }u G^ފGFFP3:Y_^]UVW~PYE t DP Y3>t EP5cYYE *Pf PuuFP uugYY>tE t JP VRPYYEP5YY_^]UVWF;Zt PYF#}=t\gRvLFZ^FF:vFPPFP60FPvCF#}=tgRVRP7+M+P6v#tVW6vYvgPFPW+6_^]UVW~v>tEU+DT|#DT+EU&>t&EU+DT}ODT+EU}<;tQPRv~ov~P@@P@@Pv~M_^]UvvTYY]UVWrWv~ Y#~u ~#u PHY>t-=s P/Y6@$ߍ@_^]UVW~+NWuA+_;wdR\RPt^?tSBY6EPDPED EDEDEUDTYY_^]UPVW~+WuA+_BV6GF"u_^Y]UVWvv^PFP*+rWuA+_AVdW~_^ #|;݊_* t+t t#u N݈GN݊G݈GOF#t+N#~ ݀ u#}++ } ݀ uF݃SY_^]UNVW~>tH+WuA+_AVVW_^WuA+_;t:GtGF FF:v݃NSFP_^]UPVW~=.u(+ |=t G^F ^F F+}:"t(<.t$GF^* tF ^F ^F F=.uG+}5=t$GF^* tF ^F ^F F_^Y]UVW~+}ފ< t ^FF} t$^F. }ފ< t ^FF^_^]UVW~F DZ%?F>uFa#u  | Fp ~ F*Pv*PVP _^]UVWF P+ҹdF%FF%F*䖋tt WVvVvvVvVW WVvVvP _^]UW+}C-G+FFtFrFtFsF tFaFtFhFPP9YY_]U졘#t$ V;P P  YY]øP YøPcYøPZYUVW~v^w$tXKKv!.I)dv.dq VV}zDPvs#t V*P vVJXPVY#t*PPEYYVVP5*PP(66(u*APVPYY]P*APlP D<t VP YY߃tt uP P"P YY~gtPY_^]UW~߃ t t ctPg YZP\ *PPO PH .PA pP: P3 P, P% `P *PP *PP *PP *PP *P@P *P\P *PP *PP *PP  uP YPY_]U>tP Y6|FPc ]U!]U;V!s+]UVGVv!s+^]ø7!*UF. %#!]UF.5$!. .%$!]%$!%#!ӎ. ... .6.6<u%$!%#!ӎ.ϴL!UV8!s+]UVW~v +F:t3}:u-* tV* t* -a^F^vv @@PF*PFP #u v Y#uy^ ?tWSY#uN+PPWSF#~<t8+NWNuA+_AVCCVW_^^^ |t^aD:+_^]UPVW+^ ^ ^NWuA+_;uO#t^ߊ<;t:Fu^Ó?;u'v S P#uU#tO#t ^ߊ:FuA};^ߊ:FuG+FF^"t<;t } ^ ވFF |6+^ Ӌڈ;~^ފ^ވF~N+^Ӌڈ_^Y]UVW~+;v}G^F"u+F_^]UVW~+"t<.tFG=tG+=tFG~+_^]UVW~vG"u_^]UVW~vG"u_^]UVW~^* t'^:u^* t ^* -al+: WuA+_AV4 WF_^la\VF3ҋ^:tBp;tStR2YY#t 9tF%Vr+҉N nk;u/^?t +WuA+_AVWH_^>rtkFtkFtkF  vY#tuvnP6l Pk*PFP #ud t2>t$>& .t& P 9 ㉇YY>r>pttP& PYY#t + P Y+_^]UVW~>u>t8 #t!㋗;u VPJY#t ㋇;u> us ^P ㉇\Pj#t u-vnP6l#t"VPY#utu  Pk*PFP   P Y#uY t2>t$>& .t& P  ㉇YY>r>pttP& PYY#t + +_^]UVW~^?u=.u(F.G=.t .F}CG F+}1"t <.t* t ݈GGG Fʀ=.uGF. },=t* t ݈GGG Fύ~+ }^!s+]UV!u]ô!ô!ø3!˜UV3!]ô?@U^VN!s]UV6!S^^^ ]U0!^GgDQ!r^Gg^]UPVW^?u&+NWuA+_A^V^Wa+^WuA+_VO#t:t<;tON<;tvv+NWuA+_AFVW_^_^Y]UVWv{FY=t~}:u* t* -aFGG;F+D WuA+_AV@ W~_^VV:uGVFVRYF#tX"uL<.u[@}<.t:u ݈GGF<.t:u݊G:uNGFPYF#t"t:t ݈GGF:uGGFP\FY=tpPPvF#}G PFPFPpP_ pP/ F ~}\fPpP6 gu H P?Y7fPFPFPF=u60J PY~uF랋F#|F_^]UfVWvvYYt+NWuA+_A^VW~_^^WRVRL PFPFPP +^WuA+_AVW~_^ }VFPFP6~u N PEY4FPFPvFPu60P PYuF륋_^]XXL!UVW8R VRv~>R +YY#tWVP+_^]UVW8R VRv@>R +YY#t WVv+_^]UW~>R FPv R +YY_]U>VW~GF"ur<%t<+FFF FV-u FGF~0uF0=*u^FFGGF*FGF<0r<9wF V*Ѓ0Vۀ~.uD=*u^FFGGF*FGF<0r<9wF V*Ѓ0V3Ҁ~luBV#tGF^*Xt#dt utxt6~u^F/~tFFƒFWFVF‰F^F+҉FV^*Xt9ct^dtst:utxt Nvv vvPFP vvFP(+vWuA+_VFFFvшF+ƉFF;F}F~tFN;F~FR R F"t'V;V}< u R R  R R FӃ~tFN;FR R  ~ uR R  R R  FR R R _^]UVW~F F uO0s~ uFv vFP+WuA+_ڋNWuA+_AvW_'^T OFV FV uً_^]UW~^f OFVFV uً_]UVW+vFFF~t$Nj^,0<9v, +NNN_^]UVW+ WuA+_AVx W~_^  WuA+_AV W~_^#t*F Ft"Ft FPFPBFPP:~^Nҍ~=0uG+WuA+_A^VW_^WuA+__^]UVWvN^*$Nك"ד_^]ììììììììUPVW~v;tFNH|FGF_^Y]UVWF=+NnFF;~vnFPV YYH}G;}vnFPV YY@~N;~vnFPnFP_;vvnFPFFH+;~%v vWvFVv vv@nFP$v vFH+P@nFP'v vWv+_^]UCVNF!s+~t~u]UV!VNN UV!O!s+]UW~"t<*t&&&?>&?u>&&u..(&&,"3&@$+>R0!-"33&=NOuL&}87uD&}=u=PW>&t2& O&=t&"t!G ! !_X&=u>-s 3R&)&+G+&)ϋ"@@@+&.&6 +P> t> ͫu ; u  ! ı=@r-@ =r--UFF]ÌU^F㑋Fʖf ֒]UB t6 d6 d6 L@6 L@B t 6 d6 L@]UP 6 i 6 vD VY> uY]U+FFFF 6 +FFFFF; v6 ^@FF< t< u~tւ~uK`~"u~u~u~uHFF묂~\u!~tF; w6 x"uF"FF6 ^@FFn~t$6 ^@FF~^@6 ߉F; w*v @F@]HEAPCODEeach_item U 9v^#t!;wtVP v^Vv^Vv^VFF~u]each_free_itemU FF`vv| Ut VP JvD ;FtvP F.v#t ;wtVP} v^VFFvD F~u]remove_from_free_chainUv|r*| uD vD t D v\ #tD G ]USY]insert_into_free_chainUPv^#t/ Uu); u6 vvD^G47v\SCv\#t>^ Uu5;6 u vDvD^G47^v#t\v{&v|r ^\ #tw vD 6 Y]search_free_chainUPU1-P@FfFY]USvD^;GrwY]set_limits U P P]sysallocU> ut +ҋN+NvX+;Vw u;Fs+ FV F]add_new_chunk UPV;rЉVwDvxF#t7+v \D UVTD;t7F > u v Y]malloc2U> t FsF~v+F vF#uv[vF~uvPvD+FF= w DFFFvDD D TVT vV^ VF#vDvvv^7\DD UD TƗu; u6 v#F> t/F]zUSY]hmallocUPUC/PvvF> t#tV#v ʋ~FY]mallocUPv6 FY]errUSvtPsnfreeUP~uvFFF> t|v| Duv#t ;wtvD UV86 | Uu$v|> t6 #tv> tfY]check_heap_integrityUU{0P]USY]UU *P ]U> t  *P  F ]UvDDD]U P]PQRSPPVWU~r6 6 FPFP PZ6 A]_^[ZYXPQRSPPVWUFPnnv&<u^ > P6 []_^[ZYXPQRSPPVWU6 6 FP]_^[ZYXUPVR1FV  +PVRFV  #PVRFV  +P0RR+P=1RP+P1P#P]U6 6 P6 6 +P6 6 #P]Uv~N+rt@H]UvvDu > FvDtv|tDt+vvDte|}^DtP+PPDPv+DPtDP$Fv+T;uF> FvL vDDFF]U+FF +ɋv++ًƋӹ F#|Z=Uv|tLvDt/Dt VFY vDt*vDu DutYvDPvD > FF]UPFF L tF ; tPFYF=sF6 1YY]U]UP( FV( Y]U( 4;t ( ( ]UF+ : s* > +* . 0 ]UFFF* ^Vvv]Uv0 P6 P]UF*, >P]UF* LPv]Uvvc]UPF*. > u> * Y]U+PFPF*P]UPF*, * DP0 uF0 tF0 tFFFY]UF*, F * F. F0 BP]0 F* FFV]U* , . 0 62 >4 68 66 !]ݏ6 8 * , . 0 62 >4 : ]*.**.* %04X :%c %04X %10lu %2d%c%02d%c %2d%c%02d%c%02d %s "%s" %s ...File not found Path too long Insufficient memory more...total files total bytes disk free space master checksum %04X (hex) Invalid password Drive %c: not ready Failed to get current path on drive %c: (OS error code %d) Invalid path or path not found "%s" Invalid file name "%s" Invalid option '%c' in parameter Invalid attribute '%c' in parameter "%s" (use A,D,H,R or S) Attribute A,D,H,R or S expected to follow "%s" Invalid attempt to both include and exclude the same attribute Invalid parameter "%s" Too many files to sort (>%ld) access denieddrive not readyfile already openOS error code %dDirectory of %sDIRECTORY Extended directory display V1.2 Digital Research (UK) Ltd (c) 1987. xdir [%cHelp] [[+|-ADHRS] [d:][path][filename[.ext]]] [options] +|-ADHRS It is possible to select files for display on the basis of their file attributes. For example "xdir +A" will display only those files that have the archive attribute set; "xdir -R" will display all files that do not have the read-only attribute set. d: drive which xdir is to search path directory where search is to begin (default is current) filename.ext file to find (wildcards allowed) %cB brief mode: display only file path and name %cC display checksum for each file %cL long display format (default) %cP pause after each page is displayed %cR reverse sort order %cS display files in sub-directories %cT sort directory by date/time (defaul t is by name) %cW wide display format %cZ sort directory by file size %s ...path password? %s ...file password? 2 d:..d:pathname.exta:*.*a:*.*a:a: 0123456789abcdef0123456789ABCDEF000000001000000001000000000000000000*."/\[]:|<>+=;,S ((((( AAAAAABBBBBB   (0F R ^ ***RANGE OR NIL CHECK ERROR***!***QUOTIENT OVERFLOW ON DIVIDE***HEAPMGMT - heap error Aborting...)*** Cheap-heap linked in => no heap dump.&Cheap stack dump linked in => no dump.***Program aborted.******STACK/HEAP OVERFLOW***4MetaWare High C Run-time Library Copyright (C) 1983-1986 Metaware Incorporated.. ࢳд!T!!2ㆠ3+u ub t/<+tHu^GtG3Ҡ.!3|uVGOr dursuy MZ` aP/3  h..HHH $U~}PY^_:u-^__*Ft^__* hucPY\PLPPPP^w #tPY>uPP6@PgY>Lu$+TWuA+_AVPWL_^;~|^0:tPY"us:uF*Ft* dwG. @`````````P`H``Xh fjlPYFG^>ftjPP6@PmY uPY>htH JuPY uP"Y>NtPY+P Y]VWPP{>/t/\wPvPn#u PY_^UVW >ltpPrP6nPWLPP uuPrY#uFF:#ttu PY>pu>fu>ju 6prPYY>ft+PPo*Rn*R#tc+pWuA+_AVVW_^VR Y@/>jt6prP=PPYN>fu>jucpPrPO YY _^]øPa82,>fu >jt+*L6nYYUVW~FP7P,PaF~u-t>.tPV'YYFPBFY;toW:P8P#tVVFrPP6 #t 2PY,2PY~urPHJYF덋F_^]UW~>LtjP LY>fu>juW Y>ft+PPo*Rn*R#t.W Y@&>jtWe P^ YPQ YN>fu>ju_]UVW~vG"u_^]UVW~vG"u_^]øLPY#u>ltf>fu_>juXP<P LPLP >lt\P YP +PRo*Rn*R #u+PYUPVW~ F*PF*PXPj ~t P\ Y=uuHe F^*FtF, F:Ft F:Ft #u+uuP Y#t F*Pd F*PhP YY_^Y]URVW~v+WuA+_AFVW_^փRVz vFP FP _^]ølP YøPYøPYUW~߃ctiKv.#UAZ_KF P$ pP *PPPPPP fP *PPPPPP .P TP P *PP *PP *PP *PBP YY uP YPY_]U>tP Y6FPS ]U!]U;V!s+]UVGVv!s+^]UV!VNN UV!O!s+]ø7!*UF.5 %#!]UF.3 5$!.7 .9 %$!]- %$!- %#!ӎ.5 .; .= .7 .6= .6; <u- %$!- %#!ӎ.3 ϴL!UW~"t<*t tFtFtF ` v Y#tuvP6P*PP #udt2>t$>.tP 9㉇ YY> > tPPYY#t+PY+_^]UVW~>u>t8#t!㋗ ;`uPY#t㋇ ;`u> us`P㉇` b"P #t u-vP6#t"PY#utuP*PP PY#uYt2>t$>.tP ㉇ YY> > tPPYY#t+ +_^]UVW~^?u=.u(F.G=.t .F}CG F+}1"t <.t*Ft ݈GGG Fʀ=.uGF. },=t*Ft ݈GGG Fύ~+ }^+YY#tWVP+_^]UVW8VRv@>+YY#t WVv+_^]UW~>FPv +YY_]U>VW~GF"ur<%t<+FFF FV-u FGF~0uF0=*u^FFGGF*FGF<0r<9wF V*Ѓ0Vۀ~.uD=*u^FFGGF*FGF<0r<9wF V*Ѓ0V3Ҁ~luBV#tGF^*Xt#dt utxt6~u^F/~tFFƒFWFVF‰F^F+҉FV^*Xt9ct^dtst:utxt Nvv vvPFP vvFP(+vWuA+_VFFFvшF+ƉFF;F}F~tFN ;F~FF"t'V;V}< u  FӃ~tFN;F ~ u  F_^]UVW~F F uO0s~ uFv vFP+WuA+_ڋNWuA+_AvW_'^OFV FV uً_^]UW~^OFVFV uً_]UVW+vFFF~t$Nj^,0<9v, +NNN_^]UVW+ WuA+_AVW~_^WuA+_AVW~_^#t*F Ft"Ft FPFPBFPP:~^Nҍ~=0uG+WuA+_A^VW_^WuA+__^]UCVNF!s+~t~u]UPVW~v"u<.uF~}APYY#t*Ft F"t<.u <*tq?GF빀<*uF"t<.uXF.GF ~ }9PY#t*Ft F<u <*u?GFG<*uF<t+_^Y]ô?@U^VN!s]UPVW^?u&+NWuA+_A^V^Wa+^WuA+_VO#t:t<;tON<;tvv+NWuA+_AFVW_^_^Y]UVWvFY=t~}:u*Ft* -aFGGF+,WuA+_AV(W~_^VV:uGVFVRdYF#tX"uL<.u[@}<.t:u ݈GGF<.t:u݊G:uNGFPYF#t"t:t ݈GGF:uGGFPFY=tpPPvF#}/PFPFPpP-pPF ~}\fPpP6gu 0PY7fPFPFP2F=u62PeY~uF랋F#|F_^]UW4=t FG:Eu+ 3Ҁ~ vB_]UPVWvvYY#t8F*䓃t t ~O+ۃ }GF^ӋڈGċ^;Ó_^Y]Uv]UPvY]initPP Pm 3.&X&;v+ر&+شJ!+یЋa;s+ر.TX+@("tPX%t)3*>*&*?>*?u>**u..b*&,&3&"@$+>R0!1&33&=NOuL&}87uD&}=u=PW>*t2* O&=t&"t!G ! !_X&=u>1s 3R&-&+G+&-ϋ&"@@@+&.v6^+P>jt>sͫuw;uu w ! ı=@r-@ =r--UFF]ÌUt6|d6~d6|L@6~L@t 6d6L@]UP 6K 6vD V6Y>uY]U+FFFFm6^+FFFFF;bv6Z^@FF< t< u~tւ~uK`~"u~u~u~uHFF묂~\u!~tF;bw6Zx"uF"FF6Z^@FFn~t$6Z^@FF~^@6^߉F;bw*v^@F@]HEAPCODEeach_item U9v^#t!;wtVP v^Vv^Vv^VFF~u]each_free_itemUFF`vv| Ut VP JvD ;FtvP| F.v#t ;wtVP_ v^VFFvD F~u]remove_from_free_chainUv|r*| uD  vD t D v\ #tD G ]USY]insert_into_free_chainUPv^#t/ Uu);u6vvD^G47v\SCv\#t>^ Uu5;6uvDvD^G47^v#t\v{&v|r^\ #tw vD 6Y]search_free_chainUPU P@FfFY]USvD^;GrwY]set_limits U졒PP]sysallocU>u+ҋN+Nvz+;Vw u;Fs+FVF]add_new_chunk UPV;rЉVwDvxF#t7+v\D UVTD;t7F>uv Y]malloc2U>t FsF~v+F vF#uv[vF~uvPvD+FF= w DFFFvDD DTVT vV^ VF#vDvvv^7\DD UDTƗu;u6v#F>t/F]zUSY]hmallocUPU"PvvF>t#tV#v ʋ~FY]mallocUPv6FY]errUSvtPUnfreeUP~uvFFF>t|v| Duv#t ;wtvD UV86| Uu$v|>t6#tv>tfY]check_heap_integrityUU7$P]USY]UU*P]U>t *PF]UvDDD]U츰P]PQRSPPVWU~r66FPuFPP<6#]_^[ZYXPQRSPPVWUFPnnv&<u@ P6[]_^[ZYXPQRSPPVWU66FPs]_^[ZYXUPVRFV+PVRFV#PVRFV+P$RR+P$RP+PI%P#P]U66P66+P66#P]UvvDu FvDtv|tDt+vvDte|}^DtP+PPDPv+DPtDP$Fv+T;uFFvL vDDFF]U+F+ɋv++ًƋӹ F#|Z=Uv|tLvDt/Dt VFY vDt*vDu DutsYvDPvD FF]UPFF t;tPFYF=sF61YY]U]UPFVY]U졼';t ]UFs+]UFFF^Vvv]UvPP]UF*>P]UFLPv]Uvvc]UPF*uY]U+PFPF*P]UPF*DPuFtFtFFFY]UF*F FFBP]FFFV]U6>66!]ݏ6>]d:*.*d:..d:filename.ext*.**.* (%c/%c)? %c%c YNInvalid number of parameters Invalid parameter: filename expected Invalid parameter: option expected Invalid path File not found Insufficient memory Path too long No empty sub-directories found path: %s file: %s warning: FILES IN SUB-DIRECTORIES MAY BE DELETED Is this what you wish to doExtended file delete V1.2 Digital Research (UK) Ltd (c)1987. xdel [%cHelp] [d:][path]filename[.ext] [%cD] [%cP] [%cN] [%cS] d: drive which xdel is to search path directory where search is to begin filename.ext file to be deleted (wildcards allowed) %cD remove empty sub-directories %cP prompt before deleting each file %cN delete specified files with no warning (careful!) %cS delete files in sub-directories Removing empty sub-directories... ...delete failed ...remove failed%s ...path password?  d:..d:pathname.exta:*.*a:*.*0123456789abcdef0123456789ABCDEF000000001000000 001000000000000000000a:a: *."/\[]:|<>+=;,S ((((( AAAAAABBBBBB   ,3***RANGE OR NIL CHECK ERROR***!***QUOTIENT OVERFLOW ON DIVIDE***HEAPMGMT - heap error Aborting...)*** Cheap-heap linked in => no heap dump.&Cheap stack dump linked in => no dump.***Program aborted.******STACK/HEAP OVERFLOW***'MetaWare High C Run-time Library Copyright (C) 1983-1986 Metaware Incorporated.. ࢳд!T!!2ㆠ3+u ub t/<+tHu^GtG3Ҡ.!3|uVGOr dursuy MZ` P8%77%7p7678zzz $U Z\X+VTvvHYYZ=}VRP YY#t~uLPP YY\;Zt*=}VRPYY#t~uLP P YYFPFPYZ\ YYW Y#tW" P P *>Xt vv vvYYW 6\>YYhPW Y#u]VW^P Y<ttP. P9 YYPO 3Ҁ>^uBd>du_a*W6dNi P _^UVW+FF;~|^0"u:u ~u~~uP Y*䓃1t^8taHtVt_ePv *PPPPg P` *P`PS *PPF *PP9 +PE TVX :tFFIG3~t*PPPP P Z;~}U^Ó:uCPA *-A\YuZ^ÓG"t:tLP PYYG;~}LPv PYY_^]U"VWF3ҡZ;\uBVFZ*APP6 YY~u\*APP YYFPFPFPFP6Z ~u~u>TtFFnF>VtFFfFF+vVJ#ЉV;VwP PYYF)FFfFFvvF+vP<Pl +FF~t~tZ*APPE 7YYF+F;FsFv~FF;vKVNJNPNIFP6Z#t8iP< Y=uPYNIF~뫃~t\*APP YY~tkFPVRVRVR6\ ~u~uFFnF~uFF;FuF;FuF;FuF;Ftv~FF;wvNJNPNIFP6\)#tfzFF;F}+YY#tWVP+_^]UVW8VRv@>+YY#t WVv+_^]UW~>FPv +YY_]U>VW~GF"ur<%t<+FFF FV-u FGF~0uF0=*u^FFGGF*FGF<0r<9wF V*Ѓ0Vۀ~.uD=*u^FFGGF*FGF<0r<9wF V*Ѓ0V3Ҁ~luBV#tGF^*Xt#dt utxt6~u^F/~tFFƒFWFVF‰F^F+҉FV^*Xt9ct^dtst:utxt Nvv vvPFP vvFP(+vWuA+_VFFFvшF+ƉFF;F}F~tFN;F~FF"t'V;V}< u  FӃ~tFN;F ~ u  F_^]UVW~F F uO0s~ uFv vFP+WuA+_ڋNWuA+_AvW_'^OFV FV uً_^]UW~^0OFVFV uً_]UVW+vFFF~t$Nj^,0<9v, +NNN_^]UVW+LWuA+_AVBW~_^`WuA+_AVVW~_^#t*F Ft"Ft FPFPBFPP:~^Nҍ~=0uG+WuA+_A^VW_^WuA+__^]?@U^VN!s]initMPP oP.&~&;v+ر&+شJ!+یЋ;s+ر.TX+@"tPX%t3 > & ?> ?u>  u..  &, 3 &@$+>R0!'33&=NOuL&}87uD&}=u=PW> t2  O&=t&"t!G ! !_X&=u>'s 3R&#&+G+&#ϋ@@@+&.\6+P>t>ͫu;u  ! @ı=@r-@ =r--MUFF]ÌU^F㑋Fʖf ֒]Ut6d6d 6L@6L@t 6d6L@]UPb66vD VY>uY]U+FFFF6+FFFFF;v6^@FF< t< u~tւ~uK`~"u~u~u~uHFF묂~\u!~tF;w6x"uF"FF6^@FFn~t$6^@FF~^@6߉F;w*v@F@]U*P]U>t *PF]UvDDD]U츮P~]PQRSPPVWMU~r66FPSFPP6]_^[ZYXPQRSPPVWMUFPnnv&<u P6[]_^[ZYXPQRSPPVWMU66FPQ]_^[ZYXUPVRFV+PVRFV#PVRFV+PRR+P#RP+PsP#P]U66P66+P66#P]UvvDu FvDtv|tDt+vvDte|}^DtP+PPDPU v+DPtDP Fv+T;uFFvL vDDFF]U+F+ɋv++ًƋӹ F#|Z=Uv|tLvDt/Dt VFY vDt*vDu DuteYvDPvD FF]UPFF t;tPFYF=sF61YY]Uvy]UPv7Y]U]UPFVY]U졺;t ]UF s+]UFFF^Vvv]UvPP]UF*䣾>P]UFLPv]Uvvc]UPF*^ Uu5;6uvDvD^G47^v#t\v{&v|r^\ #tw vD 6Y]search_free_chainUPUP@FfFY]USvD^;GrwY]set_limits UPP]sysallocU>uj+ҋN+NvN+;Vw u;Fs+FVF]add_new_chunk UPV;rЉVwDvxF#t7+v\D UVTD;t7F>uv Y]malloc2U>t FsF~v+F vF#uv[vF~uvPvD+FF= w DFFFvDD D6TVT vV^ VF#vDvvv^7\DD UD6TƗu;u6v#F>t/F]zUSY]hmallocUPU!PvvF>t#tV#v ʋ~FY]mallocUPv6FY]errUSvtPInfreeUP~uvFFF>t|v| Duv#t ;wtvD UV86| Uu$v|>t6#tv>tfY]check_heap_integrityUU #P]USY]Uv4FFVP?]U6prPP)]UPv)FF*䣾?PY]UPvFV*@R;Fs >uY]U+PFPF*P]UPF*䣾DPQuFtFtFFFY]UF*䣾F FFBPFFFV]U6>66!]ݏ6>]UPPr6fhPatP]UvPI\]Copyright (c) 1987 Digital Research Inc.YN Compare more diskettes (Y/N)? Requires Concurrent DOS or Dos Plus DISKCOMP failed to lock disk system. Insert SOURCE diskette in drive %c Insert TARGET diskette in drive %c Strike any key when ready Unrecoverable read error on SOURCE diskette Unrecoverable read error on TARGET diskette Insufficient memory for diskcomp. Compare error on side %d, track %d Verify error on side %d, track %d Compare OK Verify OK Drive types or diskette types not compatible Invalid drive specification. Specified drive does not exist, or is non-removable. Invalid paramater. diskcomp [d:] [d:] [%c1] [%c8] [%cV] Drive %c: not ready. Make sure a diskette is inserted into the drive and the door is closed. Comparing %d tracks %d sectors/track, %d side(s) Verifying %d tracks %d sectors/track, %d side(s) Floppy diskette image compare V1.2 Digital Research (UK) Ltd (c) 1987 diskcomp [d:] [d:] [%c1] [%c8] [%cV] d: drive specification for removable drive (default is current drive) %c1 compare first side only of double sided diskette %c8 compare eight sectors per track of nine-sector diskette %cV verify that all tracks can be read (other switches ignored) 0123456789abcdef0123456789ABCDEF000000001000000001000000000000000000S  "***RANGE OR NIL CHECK ERROR***!***QUOTIENT OVERFLOW ON DIVIDE***&Cheap stack dump linked in => no dump.***Program aborted.******STACK/HEAP OVERFLOW***HEAPMGMT - heap error Aborting...)*** Cheap-heap linked in => no heap dump.MetaWare High C Run-time Library Copyright (C) 1983-1986 Metaware Incorporated.. t/<+tHu^GtG3Ҡ.!3|uVGOr dursuy MZ PB# )  ' r 8 8 $Ul]^_:u-^__*t^__* hucP Y;~|^Ó:t"u:uF*t* bwa.<02(4 68:fP YFiGD;~ugP YF+^^WNuA+_A^VW>_^>WuA+_;6u>P-YG;~u>6t+P0+PcYPv~ Y#v~udP Y;~|PPPPP^Ó7^ #t^>uPP6#thP Y>u$+WuA+_AVW_^8PP66#thPl YFF:>r +F F>:t F6PP6 RvRPFtt.^Ó7^Ó7PPsFF#t=t7~urPPY6#uF+WuA+_AVW~_^S6SFP+6WuA+_AFVW_^>:uFFF4vFP$ .@FPPP_26.Y#tFP^PP>6tvvY2 luFPPP6.Y6PPFYY~u^Ó7PP8PZ YGV+P]ø~PX8 Po P P T >/t/\k|Pj UW~}+FVFV;2u#t,FV6>P6,6(k#t׃FV̓>2t>8uFV FV+FVFV#t QRP<WPJ +Pvv"P1>8tP6,6(#u6(vvW2#t5FV6>P6,6(#t6(vvW_]UVW~@+FVFV;2u#tXFV+(WuA+_A6(W_RF6>P6,V #tFV롃>2t/>8uFV FV+FVFV#t QRPWP +PvvP>8tk#uFV+(WuA+_A6(W_R~6>P6,V: #u6(vvW~#taFV+(WuA+_A6(W_R6>P6,V #t6(vvW2_^]UPWFPvYY#| Ft+_Y]UVW~><u}>4tY#tUWPR+WuA+_WuA+_N#t PZY︦PP4Y>4tv vvLv S#t->4tv vvWP 8v WP(>4tv vvP v PYY_^]UVW&#tY,**(++ʉFN P&P*R4#t>0t#+&>,w2m FF>0tFV#u#tQRP6. "|6$6"6. &=v 2l>&u"F&FPFPVR0#t@)&>.t&;$s06""(*&, P&P*R2#t@),>0t>,v 2m+_^]+&02VW$$=rPW"Y#u.$>"udPNY_^UVWvvPFPx +WuA+_AVW~_^ #|;݊_*t+t t#u N݈GN݊G݈GOF#t+N#~ ݀ u#}++ } ݀ uF݃SO Y_^]UPVWvvPs #t8 F*䓃t t ~O+ۃ }GF^ӋڈGċ^;Ó_^Y]øPTYøPKYUVW~+߃cv. #  PP N"PP YYPP *PPPPPPPP *PLPP{ *PPPj *PPPV *PPPE *P PP4 8PP) ^PP PP PP PP #t*PPPPPPPP  uP YPY_^]U>8t8PY6|FPZ ]UWV؎v<^Fu O<+^_]UWV؎~NvvN +N vuߋыvN tʋ+^_]U!]U;V!s+]UVGVv!s+^]ø7!*UF.%#.!]UF.5$!..%$K!]%$!%#!ӎ.....6.6<u%$!%#!ӎ.ϴL!UV8!s+]UVW~v +F:t3}:u-*tV*t* -a^F^vv @@PF*PFP #u v Y#uy^ ?tWS Y#uN+PPWP F#~<t8+NWNuA+_AVCCVW_^^^ |t^aD:+_^]UPVW+^ ^ ^NWuA+_;uO#t^ߊ<;t:Fu^Ó?;u'v S P#uU#tO#t ^ߊ:FuA};^ߊ:FuG+FF^"t<;t } ^ ވFF |6+^ Ӌڈ;~^ފ^ވF~N+^Ӌڈ_^Y]UVW~+;v}G^F"u+F_^]UVW~+"t<.tFG=tG+=tFG~+_^]UVW~vG"u_^]UVW~vG"u_^]UVW~^*t'^:u^*t ^* -a`+.WuA+_AV(W:_^`aPJ:3ҋ^:tBd;tShR. YY#t 9hF%vVf+҉xN b_;u/^?t +WuA+_AVW<_^>ft_Ft_Ft_F zv Y#tuvbP6`P_*P:P #udt2>vt$>.tPz9㉇zYY>f>dthPPYY#t+P Yx+_^]UVW~>xu>vt8#t!㋗z;uJPIY#t㋇z;u> usRP㉇z|PP #t u-vbP6`#t"JPY#utuxP_*P:P PY#uYt2>vt$>.tPz㉇zYY>f>dthPPYY#t+ x+_^]UVW~^?u=.u(F.G=.t .F}CG F+}1"t <.t*t ݈GGG Fʀ=.uGF. },=t*t ݈GGG Fύ~+ }^!s+]UV!u]ô!ô!ø3!˜UV3!]UB^VNF !sؙ]UVD^!s+v^]ô?@U^VN!s]UF4+YY#tWVP+_^]UVW84VRv@>4+YY#t WVva+_^]UW~>4FPv 4+YY_]U>VW~GF"ur<%t<+FFF FV-u FGF~0uF0=*u^FFGGF*FGF<0r<9wF V*Ѓ0Vۀ~.uD=*u^FFGGF*FGF<0r<9wF V*Ѓ0V3Ҁ~luBV#tGF^*Xt#dt utxt6~u^F/~tFFƒFWFVF‰F^F+҉FV^*Xt9ct^dtst:utxt Nvv vvPFP vvFP(+vWuA+_VFFFvшF+ƉFF;F}F~tFN;F~F44F"t'V;V}< u 44 44FӃ~tFN;F44 ~ u44 44 F444_^]UVW~F F uO0s~ uFv vFP+WuA+_ڋNWuA+_AvW_'^6OFV FV uً_^]UW~^HOFVFV uً_]UVW+vFFF~t$Nj^,0<9v, +NNN_^]UVW+dWuA+_AVZW~_^xWuA+_AVnW~_^#t*F Ft"Ft FPFPBFPP:~^Nҍ~=0uG+WuA+_A^VW_^WuA+__^]UCVNF!s+~t~u]UV!VNN UV!O!s+]UW~"t<*t$&$?>$?u>$$u..L"$&, 3&@$+>R0!+ 33&=NOuL&}87uD&}=u=PW>$t2$  O&=t&"t!G ! !_X&=u>+s 3R&'&+G+&'ϋ @@@+&. v6+P>t>ͫu;u  ! p ı=@r-@ =r--UF F ]ÌU0 t6d6d6L@6L@0 t 6d6L@]UP 6K 6vD V6Y>uY]U+FFFF6+FFFFF;v6^@FF< t< u~tւ~uK`~"u~u~u~uHFF묂~\u!~tF;w6x"uF"FF6^@FFn~t$6^@FF~^@6߉F;w*v@F@]HEAPCODEeach_item U9v^#t!;wtVP v^Vv^Vv^VFF~u]each_free_itemUFF`vv| Ut VP JvD ;FtvP| F.v#t ;wtVP_ v^VFFvD F~u]remove_from_free_chainUv|r*| uD  vD t D v\ #tD G ]USY]insert_into_free_chainUPv^#t/ Uu);u6vvD^G47v\SCv\#t>^ Uu5;6uvDvD^G47^v#t\v{&v|r^\ #tw vD 6Y]search_free_chainUPU&P@FfFY]USvD^;GrwY]set_limits UPP]sysallocU>u+ҋN+Nvz+;Vw u;Fs+FVF]add_new_chunk UPV;rЉVwDvxF#t7+v\D UVTD;t7F>uv Y]malloc2U>t FsF~v+F vF#uv[vF~uvPvD+FF= w DFFFvDD D TVT vV^ VF#vDvvv^7\DD UD TƗu;u6v#F>t/F]zUSY]hmallocUPU(PvvF>t#tV#v ʋ~FY]mallocUPv6FY]errUSvtPUnfreeUP~uvFFF>t|v| Duv#t ;wtvD UV86| Uu$v|>t6#tv>tfY]check_heap_integrityUU!*P]USY]UU *P]U> t  *P F ]UvDDD]U P]PQRSPPVWU~r6 6 FPuFP P<6 #]_^[ZYXPQRSPPVWUFPnnv&<u@ , P6 []_^[ZYXPQRSPPVWU6 6 FPs]_^[ZYXUPVRFV  +PVRFV  #PVRFV  +P*RR+P*RP+P3+P#P]U6 6 P6 6 +P6 6 #P]UvvDu , FvDtv|tDt+vvDte|}^DtP+PPDPv+DPtDP$Fv+T;uF, FvL vDDFF]U+F4 +ɋv++ًƋӹ F#|Z=Uv|tLvDt/Dt VFY vDt*vDu DutsYvDPvD , FF]UPFF : t4 ;tPFYF=sF61YY]U]UP FV Y]U -;t   ]UF ( s , +   ]UFFF ^Vvv]Uv P$ P]UF* >P]UF LPv]Uvvc]UPF* , u,  Y]U+PFPF*P]UPF*  DP uF tF tFFFY]UF* F  F F BP] F FFV]U    6 >" 6& 6$ !]ݏ$ &     6 >" ( ]*.**.* %s %s %s%s - %lu: %s %s %s(%lu): %s %s: %s (%lu): %s %s %10lu FILE: FIND: Insufficient memory FIND: Invalid parameter - option expected FIND: Invalid number of parameters FIND: Path too long FIND: Current path invalid FIND: Invalid filename "%s" FIND: Invalid path "%s" FIND: File not found "%s" FIND: Access denied for file "%s" FIND: Read error on file "%s" FIND: Line too long in file "%s" FIND: Cannot open "%s" (device) FIND:"%s" ...path password?  Search for text string V1.2 Digital Research (UK) Ltd (c)1987. find [%cHelp] [%cC] [%cN] [%cS] [%cU] [%cV] "string" [[d:][path]filename[.ext]...] %cC show only the number of lines that contained "string" %cN display line numbers %cS search files in sub-directories %cU case-sensitive search (eg 'A' doesn't match 'a') %cV display lines not containing "string" d: drive which find is to search path directory where search is to begin filename.ext file to be searched (wildcards allowed) Multiple files may be specified on the command line. If no files are specifed find will read from standard input. d:..d:pathname.exta:*.*a:*.*0123456789abcdef0123456789ABCDEF000000001000000001000000000000000000a:a: *."/\[]:|<>+=;,S ((((( AAAAAABBBBBB   &4 @ L ***RANGE OR NIL CHECK ERROR***!***QUOTIENT OVERFLOW ON DIVIDE***HEAPMGMT - heap error Aborting...)*** Cheap-heap linked in => no heap dump.&Cheap stack dump linked in => no dump.***Program aborted.******STACK/HEAP OVERFLOW***-MetaWare High C Run-time Library Copyright (C) 1983-1986 Metaware Incorporated..`` 6W2PVPZ CP/M V1.35 6/12/85 SMALL Model CLEAR library. Copyright 1983-1985 Digital Research.$UWVVN  *^_]+ێOsZero divide error$XYZ+^gVDRQSVRSSSP6 [ZB;v' Stack overflow. $+RSñ uPPt<v. A0 ÃԱi@t+ P X"r.t " t 5 t 5t+Ɉ4 2 %Ë-++Ë6_Cr Ë6_+́;s;rùË-UPPPe+]You must link with LINK86 V1.2 or later. $66 UVWv v~v2f_^]Y[ڎ^6-6'6!6666 6SV++4,S$p{ȳ+^t&u+[+u@fU vvF~u1 2P:1DDP DDPPq { ~u~uP69DDP7DD>}u>uPDDF PDDF~u>u F>u4F'F PDDF~~v DDF~d|Ӄ>ueFVPF[7DDF~~7 PPF[7 P[Gu u| GuP) DDFK9F~]á P4DD P4DD  2P/DD 0/+PP 0 P -DD+P6DDUFF%FF?uFFF? tFF~|ՋF]U FPP P+P.~to~th P2DD=uf PlX+ÉFPX+ÉF9Ft;FlFP^[FF9F|.. .FP>P P+P.F2= t c 2P.DDi > u4H 2P.DDP\ DDPzP 7 !P7DD > u|!P7DD > ucF/Pc7DDF~uD HPF[؋FF~|˸P.7DDF~u FGj-F ^ ^ F~|KFFF FPFF؋F[ u}FF FPFF؋F[ uP PG5 > | P1DD0P P3 > }F F F~ |F PF[F~d|縼 P P P  PA1DDFF؋@@?tFFF؋?-t1FF؋@?mtFF؋@?Mu ^FKPK[P PU5DD[PK[؃?u+F(PK[؋FFFF~uFF؋F?sSFF؋F?r=o PFF؋F2[؊%tFF؋F2FF؋F2F t ~,tJPK[؋F~tFFF؋F?t# F=uV=u=uIFF9F}6+]U      4FFA 2P*DDPUDDPP0F~uF ~uFPF@[؋GP Pf[PF~t~t~uFn~~F~}F~ t ~ tw~ u(F ~uFP P1 > }F P P PF~u FF FF 2PT)DDP&DDPPFt 2P)DDPDD"PPU_F>~uF0P P0 > }F P P P6F~u FF FFD 2P(DDPXDDPP3F 2PP(DDP"DD6P$PFq 2P(DDPDDPPR\R<:F=t=uN=u=u=uh=u=u)돃~u~u+]UFFF &F F~d|dž$ 2P`'DDP2DDFFFFqFX FF? tF&FXdž$PPvv FP PPvF-PL P F~|FFF~~F~F}u>P8Pp$u4O 2P&DDPcDDFP@P>rF~d|F~}FcF~d|F&F? tF@@FF@@FvFP>&P=#DDPFF2P4&vv&OF~xuFX~Xt~ u FFPF[P"DDPFF2P%~ t~ t ~Xt~ uF~ un~}Fc&F? t~t G 2;Ft G 2;Fu0F!FF?XuvDD=uF~d|]UF FFP FPF[؊[F~|FFRh 2P$DDP|DDTPHPW PF[7 P PF~upPjPFP P F~}]N P P F~}FhPVP]gF~t G 2;Fu G 2;Funi P PF~upxPrPv 6 PF[؋FFPv P(  P P P}+]UX PvP+P P# ]á P#DD P+P#á PP#y#U^u4^G2P^GP`DDP^G2P^2P^GP ^u'+P^GP_DDP^G2P^2P]UFfFPqDDFF9F|]UFF+Pvvv*F^vv+PP0X tJ Pvv.F~ }+F Pvv.F~}+]UFF+Pvvv8*F^vv+PPR0X t@ Pvv9'F~ }!Pvv'F~}+]U +PFRP+PP/v)F^vv+PP/X tPvv-F~}PF@@Pv-F~}PFPv-F~}PFPvd-F~}xPFPvA-F~}UPFPv-F~}2PFPv,F~}PFPv,F~}PFPv,F~} PF(Pv,F~}FPF(PF[؃?t9F(PF[7FHPF[7v=,F~}RF~|PFhPv,F~}'^GhP^GjPv+F~}+]UFP+PPvx'F^vv+PP-X t+vv+PP8,XZF+PFRP+PPp-v,'F^^JFCF(PF[PFHPF[7DD[vF(PF[؋[F~|v^GjP^GjP[Ghv^Gh[PvvF~}+PF@@PvF~}+PFPvF~}+PFPvF~}+PFPFPF~}+aPFPv]F~}+?PFPv;F~}+PFPvF~}+PFPvF~}+ PF(PvF~}+FZ u v2DDF\ PZ Z [PFF[FF9F|NjF]U>Z ~P\ PvW!FFZ F]UFFFHF^? tFFF^?uF^F+F@]UFFFFF{^:Fu ~}FU~~$FFFFFFFFFFFFFF9F|F^F~uFF~t|FFF+F]U FFM^?u2F^2FF^F FFFFN FFP^[F^?uFFFF nF9Fr^]UFFFFFF7F%PF%p[ PF%[ ÉFFF> u~tF%F FFF%F FFF5FFF5FFFF to P^2[؊%t*~~$X Pvvv Pl FFFF%FP^2PQ FF-FF tF%FP^2P FF~$X Pvvv P FFFF^2FFX Pvvv^2P FF~~$X Pvvv P FFF^?uF_X PvPv^2PP F=;^2<u3<~u<|u|<{ue<}uN<_u<\uhF~tF]U3+upkfa\WRFMKIGF2 ]UFZFF H^F\F`FdbF fFlFnvZP]U ^GP^X+@FvNDDFF^GFAX P^_ ؊2PvFFPP^XPFFP FFF9F ^G;F}8X P^_ ؊2PvFFPP^XP P. ^G;F}]U ^GP^X+@FF^GF^_ ؊2P DD+FFP^7v+PFFP<FF^G;F}ʋ]UPP;PYP-PFF2 PPFF2 P]U^GP^X+@V^GP^_X+@&VX^tXXFvLDDqqqF X9q~^tX@PqFq?.uqP qX9q~ދ^GP;X~X ^GPR^GP^R[;}^G ^RTR@qFq qX9q~^G P7 DDvv:^GP^[;|^GP^G[;~ v^[G^GP^G[;|^GP^G[;~ v^G[G^GP^GPp^t>p0s>p9vv DDqP9quX@PXR^GTFqpPp2PQ^G;T} ^G%^GP^GP^G %t >p-uJ^GP^[;u(^tPp2P ^-^GPP`C >p.t^uvvU v DDPFPp^GP;X~X ^GPR^GP^R[;}^G ^RTR@qFq qX9q~}vv^G;T}^G^GP^GP PPnQ p%t>p s^u3>ps$>pro Pp2[؊%t p2p2pvDDFؠpPp2PZ ^G^GP^G[;h^GP^G[;u/^o^G %t^GP^GP 'v^[G^G^GP^GP S>p u^G %t >>pu^G %t &>p u^G %t >p u^G %t>pu^G % t>pu^G %@t :pu^G %t G:pu^G %t G:pu^G %tm G:pu^G %tO G:pu^G %t1 G:pu^G % t G:pt^G %@u G:pu^G %t G:pu^G %t  G :pu^G %t  8pt 8pupǠ 8pt 8pupv^[G^GP^G[;}^G^GP^GP %^GP^X+@@P^XHq^G;q|^qG^GP^GP? PP^GP^X+@HP^XHq^;q~ ^qG^GP^GPPPwZ^GP^[;u9^GP^G[;uPPC&^ov^G[G^o^GP^GP`>pu3P P`^GP^GP7vDDF ^GP^G[;uPP^o^GP^GPw^GP^G[;uPPqT^G^GP^GP6^GP^uT^G[;t8^GP^G[;uPP ^Gv^[G4^u$vDDF؀? uPP ^G^GP^GPv^[Gv^G[G^GP^GP`^uPPc Fv^G[Gv^G[G^GP^GPvDDq^uD^GP^_X+@&VHHss@FPFs[sq9s}.XHss@FPFs[sq9s}ۋFq ^t~Fq0P9qPR@q;X Fq ^GP;X~X ^GPR^GP^R[;}^G ^RTvvm^GP^GP<vDDqFqu@w^u!^GP^_X+@&VHFãy FXyuuPww[y9wv^tP9quX@P^GTXRP9q}X9P.P^GP;X~X ^GPR^GP^R[;}^G ^RTy vv@^GP^GPPP p2 t 1^_]UVWF8t >_^]UVWF~Nf F _^]UVWv~NF F PXPtQVV^YX_^]X F>& t16ãWSގƾ<u[_2K>t sыSrC+ӃuRPP9tX>8&t2& t;6u &;t'. t3&&. t3m&׊YQR>Ou6Q 'ZY_R >& uZZ>Pr>r tWS&u6o[_&&P'ެ؊(X 'ˈ&2& t1W_UVWmF|< r 0C0P P u u#uR,XPp uбt,ߎǿ6 u ǎg02 Aw'&&6 t02 Awǎ߻t'Ș؋'t ؊>u PXZP X_^]UVWvVDD u$ F% t% t=% u4EPR"E PK" X tP+PPVRP PVqW2DDFE2PDDFEPPƃ2=uFvE2PVDDVEDD~uF$  f_^]UVvDD u]~u+S% t$ 9%tvvV#%tvvV  vvV^]UVWB=uzVDD P[؋ǃ~u  Pv6 u B Pvo6 u )PvV t$ #  _^]U+Pvv^]U+PvvJ]UPvv5]UvDD]UVWvD%t,D?|DF2#VF2PL$  _^]UVW=uVDD P[؋ǃ~u ~u  PvJ5 u a Pv15 u HPvVG t VDD+ P+PPE2P+PPPE2Ps_^]U+Pvv5]U+Pvv!]UPvv ]UFPvP? ]UFPvv* ]UVvDD u$ ]DPvvbDPvv.SD PvDDSPDPD Pvv])$  BF =t=t=tׁ$DPA+PPX t DPPP2DP"X[^]U PHPPv(]UVWFH+@VDD u+VW_^]UVW, NjƋDP\X3 tPt DD+D;Fu;6, tǡ, NjƋD;Fr;6, uvDD u P% DD+_ʡ, NjƋDP\X3 t P DD+5D;Fr);6, uvDD u P DD+_^]UVW^ƋDPF@[;w v[?fÉWD+F[GWE[GW[^?ދFGVD[GF, D_^]UVWLLF?FfPDDƃu+5@RP+P@P`hXZƉߋFGWE[GEP DD, f_^]UVWF-ƋDP\X3 tP DD, ;r9r9r 9v;r;r(DⓋPEⓋ[;w>, +lDⓋP[;uVG[GVD[GV[V[EⓋ;uWD[GWE[GW[5>, +_^]UVWvVDDFH+@FP3DDF u+R^;t8;s GP[N~uFNjF OPN[N~uvvf_^]UVvDD uj% t+]% t$ C% tvvV+%tF+SPvV1F+SPvV~^]Z[YX[SPZ[YX+[SPUF UFF 3FFF tVV FV FtVVFV F Fu3FFFFVV VVQvvvvYYs$QvvvvOYYYF^VV VVFu"F^Ft ]YSPF^ZX[؃SPZ[YX;[u;uPZ[YX;[u;u+PUN ;N|N;Nwr4F ]+׸ҸUF f؋Ff؋FfډF^ ]UVWvFtt+PPXZF+Pvt t_X tpVVDD tD\%SPD \-%SP0}dž PF2-0[ÉFFF~0r~9vĿ~.u+FFF~*uv^ǃFFF. PF2-0[ÉNjFFF~0r~9vdž~lt~LuFFFFt(g`88PP PPV  tt(g`88P+P PPV tt(g`88P+PPPV tPt(g`88P+PPPVI tv^Fv^2䈆ƆF2PWPVF2PWPV\F2PWPVtvF2P&/zF2DP\X+ÉF ~-vDPP2Ѓ9~tL$  HD%t|tD%tDDPDؙRPP҃DVD[G+f_^]UVWF PF Rv~_^]UWV+V Fu أ .F^ ;wr ;vr+v@6 > ^_]ÃF FF2n=uDu&t t =ut u Etu Eut+؉^TV@^ RPFXY؃㓇ҋʋV҃VR ҃R FFufVVVV 3FFFFFߋOOO/ }^FuNfVVVF2n=uDutuEu=ut=tC^5VPF=uDuNu Eu:tV2u Eun=tuD\LE]M;} FNFTVTVTVVF2͈NV+=5vdE]M5r֊͊ߊĴt NuFu%VN^FF tFn^^^^N6V+VN^FsڃVuNJ݊Ίs^4u N6vF^NV t;#y ؃u3u ԊKs]UEË\ݱxT}`LTD| <$ Ċ֊tu"y؃33ҷt"ú"y@Bx"y"t -x@BËD-y-4|D$ \LU ֊͊ߊtEuDt]ENJ݊Ίu ]Mܓ3Dt̀24E3ۉ]]=t Dt]ËDEDEDEÁFsFuFuFF tFFF==|FtN2F4EF^NE] E%-D%-þB RPB BXZB R FFuþRs BuBuBFFGG uËGW/_uF ^VNNNð n3FtM]]ð3UVW؎~*ʋ~OvJsF_^]UVW؎~+ыv~tH@UVW؎~+ыv~t|&]awaawa:t밋W؎6*ыH_UVW؎N~vs_^]UVW؎~FNs_^]UVWv؎~F~ ī_^]UVW؎^vN ~s_^]û+VW؎6|*6Du6|OuA_^+_^$@Y@@@@j@.AcAחA7yACyCxDnF\)c=Hsȡ1I=P1PK?O8M20HwZ$gAAI0GP+OI~.G ~0GIJuO=0tG^_ä.GPIR N01N#1#1xxxx CprogramCON:LST:& & Raw I/O<>.,=:|[]* : unmatched quoteCannot open Cannot append Cannot create : No matchStack Overflow $C RTL - program not linked for Program terminating $ ࢳд!T!!2ㆠ3+u ub t/<+tHu^GtG3Ҡ.!3|uVGOr dursuy xx&}R(& 2PVZ +ێCOZero divide error$XYZ+^gVDRQSVRSSSP6 [ZB;v Stack overflow. $+RSñ uPPt<vDAFÃԱi@t+ P X"r.t " t5 t 5t+ɈJH%Ë-++Ë6_Cr Ë6_+́;s;rË-UPPPe+]You must link with LINK86 V1.2 or later. $66 UVWv v~v2f_^]Y[ڎ^6-6'6!6666 6SV++4,S$p{ȳ+^t&u+[+u@fCP/M V1.35 6/12/85 SMALL Model CLEAR library. Copyright 1983-1985 Digital Research.$UWVVNNp*^_]UF^2FF^?t0FPFF[؊2PP^?u]UVW P-P1PPP|DDƋƻd+0_ƻd+ +0`ƻ +0aƻd+0}ƻd+ +0~ƻ +0VPP t;P PP PP PP P-rPPP PPDD+PP+P PPPxF)F~s<PP[rPPKFPP: uF!#"ƻd+P2[âƻd+ +P2[âƻ +P2[â >a@rPP>tF&F+FPFƓ[FrF+FPDF؊[F$r>t>u6F;rcF2<t<t<t<t<t<t̀>upPPPPFPDD&F+PFƓ[F rFPP>tF+FPƓ[F rF+PFƓ[F r&FPP \>tWJ>tE8rPP>uPPPP/2< t< t<t<uI<u<uG<uFPmDD t/&FPPL,PP>FPP2=u`SLL7PPP,PP!P+FD+FPPF2FfUD89Du <BBE~u< tFH<B FBFF=t=t>>PpPF;#u-+&FࣹFPP5~u(F&FPPDD>7tFf_^]ABCDU챚&2]U챚&GK]UVW v&_ tFFAf_^]UFF]UVWFVf_^]UVWFFÍf_^]+P PNT]R%+PPRR@'RRN= t=1t="t=1t:7R/-+T="0t=" t="t=1t=1t=0t=0uz+PDP>Nt>Nt R+SPLIN DSP DSP  Only printmgr can de-spool.LST000: Unsuccessful$ $That printer could not be enabled for output.$Successful $  CprogramCON:LST: t/<+tHu^GtG3Ҡ.!3|uVGOr dursuy  6{2PVtZ CP/M V1.35 6/12/85 SMALL Model CLEAR library. Copyright 1983-1985 Digital Research.$UWVVN8*:**^_]+ێOsZero divide error$XYZ+^gVDRQSVRSSSP6 [ZB;v' Stack overflow. $+RSñ uPPt<vj*Al*ÃԱi@t+ P X"r.t " t5 t 5t+Ɉp*n*%Ë-++Ë6_Cr Ë6_+́;s;rùË-UPPPe+]You must link with LINK86 V1.2 or later. $66 UVWv v~v2f_^]Y[ڎ^6-6'6!6666 6SV++4,S$p{ȳ+^t&u+[+u@fUvvF~u10+,&2PrNDD. PD+DDP$PJ$P++;~u~uZ$PVDDPKUDDFPDDF~uF~uo]UFvDDF~tF+Fv %DDF~uF ~uFF&F~u~uFsFlv(&PE.F~u-*,&2P\MDD. P.*DDX$PR$P*+F" F=t=u~=uI=u"~t>%P^Gu[؋FFlP^GuP<%P6>%P<%P(&P*(&PgQDDP&PU(&]U9FPP2&P+PK~uu~tn2&PODD=u.&0%"%P2X+ÉF, PX+ÉF9FtF2FP^[FF9F| L<$%"%LFP>P2&P+P0&u4b(,&2PKDD. Pv(DD2$P&$P(Q(8!PFUDD<%><%uF/P&UDDF~uHPF[؋FF~|˸PTDDF~uuFGjPTDDF~uTF&KKF~u2FF&PFF[PF@@7FF[؊[ uvj$DDF]á(&P2ODD?',& 2P~JDDB' PGDDJ~J+PPJ+PtQDDU &,&2PAJDD. P'DDX P4 Px'&7F"%G2;Ft0"%G2;Ft""%G2;Ft"%G2;Ft~u"%G2;Fu"%G2;Fu"%G2;Fu"%G2;Fu~uvDDF~u~u+vVDDF~u+vSDDF~u~u+vDDF~u}+uvDDF~ua~u+avDDF~tF+L@vDDF~t/~u+/++=t=t=uX=u>t]UFFlF F~|FtU8$,&2P>HDD. P%DDl PZ Pu%$FlPT&P4F~ u~uyFFlPFF[؀? tFlF?uFlP<%P{0>| T$ P P$Z$4vw1DDv(P<%P80[Gu^u}\+dV$,&2PBGDD. P$DD P Py$#4/!=t=uE=u߃>t+]U FFlF F~|FtlOa#,&2PFDD. Pu#DD P P#P#FlPj&P]3F~ u*~uFFlPFF[؀? tFlF?uvFlP<%P.[Gu^u} " P PC#"M3>%P^Gu[7v(&PU$F~u l" P P"r"3T+[L^GuP<%P.>%P<%P(&P~# c=t=u.=u>t+]UVWFFlF ^ F~|FtFm!,&2PDDD. P!DD Pn P"FlP&P3P&P2j!FIFlP&Pn1F~ u5~uFFFlPFF[؀? tFlF?uփ>u;FlP<%P,>|  P PL! V1P&P0F~ u~uDFfFPFF[؀? t ^?u6vw-DDv(P<%P8,[Gu^u} P<%P,>}  P P} 0>%P[7v(&P!F~u^Gu+ P P" ,0us P P y 0^GuP<%P,>%P<%P(&P B4}/=t=t=u=uw=u=uf̃>tW+f_^]UVWFFlF F~|FtqT,&2PADD. PDD P P)FlP&P.F~ u/~u-FFlPFF[؀? tFlF?uvFlP<%P,*[Gu^u} P P. P PuYP&P-F~ uy>Yu ]>NtS+ZK^GuP<%P?*>%P<%P(&P+/ =t=u)=u>t+f_^]U ),&2Pk@DD. P=DDFF3F"PPvv<%FP- FF~~؃F~F|ǡ P P]g-],&2P?DD. PDD@$P4$P+5-9UVWFAF F~|FFF6~t-~ |~~~!~t~ tAPFF[PF[F~|ËF-P:dž>dž<A@Fdž)F&P^GjPk$&&&dž-dž+),& 2P>DD P P%~tV!P>!PF&!P&P[P.F~uF~uF~uF~uF~uF~uF~uF~uF ~uF ~ uF~ uF~ u_!P PY!2P!2P.>j+F~nt~Nt~yt ~Yt~ u܃~yt~Yu)undž)dž'dž%dž#dž!džB'&D'&&P[؃~&P[G<udž<dž<ldž)dž'dž%dž#dž!dž&B'&D'&P[؃}&P[G<udž<dž<&P[É8' % # F!Pf[P'[GF~|዆%)!#/!'7!F>!Pf[P'[GFV!9F|F!Pf[P'[GF!9F|FX!Pf[P%[GF|!9F|F~!Pf[P#[GF!9F|ߋ' '!' !FHF8GPⓡ&P8_XÉ3:+PP'P+PN)|!PX!P!P!P)P,& 2PdDDPP8GPP8_XP3Pa; &P[É8X!P-[É55G2P52P;P8DD5GP,;DD(F"%2;FuS[,&2P:DD&!P&P[P(|!PX!P!P!P(-1~t ~t~u -@1-91u5G2P52P0:5G2P)7DD5GPD:DD1--}|!H-|!9-|dž-|!HH;-.8GP8G[;u8GP8G[;udž-~u"%G 2;Fu ~ tT~uFy F>3\W3_N3}E3{<Ɔ7~F0Ɔ7|F$"-=t=t=t=t=t=t !P~!P-/&P[É8~!P+[É55G2P52P8P5DD5GP8DD%F"%2;FtH ,&2PL8DD&!P&P[P&!P~!Po|!PX!Pa!P!PSX!P/[É55G2P52P8P5DD5GP)8DD+1~t~u +H1~t~ u +@1+91t[5G2P52P75G2P4DD5GP7DD1++}!H+!9+|dž+~t"%G 2;Ft ~ tT~uF' 8GPⓡ&P8_XÉ33373P+[F &P[؋GPF~/}(F/&FPP&F[NF9F}ߋFF &F FFP;FFm &P[؋GPF~/}+FPF&F-P  P&F[F~~F0 &F F~~FF&P[؋GPFF&F? uFFPFP[;|FO;F}FOF&F? u FN;F}F9F|F9F}F ^ F~P|F+F@F(PFX+ÉFFFPFF&؊[FFF;FF&FFP^[F~P|&P[؋G@P(P!PL=&P[؋G@P(P !P+=+P)P&!P=FF +PP&P@[؋GP+P"4!P!PF w!Pf[؋GP&PF[P F~ tI~ uF<~t ~ t~ uF~un~~F~}F~uF FuPF[P )P!PF@[؋GP8F~}F PF[؃?}PF[؃?~F PF[؃/F~|9+=~F ~ u$PP:P&FP&OF9|L9C@+PHFFFFNⓡ&P&F[NF9F}6P&FFFFFⓡ&P&F[FF9F~FnFF&P[؋G@P )PH!P:&P[؋G@P)PT!P:&PKDDF PP'P+PP1AP<+%P>[؊@&P[É8Fe:9>|#9 PR.DD$P@2PN18GP8GP#18_ ,&؊2PDDP0DD$P8GPⓡ&P8_X؊2P0

P0AP<+%P>[؊@ P-DD$P@2P0

P0F.%2;Ft :%2;FuF/%2;Ft ;%2;FuFdž>%<dž>O#<#9u%9O>e>Ou#9>=;9F=t= t=t=t=uu=uX=u?=u&Ã~ tA~t;"%G2;Ft-"%G2;Ft"%G2;Ft"%G 2;Ft~uF 8GPⓡ&P8_X؊@~ uF8GP8GP.8G P+DD$P@2P.

P."%G2;Fu8GP8G[;~8o"%G2;Fu8GP8G[;}8G"%G2;FuI8GP8[;u.8GP8G[;t8o8P8G[G8o"%G 2;FuI8GP8G[;u-8GP8G[;t8G8P8[G8G\F=t=u=ue= uL= u= uC= u~= u=uN=u<=u=uN=u=u@=u-=u$=uo~t&PDDv^GjP&PB[Gh+f_^]UJ ,&2P,DDv^DD!P!P : ]U ,&2PW,DD. P) DD\"P!P  F~ t "%G:Fu"%G:Fu],&2P,DD. PDD"P^"P8 BUF%pPF%[ PF%[ ]UVWF@@FFFFFFFFFFFFoR!,&2Pc+DD. P5DD#P"PF%FPF[7'Pf[PuF~|ՋFd7"(PYFf7N(PFFF~}F ~ ~F~t~uF~|}FPF[؋P'Pf[PnF>Yt>Nt ~ t~ u˃~ t~ u`FPF[؋~tFn F tKF-FFHPF[7'Pf[PF~ t~ uF F-FFFP'Pf[PF>At(>Ot!>Ct>Et> t ~ t~ u~ t~ u`FF~tFn~u ~uF#+*F=t=u.=u~t+f_^],&2P(DD. PDDv#P #P&UVW FcF~ctV,&2P(DD. PjDD#Px#PF[F@@f(Fj(FHPF[7d(PF@@|(F@@(FFPz(PtF~ |FFPF uYFHHFFF?Mul(l(Ff(F@j(FHPF[7d(PFtF@|(F@(FHFFFPz(PSF>At#>Ot>Mt>Ct>Et> uŋFF~ ur~u'FFFcS~uvHDDFFFc8~ t;~ t ~ t~uFn~}F~~F~tf_^]UT,&2P&DD. PhDD#P#PCFYFFP(PKF~ u~Yt~Nu؀~Yu+]U &#&$&#QP&Pq.(&>(&}FFy>%P<%P(&P`F~uF FOx,&2P%DD. PDD$P#PgFB,&2P%DD. PVDD$$P$P#P#P#F P&PL,(&>(&}FzF <%F F~ |<% F>%PF[F~d|>%P<%P(&PF~u](&Pe)DDFF>;d,&2P$DD. PxDDH$PB$PSFF+,&2Pm$DD. P?DD#P#PF F &^ F~|'&&P(PF~ u~uFFF&FP&PFF[؊[ u]cVTOF= t=t= uk=u0=u=uJ=u=u=u=ub묃~ tT+]U)PvP+P P# ]á2&P#DD2&P+P#á2&PP#y#U^u4^G2P^GP;hDDP^G2P^2P^GP ^u'+P^GPhDDP^G2P^2P]UFfFPqDDFF9F|]UFF+PvvvU+F^vv+PPo1X tJ Pvvl/F~ }+F PvvC/F~}+]UFF+Pvvv*F^vv+PP0X t@ Pvv}'F~ }!Pvv^'F~}+]U +PFRP+PP0vF*F^vv+PP`0X tPvv\.F~}PF@@Pv:.F~}PFPv.F~}PFPv-F~}xPFPv-F~}UPFPv-F~}2PFPv-F~}PFPvh-F~}PFPvE-F~} PF(Pv"-F~}FPF(PF[؃?t9F(PF[7FHPF[7v,F~}RF~|PFhPv,F~}'^GhP^GjPv},F~}+]UFP+PPv(F^vv+PP".X t+vv+PP,XZF+PFRP+PP.v'F^^JFCF(PF[PFHPF[7DD[vF(PF[؋[F~|v^GjP^GjP[Ghv^Gh[PvvF~}+PF@@PvF~}+PFPvF~}+PFPvF~}+PFPFPF~}+aPFPv]F~}+?PFPv;F~}+PFPvF~}+PFPvF~}+ PF(PvF~}+F)u v2DDF)P))[PFF[FF9F|NjF]U>)~P)Pv!FF)F]UFFFHF^? tFFF^?uF^F+F@]UFFFFF{^:Fu ~}FU~~$FFFFFFFFFFFFFF9F|F^F~uFF~t|FFF+F]U FFM^?u2F^2FF^F FFFFN FFP^[F^?uFFFF nF9Fr^]UFFFFFF7F%PF%p[ PF%[ ÉFFF>.&u~tF%F FFF%F FFF5FFF5FFFF.& t)P^2[؊%t*~~$)Pvvv Pl FFFF%FP^2PQ FF-FF.& tF%FP^2P FF~$)Pvvv P FFFF^2FF)Pvvv^2P FF~~$)Pvvv P FFF^?uF_)PvPv^2PP F  =;^2<u3<~u<|u|<{ue<}uN<_u<\uhF~tF]U3+upkfa\WRFMKIGF2 ]UFFF HFFFF F F"vP]U ^GP^X+@FvVDDFF^GFA)P^_ ,&؊2PvFFPP^XPFFP FFF9F ^G;F}8)P^_ ,&؊2PvFFPP^XP P. ^G;F}]U ^GP^X+@FF^GF^_ ,&؊2P DD+FFP^7v+PFFP<FF^G;F}ʋ]U$PP$PYPq$PFF2 P[$PFF2 PE]U^GP^X+@ ^GP^_X+@&  ^t  FvTDD%%%F 9%~^t @%F%?.u% % 9%~ދ^G; ~  ^G^GP^[;}^G ^@%F% % 9%~^G P7 DDvv:^GP^[;|^GP^G[;~ v^[G^GP^G[;|^GP^G[;~ v^G[G^GP^GP$^t>$0s>$9vv DD%9%u @ ^GF%$$P$2PQ^G;} ^G%^GP^GP^G %t >$-uJ^GP^[;u(^t$P$2P ^-^G$PPC >$.t^uvvU v DDF$^G; ~  ^G^GP^[;}^G ^@%F% % 9%~}vv^G;}^G^GP^GP $PPQ $%t>$ s^u3>$s$>$r)P$2[؊%t $2$2$vDDFؠ$$P$2PZ ^G^GP^G[;h^GP^G[;u/^o^G %t^GP^GP 'v^[G^G^GP^GP S>$ u^G %t >>$u^G %t &>$ u^G %t >$ u^G %t>$u^G % t>$u^G %@t"%:$u^G %t"%G:$u^G %t"%G:$u^G %tm"%G:$u^G %tO"%G:$u^G %t1"%G:$u^G % t"%G:$t^G %@u"%G:$u^G %t"%G:$u^G %t "%G :$u^G %t .%8$t :%8$u$Ǡ/%8$t ;%8$u$v^[G^GP^G[;}^G^GP^GP %^GP^X+@@P^XH%^G;%|^%G^GP^GP? $PP"^GP^X+@HP^XH%^;%~ ^%G^GP^GP$PPZ^GP^[;u9^GP^G[;u$PP&^ov^G[G^o^GP^GP`>$u3$P P`^GP^GP7vDDF ^GP^G[;u$PP^o^GP^GPw^GP^G[;u$PPT^G^GP^GP6^GP^u^G[;t8^GP^G[;u$PPQ^Gv^[G4^u$vDDF؀? u$PP^G^GP^GPv^[Gv^G[G^GP^GP`^u$PP Fv^G[Gv^G[G^GP^GPvDD%^uD^GP^_X+@& HH''@FPF'['%9'}. H''@FPF'['%9'}ۋF% ^t~F%09%@%;  F% ^G; ~  ^G^GP^[;}^G ^vvm^GP^GP<vDD%F%)@+^u!^GP^_X+@& HFã- F -))P++[-9+v^t9%u @^G 9%} 9.^G; ~  ^G^GP^[;}^G ^- vv@^GP^GP$PP $2u t 1u^_]UVWF8rt >_^]UVWF~Nf F _^]UVWv~NF F PXPtQVV^YX_^]X F>& t16ã{WSގƾ<u[_2K>ztx sыSrC+ӃuRPP9{tX>w8&rtw2& t;6su &;ut'.u t3&u&.s t3mw&׊YQR>{OuTQ 'ZY_R >& uZZ|>|Pr|{>{r{ tWS&u6o[_&&Pެ؊}(X 'ˈ&r2& t1W_UVWmF0R< r 0C0P P u u#uR,XP uбt,ߎǿ6 u ǎg02 Aw&&6 t02 Awǎ߻tz'Ș؋xt ؊}>u PXZP X_^]UVWvV3%DD u`* 8*<*F% t% t=% u4EP(E P(# X tP+PPVP4*PVWDDFE2PhDDFEPP轩2=uFvE2PtV4$DDV#DD~uF`*8*<*f_^]UV FDVv?DD@[GVދFG[GFPvV+f^]UVv$DD u]~u+S%   t`* 8*<*9%tvvV#%tvvVh  vvV ^]UVW"=uzV5#DD@*P[؋ǃ~u (*Pve> u B.*PvL> u )PvV% t`*#8*<* _^]U+Pvv^]U+PvvJ]UPvv5]UvpDD]UVWvD%t,D?|DF2#VF2PCL`* 8*<*_^]UVWf!=uV"DD@*P[؋ǃ~u ~u (*Pv'= u a.*Pv= u HPvV$ t VG!DD+ P+PPE2P+PPPE2P_^]U+Pvv5]U+Pvv!]UPvv ]UFPv$P]UFPvv]UVW FDVދFG[GDFPvVIV+PGǍf_^]UVv DD u`* 8*<*]DPvv$bDPvv:%SD Pv!DDSP$DPD P$vv]$)`*8*<*BF =t=t=tׁ$DPM$+PPX t DPPP>$DP.$X[^]UPHPPv(]UVWFH+@VDD u+VW_^]UVWh*NjƋDP\X3 tPt DD+D;Fu;6h*tǡh*NjƋD;Fr;6h*uvDD u P% DD+_ʡh*NjƋDP\X3 t P DD+5D;Fr);6h*uvDD u P DD+_^]UVW^ƋDPF@[;w v[?fÉWD+F[GWE[GW[^?ދFGVD[GFh*D_^]UVWLLF?FfPĤDDƃu+5@RP+P@Pl"t"XZƉߋFGWE[GEP DDh*f_^]UVWF-ƋDP\X3 tP DDh*;r9r9r 9v;r;r(DⓋPEⓋ[;w>h*+lDⓋP[;uVG[GVD[GV[V[EⓋ;uWD[GWE[GW[5>h*+_^]UVWvVDDFH+@FP3DDF u+R^;t8;s GP[N~uFNjF OPN[N~uvvf_^]UVvDD uj% t+]% t`* 8*<*C% tvvV+%tF+SPvV=F+SPvV^]Z[YX[SPZ[YX+[SPUF UFF 3FFF tVV FV FtVVFV F Fu3FFFFVV VVQvvvvYYs$QvvvvOYYYF^VV VVFu"F^Ft ]YSPF^ZX[؃SPZ[YX;[u;uPZ[YX;[u;u+PUN ;N|N;Nwr4F ]+׸ҸUF f؋Ff؋FfډF^ ]UVWvFtt+PPXZF+Pvt t_X tpVVDD tD\%SPD \-%SP0}dž PF2-0[ÉFFF~0r~9vĿ~.u+FFF~*uv^ǃFFF. PF2-0[ÉNjFFF~0r~9vdž~lt~LuFFFFt(`PP PPV5 tt(`P+P PPV tt(`P+PPPV tPt(`P+PPPVu tv^Fv^2䈆ƆF2PWPVF2PWPV\F2PWPVtvF2P/zF2f^]UVWv~ v vFF   DP +PPN FFDP vvX t0VDD tvvV tF^+F^ D4PD%[ÉF~^F~u7 DPa D PZ nX tD PDPG M F^+F^ ~ uFDPP,XX!GFn^ FDPP XX9Fsv v+PPX tdv v+PPX tDPD PX tD PDPF^f_^]UVWv^%t |*P{DD~sFu"+P@PlƆ uƆP PF2䉆9s PP%+=u^ +8FPG[N~vwȃ~vF G+Íf_^]UVWv~v vFFDP+PPFFDPnX[% uDPWvvSX t'VJDD t=vvV t&D4PD%[ÉF%GPFF[n^ DPPXX9Fsv v+PPX uF^ u-DPD PX tD PDPF^FVFFv v+PPFFvv+PP|X t!PvvWvvVFVFPvvDPvv+PPnvv+PP\FPXvv+PPCXZǍDPD PX tD PDPvvvvX t F^+F^ F^ u F^VDD tvvV tF^+F^ iDPv vD4FGPFF[n^ v v+PPBX u֍DPD P,X tD PDP F^f_^]UVFF+0F^#*#* u*Pvvo!FP+P@PuF|`*8*<*f^]UP^XЙRP*P+]V+@*P[PP譆DD[V DDF|^UV@*PF[؋ƸP+PVVF[GDPPP P PDP^]UVWvr`* 8*<*+*@*P[؋Nj% u`* 8*<*+_^]+P PȄ8*r*]t*%+PP諄t*t*@'t*t*8*= t=1t="t=1t:7t*/-+r*="0t=" t="t=1t=1t=0t=0uz+PDP+>8*t>8*t t*+UVWvDD u%t+ۋq%@tDPD P>D2PYDDFDP#P讃vD2PqD0Pw+PPX[-F^%uvv+PPX uDP9vv5X t-v*DD tvvVf tDPvv+PPCD4ǍFG;~s=uDPD4+ÙRPJ DP+PPCDPF^SP+PPDPD PX tDPD PntD PDP`f DPRX[f_^]UVWv@*PF[؋FFWV t`*8*<*}t vE[G~u$?P@P t`*8*<*^G2PxDDF~u WPʁ~u^%tEWv詁F~u%^% uE %tWFP{v^G2P;~u`*8*<**~t~uF~+`*8*<*f_^]Z[w7ZYX[GUVV]UF^!F!^ ]UF^ F ^ ]UF^1F1^ ]UN^ F^ F]UN^ FYXZ[WYXZ[)WYXZ[!!WYXZ[  WYXZ[11WZYX['WZYX[oUVWv~v }~~ fuF~ et~ Eu@F ~ uF~~F F 2PvPP@Pv ~ fu WvVDDFH؀?.u FHF< t9vt VvFf_^]UF 2Pvvv']UF 2Pvvv ]UF 2Pvvv]UVWvF3=.u~)=eu$F@F9~sFFPG[ udG߀?uŋ+FHFG0FF;~F@NJF~5r*O=.uO߀?9v0=1s=.uH-1f_^]UVWv P+Pv P PF@P PFPVIƀ<:u,FPvt=u PFPFPƀ<*uP?PF@PFPF@PFP<.uC PFPFPƀ<*uP?PF P^FPF PFPS<;u) PFPFPƸPFPFP%+2< t< t<tf_^]UVWv~4GPu:P@@PӃ=uP+PP@PӃ=u@@P*PB +P@Pу=t@P*P ?PW u*PW{ uF*F4PPEyPWPF~u *PWMFPF2PvFP9DD@PbyDDFFPvvDDPWPoF~uWDD2<>u<DP\X+ÉF ~-vDPP:Ƀ9~tL`*8*<*HD%t|tD%tDDPDؙRPP̃DVD[G+f_^]UVWvD% uD%t L |u&D%uVPDD[G uLLD%tVPX[G$9u$%@t $PDDVD%tPDPPσ[G||uL0L DVD[GD2_^]UVWF F v~f _^]UWV+V Fu أ,+.+.F^ ;wr ;vr+v@6,+>.+^_]ÃF FF2n=uDu&t t =ut u Etu Eut+؉^TV@^ RPFXY؃㓇ҋʋV҃VR ҃R FFufVVVV 3FFFFFߋOOO/ }^FuNfVVVF2n=uDutuEu=ut=tC^5VPF=uDuNu Eu:tV2u Eun=tuD\LE]M;} FNFTVTVTVVF2͈NV+=5vdE]M5r֊͊ߊĴt NuFu%VN^FF tFn^^^^N6V+VN^FsڃVuNJ݊Ίs^4u N6vF^NV t;#y ؃u3u ԊKs]UEË\ݱxT}`LTD| <$   ֊tu"y؃33ҷt"ú"y@Bx"y"t -x@BËD-y-4|D$ \LU ֊͊ߊtEuDt]ENJ݊Ίu ]Mܓ3Dt̀24E3ۉ]]=t Dt]ËDEDEDEÁFsFuFuFF tFFF==|FtN2F4EF^NE] E%-D%-þB RPB BXZB R FFuþRs BuBuBFFGG uËGW/_uF ^VNNNð n3FtM]]ð3UVW؎~*ʋ~OvJsF_^]UVW؎~+ыv~tH@UVW؎~+ыv~t|&]awaawa:t밋W؎6*ыH_UVW+PPPPPvt< t< tN X[YZ_^]UVW؎N~vs_^]UVW؎~FNs_^]UVWv؎~F~ ī_^]UVW؎^vN ~s_^]û+VW؎6|*6Du6|OuA_^+_^ÃW؎Ў3FFFFF$@F F FFFFދ&?+t&?-uCD&C,0|1< -S-[DDtLE]M]_^UGGĀt- G-?% x0%GUPSQR]]]]0%G]MuXEM߃ـ?5r K?9v01E@E]MWV؎FFO|O;}IAAI0G+OI~.G ~0GIJuO=0tG^_ä.GI, Space to select; Press ^A(HELP), ^W (DO IT), Esc(CANCEL) ^A - Display this HELP screen^B - Display Special Effects Screen^P - Insert a blank line between current line and line above.^Q - Delete current line.^R - Center the text on the current line.^S - Copy lines.^T - Show current cursor position.^U - Display the menu screen as the user will see it.^V - Enter Special Characteristics.^W - Go to Assign Function Key Screen. ^E Cursor up one row ^X Cursor down one row ^F Cursor right ^D Cursor left ^O Insert space^C Cursor upper left^N Cursor bottom right^L Cursor to prior tab stopPress ENTER for Prior Screen; ^B to display Special Effects HELP ScreenPress ^W to continue The ^B key (Disable ENTER, ESC Options) disables the above functions 0 Press ENTER or TAB for next field, ^L for prior field ^A(HELP), ^B(Disable ENTER, ESC Options) ^W (Done), Esc(Prior Screen) or Press ^B to create file: ^Z(Move Commands) ESC(Exit Without Changes) ^Z - Move Commands display to top or bottom of screenDEL or ^G Delete character 72L f  F`uHc    3 Tr" ,Fh"2H:Q>TF]`oz)2@ $-6?GT Bj   6 p @"<(X(t(v(((h>  Z  |       6 u      - Z    . _      <      M   V#i{  \` 7 VX  !   HX EDITMENU cannot run on this terminal.    $%MENU.DATMENU.DAT(11> N01N %  (/ % OK !,-FGOK !,-FGEEEEEEEEEEE E   M   MM  ))$2 $ 2  xxxx %02d%02d%02d%d%2d%2d!!!!!"CprogramCON:LST:b*b* Raw I/O<>.,=:|[]* : unmatched quoteCannot open Cannot append Cannot create : No matchStack Overflow $C RTL - program not linked for Program terminating $ t/<+tHu^GtG3Ҡ.!3|uVGOr dursuy MAIN START PRINTMGRSTARMENUPMGRSTARSTARHELPPMGRPRINMAINHELPSMNUHELPPRINHELPPMGRDELEDELEHELPPMGRSUSPSUSPHELP   ',09AJNV[NYNNNN M START}~yM  DIGITAL RESEARCH INC ͻ|kJ ~y ~b=  ~y ~b < ~y ~bB  ~y ~b        ~y ~b         ~y ~b          ~yL ~y ~w   ~c    ~y ~w     ~c   ~y ~w      ~c  ~y ~w      ~c    ~y ~w     ~c ~y ~w     ~c ~y ~w   ~c    ~yL ~y MULTITASKING MULTIUSER OPERATING SYSTEM ͼP ~w}|k Ŀ Ŀ }Press~c[F10]}~w }Press~c[ESC]}~w } for menu }  }for command line}  }|k ĿNYNNNNAAAAAM  HELPFMTREEDREDIXCARDFILEPRINTMGR3NĿ}~c Concurrent Startup Menu ~w}N͵ Ŀ2  }F2} }--~gFile Manager ~w} 2  Ŀ2  }F3} }--~gTREE of subdirectories ~w} 2  Ŀ2  }F4} }--~gDR EDIX Editor ~w} 2  Ŀ2  }F5} }--~gCardfile ~w} 2  Ŀ2  }F6} }--~gPrinter Manager ~w} 2  Ŀ Ŀ"  }F1} }--~mHelp ~w}}Esc} }--~yExit this menu ~w}  " NĴ}~cTo switch windows, hold the Ctrl key down and press 1,2,3 or 4 on keypad~w}Nthis menu ~w}  " NĴ}~cTo switch windows, hold the Ctrl key NYNNNNMMMAMM  MAINHELPPMGRSTARPMGRPRINPRINTMGR STATUSPMGRDELEPMGRSUSP%NĿ}~c Concurrent Printer Manager ~w}N͵N }~b _M a i n M e n u _ ~w} Ŀ6  }F2} }--~gStart The Printer Manager ~w} 6  Ŀ6  }F3} }--~gPrint File(s) ~w} 6  Ŀ6  }F4} }--~gPrinter Manager Status ~w} 6  Ŀ6  }F5} }--~gDelete A Job ~w} 6  Ŀ6  }F6} }--~gSuspend/Stop Printer Manager ~w} 6  Ŀ Ŀ  }F1} }--~mHelp ~w}}ESC} }--~yExit this menu ~w}   N ~w} 6  Ŀ Ŀ  }F1} }--~mHelp ~w}}ESC} NYNNNNMO SMNUHELPPRINTMGR START:NĿ}~c Concurrent Printer Manager ~w}N͵N }~b _Start Multiple Printers _ ~w}N  Ŀ5  }F2} }--~gSpecify Printer Numbers ~w} 5 N N  Ŀ Ŀ  }F1} }--~mHelp ~w}}ESC} }--~yExit This Menu ~w}   N  >PRINTMGR START Ŀ Ŀ  }F1} }--~mHelp ~w}}ESC} }--~yExit This Menu ~w} NYNNNNM AAAAAM  STARHELPPRINTER=0!PRINTMGR START 0PRINTER=3!PRINTMGR START 3PRINTER=1!PRINTMGR START 1PRINTER=4!PRINTMGR START 4PRINTER=2!PRINTMGR START 2STARMENU(NĿ}~c Concurrent Printer Manager ~w}N͵N }~b _Select Printer To Start _ ~w}N N  Ŀ Ŀ  }F3} }--~gPrinter 0 ~w}}F4} }--~gPrinter 3 ~w}    Ŀ Ŀ  }F5} }--~gPrinter 1 ~w}}F6} }--~gPrinter 4 ~w}    Ŀ Ŀ  }F7} }--~gPrinter 2 ~w}}F8} }--~gMultiple Printers ~w}   N N N N  Ŀ Ŀ  }F1} }--~mHelp ~w}}ESC} }--~yExit This Menu ~w}   NN N N N  Ŀ Ŀ  }F1} }--~mHelp ~w}}ESC} }--~yExit This Menu ~w} FNYNNNN NĿ}~c Concurrent Printer Manager ~w}N͵N N } Select the command that corresponds to the printer(s) you want }} the Printer Manager to use. To tell the Printer Manager to use }} more than one printer, select command F8. }}L }} Consult the Concurrent User's Guide for more information on how }} printer numbers are assigned.) }N N N N N N N N N  Ŀ-  }ESC} }--~gExit this menu ~w} - Nsigned.) }N N N N N N N N N NYNNNNMO PRINHELPPRINTMGR PRINT1NĿ}~c Concurrent Printer Manager ~w}N͵N }~b _Print File(s) _ ~w}N  Ŀ4  }F2} }--~gSpecify File(s) To Print ~w} 4 N N  Ŀ Ŀ  }F1} }--~mHelp ~w}}ESC} }--~yExit This Menu ~w}   N  >PRINTMGR PRINT Ŀ Ŀ  }F1} }--~mHelp ~w}}ESC} }--~yExit This Menu ~w}  (NYNNNN NĿ}~c Concurrent Printer Manager ~w}N͵N } The Concurrent Printer Manager enables you to print one or more } } files while you use your computer for other work. The following } } command summary provides guidance on using the Printer Manager. } } For more information, consult the Concurrent User's Guide. } N } Start The Printer Manager Tells Concurrent which printer(s) } }$ to use; must be used before files } }$ can be printed with Printer Manager. } } Print File(s) This command is used to print files. } } Printer Manager Status This command tells you what files } }$ are printing or waiting to print. } } Delete A Job Stops a file from printing. } } Suspend/Stop Printer Manager This command stops the Printer } }$ Manager, and gives you the option } }$ of keeping your print files. } N  Ŀ.  }ESC} }--~gExit This Menu ~w} . N option } }$ of keeping your print files. } N  Ŀ.  }ESC} }--~gNYNNNN ENĿ}~c Concurrent Printer Manager ~w}N͵N } Select command F2 to tell the Printer Manager which printers you }} want to use. Then you can enter the numbers of the printers you }} want the Printer Manager to use, separated by spaces. }N } For example, to use printers 0 and 1:" }}~m 1. Press F2 from the Start Multiple Printers screen. ~w}}~m 2. Type: 0 1 and then press ENTER. ~w}N } The phrase "PRINTMGR START" which appears at the bottom of the }} Start Multiple Printers screen can be entered directly from the }} command line to start printers. See the Concurrent User's Guide }} for more information on using the Printer Manager from the }} command line.: }N N  Ŀ.  }ESC} }--~gExit this menu ~w} . N Nnager from the }} command line.: }N N  Ŀ.  }ESC} }--~gExit this menuNYNNNN NĿ}~c Concurrent Printer Manager ~w}N͵N } Select command F2 to tell the Printer Manager which files you }} wish to print. Then you can enter the names of the files to }} print, separated by spaces., }N } The Start The Printer Manager command must be used before any }} files can be printed using the Printer Manager. }N } The phrase "PRINTMGR PRINT" which appears at the bottom of the }} Print File(s) screen can be entered directly from the command }} line to print files. This is a "shortcut" way to print files }} using the Printer Manager. See the Concurrent User's Guide }} for more information on using the Printer Manager from the }} command line.: }N } There are several options you can use to control th  e printing. }} See the Concurrent User's Guide for more details. } Ŀ.  }ESC} }--~gExit This Menu ~w} . N See the Concurrent User's Guide for more details. } Ŀ.  }ESC} }--~gExit This Menu ~w}NYNNNNMO DELEHELPPRINTMGR DELETE.NĿ}~c Concurrent Printer Manager ~w}N͵N }~b _Delete A Job _ ~w}N  Ŀ3  }F2} }--~gSpecify Job To Delete ~w} 3 N N  Ŀ Ŀ  }F1} }--~mHelp ~w}}ESC} }--~yExit This Menu ~w}   N  >PRINTMGR DELETEĿ Ŀ  }F1} }--~mHelp ~w}}ESC} }--~yExit This Menu ~w}  NYNNNN mNĿ}~c Concurrent Printer Manager ~w}N͵N } Select command F2 to tell the Printer Manager the number of the }} print job to delete from the Printer Manager. Then you can }} enter the number of the print job to delete. Print jobs can }} only be deleted one at a time.) }N } You can find out the number of a print job by using the }} Printer Manager Status command.( }N } The phrase "PRINTMGR DELETE" which appears at the bottom of the }} Delete A Job screen can be entered directly from the }} command line to delete print files. This is a "shortcut" way }} to delete print files. See the Concurrent User's Guide for }} more information on using the Printer Manager from the command }} line.B }N N  Ŀ.  }ESC} }--~gExit This Menu ~w} . Ner Manager from the command }} line.B }N N NYNNNNMAA SUSPHELPPRINTMGR TERMINATEPRINTMGR RESETNĿ}~c Concurrent Printer Manager ~w}N͵N }~b _Suspend/Stop Printer Manager _ ~w}N N  Ŀ7  }F2} }--~gSuspend The Printer Manager ~w} 7  Ŀ7  }F3} }--~rStop The Printer Manager ~w} 7 N N N N N N N  Ŀ Ŀ  }F1} }--~mHelp ~w}}ESC} }--~yExit This Menu ~w}   NN N N N  Ŀ Ŀ  }F1} }--~mHelp ~w}}ESC} }--~yExit This Menu ~w} NYNNNN :NĿ}~c Concurrent Printer Manager ~w}N͵N N } Both the Suspend and the Stop commands stop the Printer Manager }} from printing. The difference is that the Suspend command will }} "preserve" your print files so that when the Printer Manager is }} re-started, the files will continue printing. The Stop command }} removes the print files from the Printer Manager and shuts the }} Printer Manager off.3 }N N N N N N N N N  Ŀ.  }ESC} }--~gExit This Menu ~w} . Ner off.3 }N N N N N N N N N  Ŀ.  }ESC} }--~gExit This Menu ~w}NYNNNN M START}~yM  DIGITAL RESEARCH INC ͻ|kJ ~y ~b=  ~y ~b < ~y ~bB  ~y ~b        ~y ~b         ~y ~b          ~SS||Xَэ&HPG3ɋUVN]010486Concurrent V5.0COPYRIGHT 1986, DIGITAL RESEARCHXXXX-0000-654321CSEG patch areaUPP ]UPP]UPFP]U Pv]U Pv]UPFP]U PP]UPv]U^G G PS]UPvo]UPv_]UPvO]U^G G PS6]U!Pv&]UPv]U$Pv]U PFP]U6$<t]àP]UHPvSPFs]UNv~]UOPP< r@P΋^P u@Y"s"^:t:sOOP P뷠O]UFF<v\P<tLFF]UQG"Jsf^:4v]VP^^?u P^rP^?u\P>^!^? tQ^ ^ PQ]UmPPz&& &mQPg&- "R$Rу>"w@"sb$ƍP\P<t\P$PP)$ƀ$uRRs."$눸P>"sRs\P;$PP]US>u >u>uSS:w#À t S,uƇ SuSS:r@SP t@Y"sS֊S.u 0TƇ TTS>S wPQSÍP)Su۠TSUWXUu@W"r uVUP< u@YP[u@Z"Pu@Z"P>V r@P>S r@Z"Z"s@`v{s SSUVöֈUVuSS< wXsWHU[u;SȱÀ uSȢSSƇ[USXUFGHI8SwVV< rÀ[uoCuHVÀEu I.S@VÀNtVÀLu FG͠VÀ uSV VsS]UPZ>Zw PPZƍPZu[(-0. PP\P\P<u PPLLQ\P <t@Y"rZ>Zr@L"sƊZuL֊Z/tYLъZ/t@"s SZY׀>YuLsZ,0P(YSZY>Y r@L"ZP u@Z"sO`v{s (Y(YZƈ6ZZY녠Lr\P P}P(ƍPfP~P(ƍ@PL(Z(@(1uo[.-.=sLs\P:YP>P>(*(9*w, PsP*ƍP*s 6Z,ZP<[ PP\P\P\P.w@"s.*㍇P\P<tLȁ..*,*H9,w,㍇P\Pl<t%\PAZ\P\P0ZPP,sJ\P0$uL>tLMPL-8Lr286Lу>6w@"s.2㍇P;\P<tLȁ.6242H94w4㍇PMP<t%MPMP_\PPP4sJ\Pc0u::B:<:r<ƀ$u<Ɗ:tsV3P>us&P<>w s P3PTPB1u3P P> wƇ u$ P<ƍPPP}B<Ɗ:s@<@s3PVP6P]UD>1uS À uꠕ,2ÍP2ÍP2Ê>t   >1t>1u2Ƈ Њ"rDƀ$u08t0ÍPP>t PDƍP0ÍPI00s 00<wÀ t[u 1D&sDƊ:rD sXD@PDƍP}PPDƍ@P~PDƊK0>1u2Ê]U:Fr@L"sE3PLLs:w YPuꠝÍP]U P60Ls 3PeLLs\P5<t\PKP\PwL]ѠL"P\Q<t@Y"sѠKȢ<v@"r<uLЊL"P>r@P/t@Y"Y"s%Se˷S[먀>u Ƈ$LЊ"s6> uGs 3P1L6A>vPF KUPsPHPW3PtPHPƇ39>tFs5P]UL3<t<2s PP4JqHs]àIs]ð PP\P\P>uY\P=\P>u6Fs5P2>qu0P3Rq8qu0QbQB<u1 $Requires Concurrent 3.2 or better to run.$HELP HLP HELP UTILITY V2.0 At "HELP (Enter topic, ESC to exit)> " enter topic {,subtopic}... EXAMPLE: HELP (Enter topic, ESC to exit)> DIR EXAMPLES $? HELP HELP Topic:$Not found$No HELP.HLP file on the default drive.$ t/<+tHu^GtG3Ҡ.!3|uVGOr dursuy ACTION_KEYS 8087 &[APPEND /5EXAMPLES: >zATTRIB BEXAMPLES OAUX RnBACKUP UcBANK Y_BATCH ^tCALL g2ECHO jEXIT o*FOR p>GOTO u;IF yPAUSE |aREM ~~SHIFT BREAK 0CARDFILE {CCONFIG.SYS CD %CHDIR QCHKDSK zCHSET lEXAMPLES CLS }COPY -OPTIONS $COPYMENU CPM EXAMPLES: kCUT&PASTE DATE ^DEL DIR JDISKCOMP eEXAMPLES: 3DISKCOPY 7DOS_PROGRAMS"DREDIX GDSKMAINT ~FORMAT eEDIT_KEYS iEDITMENU 4EMM 7"ERASE C;ERAQ G`FDISK L2FIND NCFILEMANAGER SzCHANGEDIR lCOPY sOCOPYDISK DELETE VDIRECTORY NDRIVE lFORMAT lHELP YPRINT +RENAME RUN gSETUPSYSTEM oATTRIBUTES YCHECKDISK LOADFUNCKEYSPSYSTEMDISK !nSUBSET #^TYPE ,RFREE_MEMORY 3#FM 4jFORMAT 5FLOATDRIVE FFUNCTION K$ASSIGN Z*SAVE hWSWITCH nwHELP trHOWTO? ~wLABEL HLIMSIZE ]LOADSYS KMD eMEMSIZE MKDIR VMORE AMULTIUSER PASSWORD *EXAMPLES: OPATH |PIFED 6PRINTER :PRINTING *PRINTMGR >PROMPT PREDIRECTION dREBOOT ":RENAME #HREPLACE +)EXAMPLE: 6RMDIR 9|RUNMENU @CSCEPTER CSET LKSETPORT QCONFIG vOPROTOCOL ~.SETUP CLOCK LMDISK aDISK MLOAD MOTOR KSETTLE TSTEP ]UNLOAD DHARDISK MAXMEM JPARAMS 7SCROLL CMULTIUSER >MULTIPORT CONFIG kFEATURES vSERIAL 7PORTSET kLIM sHI-MEM *SYSDAT GUPDATE VERIFY ,SHOW WSORT ?EXAMPLES STOP # SUBST 9pEXAMPLES: @0SUSPEND B'TIME K:TOUCH PTREE VeTYPE ZhVER _RVERIFY `EVOL c>WINDOW edWMENU tiXCOPY TEXAMPLES: PXDEL EXAMPLE: =XDIR gEXAMPLES: $ \..\$ t\wo$ %1 $ reta$ ear.$ ot "///1ACTION_KEYS The following table lists special Concurrent keys and their function. Key Function Ctrl-Break Stops the currently running program; also stops output to the printer following a Shift-PrtSc. Ctrl-C Same as Ctrl-Break. Ctrl-Del After window manager is loaded, makes a switched-in window jump to full screen. When you press Ctrl-Del a second time, the window returns to its former size and location. You can use Ctrl-Del while you are in an application program or at the operating system level. Do not confuse Ctrl-Del with Ctrl-Alt- Del, which causes a system reset. See HELP topic, WMENU, to learn how to load the window manager. Ctrl-I Same as the TAB key. Ctrl-O Stops video output to a window until another keystroke is entered. Any program running in that window continues to run. Ctrl-P Turns on/off echo of screen output to the default printer. Ctrl-+ When the Concurrent status line is displayed, Ctrl-+ (note: the + key on the keypad, not the top row of the keyboard) brings you to the WMENU main menu so that you can make changes to your windows. Ctrl-+ works whether you are in an application program or at the operating system level. The window manager must be loaded before Ctrl-+ takes effect. See  HELP topic, WMENU, to learn how to load the window manager. Ctrl-Q Restarts screen output after a Ctrl-S. Ctrl-S Pauses the screen output. The program also pauses if it is trying to output to the screen. Ctrl-1 Switches to window 1. Typed using the numeric keypad's '1' key. Ctrl-2 Switches to window 2. " " " " " '2' key. Ctrl-3 Switches to window 3. " " " " " '3' key. Ctrl-4 Switches to window 4. " " " " " '4' key. Shift-PrtSc Takes a snapshot of the switched-in window and sends it to the printer. Prints full-screen size window. You cannot switch windows while the Shift-PrtSc function is printing. See also the help topic: EDIT_KEYS. ///18087 Syntax: 8087=ON 8087=OFF Explanation: The 8087 command allows EXE and COM programs to use the 8087, 80287, or 80387 co-processor. 8087=ON signals Concurrent that a program requiring the co-processor is going to be started. 8087=OFF signals Concurrent that no co-processor is available. The default setting is 8087=OFF. The 8087 command is necessary only for DOS 80x87-dependent programs. See the CHSET command description for more information on running 80x87-dependent CMD programs. To allow a program to use the co-processor, type the following: A>8087=ON Concurrent checks to see if the co-processor is present in your computer. If it is, the command prompt is returned to the screen. If it is not, the message 8087 not installed is displayed. The 8087=ON command allows co-processor use for the current window only. If you run an 80x87-dependent program from two windows, you must enter 8087=ON from each. ///1APPEND Syntax: APPEND [/X] APPEND d:path [;[d:]path] APPEND [;] Explanation: APPEND enables Concurrent to look in other specified directories for files that it can't find in your current directory. It is similar to the PATH command: PATH is used when you want Concurrent to search for .COM, .EXE, .CMD and .BAT files. APPEND is used when you want Concurrent to search for other types of files. The two main forms of the command are: * APPEND followed by the option /X * APPEND followed by pathnames APPEND with /X Before you enter an APPEND command to specify a search path, you can issue APPEND with the option /X. This causes APPEND to work with Concurrent utilities that use the Search First, Find First, and Exec functions. Use this option with care, as it can lead to problems when used with certain applications programs. Note also that before you use BACKUP you should cancel the APPEND search string by entering APPEND ; APPEND with Pathnames APPEND followed by pathnames is used to specify a search path. Once typed in, APPEND specifies where Concurrent looks for files if it can't find them in the current directory. You can specify several search paths provided each is separated by semicolon (;), and provided the total length of the APPEND command is no more than 128 characters. To return to the default value of no search path, type A>APPEND ; Warning: Some applications cannot use the APPEND command; you will find that they read files successfully from directories other than the current directory, but they can only create files in the current directory. This results in two copies of files: an edited version on the current directory and the unedited version left unchanged on the original directory. ///2Examples: The following command sets up a search path such that if Concurrent can't find the file you want in your current directory, it looks in the directory c:\spreads\cashflow. A>APPEND c:\spreads\cashflow The following example extends the search path so that Concurrent also looks in the directory \oldones on the A: drive A> Append c:\spreads\cashflow;a:\oldones ///1ATTRIB Syntax: ATTRIB [/H] [+|-A] [+|-R] [+|-S] filespec [/P] [/S] Explanation: ATTRIB displays a file's attributes, and can be used to switch the attributes on or off. The attributes included are the  archive, read- only and system attributes. The archive attribute shows that a file has been modified. It can be switched on or off by both ATTRIB and XCOPY. XCOPY also has an option that uses the archive attribute to decide which files to copy (see the XCOPY explanation). The system attribute, when switched on, prevents DIR from displaying the file and COPY from copying it. It's used for the Concurrent system files that you don't need to see in everyday use of the computer. (Note: XCOPY has an option that allows you to copy system files.) A file that is set to be read-only can't be erased, renamed, copied or altered in any of the normal ways. Setting a file with the read-only attribute should protect it from being inadvertently altered. However, the REPLACE, TOUCH and XCOPY commands all have [/R] options that allow you to alter read-only files. The ATTRIB options are as follows: /H  Displays help information. +A Sets the archive attribute (-A switches it off) +R Sets the read-only attribute (-R switches it off) +S Sets the system attribute (-S switches it off) /P Pauses after each screenful in a long display /S Sets the attributes in the subdirectories derived from the current directory. ///2Examples A>ATTRIB +A *.NEW The above example switches on the archive attribute for all the files with the extension .NEW in the current directory. You could then use a command like XCOPY /M to copy all the files marked for archiving. A>ATTRIB -R *.BAS /S This example switches off the read-only attribute from all the files with the BAS extension in the current directory and any associated subdirectories. ///1AUX Syntax: AUX [n] Default: AUX=0 Explanation: AUX displays or selects the Auxiliary device (AUX:) for the current window. If you use the AUX device in your applications, you can set it to use either COM1: (AUX=0) or COM2: (AUX=1). Several windows can share the same AUX setting, but only one at a time may actually use the device. ///1BACKUP Syntax: BACKUP Explanation: The BACKUP utility is used to 1) copy files from a hard disk to floppy diskettes, and 2) restore files on a hard disk partition from BACKUP-created floppy diskettes. Files may be selected by directory and/or date. If the restore operation tries to overwrite a read-only file, an error message is generated and the file is NOT restored. Use ATTRIB to set any such files to read/write for the restore operation to be successful. ///1BANK Syntax: BANK [ON|OFF] Default: BANK=ON Explanation: Displays or sets the value of the ok-to-use-banked-memory switch, which controls whether expanded (banked) memory can be used for subsequently- executed DOS program(s) in the current window. Use OFF for DOS  programs that do not run correctly in banked memory. If you do not have hardware that supports memory banking, or have not installed the SCEPTER program--which initializes banked memory routines--this option has no effect. The PIFED command can also be used to override the BANK setting for a particular .COM or .EXE program. ///1BATCH Explanation: BATCH files are files containing a list of Concurent instructions that Concurrent executes automatically once you run the BATCH file. The principles and special commands used in creating BATCH files are described below. Batch files all have the .BAT file extension. When creating a BATCH file, you can use variables as a part of the commands to be executed. Then the command invoking the BATCH file can contain the actual values for the variables. Thus, you can create general purpose BATCH files. See the Reference Guide for details. Batch files can also retrieve and use environment variables such as "os" (defining the operating system); "ver" (the current version number) and "path" (the current path). The environment variable names should be surrounded by % signs and quotation marks when used in batch files. The built-in commands that are used to control the flow of a BATCH file are CALL, ECHO, EXIT, FOR, GOTO, IF, PAUSE, REM and SHIFT. ///2CALL CALL allows a batch file to load and run a second batch file.  The subcommand format is: CALL [d:][path]filename CALL subcommands can be placed at any line in the batch file. You can even use CALL to make a batch file call itself - though you need to be careful to avoid creating an infinite loop. ///2ECHO Syntax: ECHO [ON|OFF] ECHO Default: ECHO=ON Explanation: ECHO is used to echo messages to the screen and to turn BATCH file command echoing on and off. When BATCH processing is first started, ECHO mode is set to ON, meaning that the BATCH commands are displayed as they are processed. Use ECHO from inside the BATCH file if you want to turn the command echoing off, and to display messages on the screen when echo is off. ECHO is also useful from the command line to echo Ctrl-characters to the screen. You can prevent ECHO itself from being displayed by preceding ECHO with the @ symbol. ///2EXIT Exit allows you to terminate the batch program before you reach the end of  the file. The command format is simply EXIT ///2FOR FOR allows iterative execution of a command. Each filename in the set is sequentially substituted in the command following DO. Wildcard * or ? characters are valid for members of the set and all matching filenames on the disk are substituted in the command. Only one FOR command can be used on a command line. Path names are not accepted with filenames in the set. The format is: FOR %%variable IN (set) DO command If you enter this command: FOR %%f IN (myprog.asm acct.bas acct2.bas)DO type %%f The three specified files are each typed to the screen in turn. ///2GOTO GOTO transfers control to the line following a label within a BATCH file. The GOTO label causes the commands on the line after label to process. To set up a label in a batch file, use a colon (:) in column 1 followed by a character string. The first eight characters of the string are considered  the significant characters, and they must be different from those of all other labels. The format for GOTO is: GOTO label ///2IF IF allows conditional processing of DOS commands within a BATCH file. The DOS command executes when the IF condition is true. When the condition is false, the DOS command is ignored and the next command executes. The IF format is: IF [NOT] condition command The condition is one of the following: * ERRORLEVEL number * string1==string2 * EXIST filespec NOT condition is true if the condition is false. ///2PAUSE You can insert a PAUSE subcommand in a BATCH file to pause the processing of the file. The pause allows you to display a message or let an action occur, such as changing disks or aborting the file. The PAUSE subcommand takes the form: PAUSE [remark] ///2REM Use REM to display a comment on your screen during BATCH file execution. REM takes the form: REM [remark] ///2SHIFT SHIFT allows BATCH file command lines to access more than 10 (%0 through %9) replacement variables. Execute the SHIFT command to get past the tenth parameter on the parameter list. The parameters on the command line are shifted one position to the left; the parameter in %1 position moves to the 0% position. Each shift command moves all the parameters to the left by one more position. ///1BREAK Syntax: BREAK [ON|OFF] Explanation: BREAK when switched ON allows you to stop a running program by pressing . The program will then stop the next time it tries to call any DOS function. If BREAK is OFF (the default value), you will only be able to issue a when the program you want to stop is performing standard input or output operations such as printing or outputting to the console. If you type BREAK on its own, you will see the current BREAK value. BREAK only affects DOS programs. ///1CARDFILE Syntax: CARDFILE [COLOR] Explanation: CARDFILE is a simple program that you can use to store and retrieve name, address, and phone number information. Use the COLOR option if you are using a color monitor and wish to have the display in colored text. ///1CCONFIG.SYS To install character, disk, and memory drivers into Concurrent, a CCONFIG.SYS file must reside in the root directory of the boot disk (A: if booting from a floppy or C: if booting from a hard disk). This is an ASCII file created with a word processor which includes the names of device driver files which are to be installed into Concurrent. For example, if the name of a floppy disk driver file to be installed is FLOPPY.COM, CCONFIG.SYS should include the line: DEVICE=FLOPPY.COM If the name of a fixed disk or memory-disk driver is WINNIE.SYS, CCONFIG.SYS should include the line: FIXED-DEVICE=WINNIE.SYS If the name of a banked memory driver is EMM.SYS, CCONFIG.SYS should include the line: EMM=EMM.SYS or: EEMM=EMM.SYS CCONFIG.SYS also supports the COUNTRY command, which enables Concurrent to set country-specific information such as date format. Identify your country to Concurrent by typing the international dialing code for your country - for example 001 for the US or 044 for the UK. The default value is COUNTRY=001 ///1CD See the help topic: CHDIR. ///1CHDIR Syntax: CHDIR [d:] CHDIR [d:][\][dirname][\dirname...] CHDIR fd:=[d:][\][dirname][\dirname...] Abbreviation: CD Explanation: CHDIR provides access to subdirectories on DOS media. The first form (above) displays the specified (or default) drive's path -- the sequence of subdirectories that lead to its current directory. Use the second form to change the specified drive's current directory to the last subdirectory in the path. The third form is used to assign floating drive (fd:) to the subdirectory  of the specified drive. Once assigned, you can refer to it as a "normal" drive (i.e. use the first & second CHDIR forms), or re-assign it. Examples: A>cd n:=c:\subdir1\subdir2a A>cd n:..\subdir2b A>cd c: A>cd ///1CHKDSK Syntax: CHKDSK [d:] [option] Explanation: CHKDSK checks the integrity of disks and can then be used to correct any corruptions that are found. If you don't specify a drive the default drive is checked. CHKDSK supports the following options: /B Bad block option. This option reads through all the files to check for bad spots on the disk. /D This option will try to locate all directories on the disk. After a major disk corruption it is used by a sophisticated user to restore individual files and directories using a disk editor. /F Fix option. This permits CHKDSK to write fixes back to disk. Unless this option is specified, no modification is made to the disk, even if errors are found. /L Rebuild cluster links. This option is useful if the file allocation table (FAT) has been overwritten with garbage. It attempts to rebuild the FAT information for as many files as possible. The corrupted areas of the disk must be zeroed before this option can be used. /R Recover root directory. This will recover lost directories that were located in the root directory. This option is useful if the root directory has been corrupted. You must first remove the garbage in the root directory. /V Verbose option. This displays extra information while CHKDSK is running. It may be useful when you are trying to locate bad spots on the disk. ///1CHSET Syntax: CHSET [HELP] CHSET [d:]filename[.CMD] CHSET [d:]filename[.CMD] [field=setting[,field=setting,...]] Explanation: CHSET is a command that allows you to make changes in the command header of a program file with a .CMD file extension. CHSET has five fields that you can display or change. The three fields and their possible settings are: 8087 - The 8087 field has three possible settings: ON, OFF, or OPT (optional). Specify ON for programs that require an 8087 processor in order to run. Choose OPT when you have a program that can use an 8087 if it is present in your system, or emulate an 8087 if it is not present. Specify OFF if you want to cancel a previous ON or OPT selection. SUSPEND - The SUSPEND field has two options, ON or OFF. When you select ON, CHSET modifies a program's command header so that Concurrent suspends that program's operation when it occupies a switched-out window. MPMLOCK - Use this flag only on an MPM application that needs to use shared multi-user reading of locked records. This field is either ON or OFF. BANK - The BANK field is ON by default, which indicates that the program can be run in Expanded (Banked) Memory. Turning it OFF forces the program to load in the non-banked memory, if it is available. The command header also indicates the compatibility attributes. These are defined as attributes F1' to F4' of .CMD files, and they provide a mechanism to modify some of Concurrent's file security rules. This facility is needed because some programs developed under earlier Digital Research operating systems don't run properly under Concurrent. Most of the problems occur because the programs were designed for single-tasking operating systems where file security is not required. For more details see the Programmer's Guide. Changing Field Settings: You can change any or all of CHSET's fields in a single command line. To change a setting for a field or fields, enter a CHSET command with a filespec and the fields you want to change. For example, if you type B>chset calc.cmd [8087=opt,suspend=on] CHSET modifies the command header of the program contained in the file CALC.CMD. Displaying Field Settings: When you enter a CHSET command with a filespec and no field settings, CHSET displays the settings for the specified file(s). For example, if you type A>CHSET PRINTMGR you will see the following display for the PRINTMGR command: CHSET.CMD [8087=OFF, SHARED=OFF, SUSPEND=OFF, MPMLOCK=OFF, BANK=ON] Modifying a command header is not a trivial matter. While CHSET cannot harm your .CMD files, inappropriate use of it can cause your programs to behave  in incorrect ways. To get a brief explanation of CHSET and a list of examples, type: CHSET [HELP] or CHSET ///2EXAMPLES Examples: A>chset taxaid.cmd [8087=opt,suspend=off] The above command modifies the command header of a program called TAXAID so that it can use an 8087 if it is present in the system or emulate an 8087 if it is not present. The command also turns off the SUSPEND field for TAXAID, so that TAXAID can run when it is in a switched-out window. The inclusion of the .CMD filetype is optional. A>chset * The above command displays the current settings for every CMD command file in the current directory. CHSET does not accept a filespec of *.* because it accepts only a blank filetype or filetype .CMD. B>chset badprog [bank=off] The above command modifies the command header for a program called BADPROG so that it will not load into banked memory. A>chset rectify.cmd The above command causes CHSET to respond with a display of the current settings of the fields in RECTIFY.CMD's command header. A>CHSET OLDPROG [F1=ON, F3=ON] This command specifies a combination of compatibility attributes set in OLDPROG's command file. ///1CLS Syntax: CLS Explanation: CLS is used to clear the current window. It is often used in batch files to start with a fresh screen. See CCONFIG.SYS. ///1COPY Syntax: COPY[/opts] source[/opts] [destination[/opts]] COPY[/opts] source[/opts][+source[/opts]...] [destination[/opts]] Explanation: This command copies one or more files between disk drives and other devices. The source and destination can be any combination of files with optional drive/path specifications, or devices, such as CON (the screen/keyboard). If the destination is omitted it is assumed to be the current drive and path. The source file name(s) are unchanged unless the destination contains a new filespec, not just a drive and/or path. The source name can include wild-card characters (* and ?) to copy multiple files, as can the destination name to allow renaming of files as they are copied. Multiple source files can also be specified separated by pluses (+) to join them together into a common destination file. Typing COPY without arguments enters a prompting mode where you can type one or more copy commands without reloading COPY.EXE each time. To exit, enter an empty line. Copy recognizes passwords in the file specifications. ///2OPTIONS Copy's options are specified by preceding the letter or number with a slash (/). Those options that affect files will affect the adjacent file (on the left) as well as all the remaining files (on the right) unless a conflicting option is specified to override it. The options are as follows: /A Ascii -- copies the file in ascii mode: source files are read up to, but not including, the first ^Z; destination files get   a single ^Z appended to the end of the file. /B Binary -- copies the file in the binary mode: source files are copied in their entirety; destination files are left as exact copies of the source. /C Confirm -- prompts the user for a Yes/No confirmation as to whether each file should be copied. If combining multiple files in groups, confirms the group by first source name only. /R Real-time -- set the destination files to the current (real) time instead of the source's time/date. /S System -- include system files in the file copy. /V Verify -- verify the copy by checking the written data. ///1COPYMENU Syntax: COPYMENU [source-menu [destination-menu [-M | menuname[,menuname...]]]] Explanation: COPYMENU is used to copy one or more menus between menu files, and to reduce the size of your menu file after editing. COPYMENU will prompt you for any or all information left off the command line. Use the special menu name, -M, in place of a list of menu names to indicate copying all menus from the source to the destination. If you use the menu prompting form, the destination menu must already exist. If you specify the source and destination menus on the command line, the destination menu will be created if it does not exist. For example, to copy all menus from MENU.DAT to a new file, NEWMENU.DAT, you could use one of the following commands: copymenu menu.dat newmenu.dat -m copymenu menu.dat newmenu.dat main,menu1,menu2,menu3,menu4 copymenu menu.dat newmenu.dat In the last case, COPYMENU will prompt you for the menus to copy. ///1CPM Syntax: CPM Explanation: The CPM command is a data transfer utility for CP/M files and media. When the CPM command is running you can use all the Concurrent commands involved with accessing files such as DIR, ERASE, COPY and TYPE. When you copy a file from a CP/M disk to a DOS disk (or back again), the CPM command will ensure that the data is in the right format for each disk. Batch files can be run from the CPM prompt, but you can't run applications programs: the CPM command is only designed for data transfer. If you want to process information stored on CP/M media, you need first to copy the data onto a DOS disk and then run the application from the Concurrent prompt in the ordinary way. The USER subcommand can only be run from the CPM prompt. USER switches the current CP/M user number. User numbers in CP/M range between 0 and 15. The EXIT subcommand takes you back to the Concurrent prompt. ///2Examples: In the following example the CPM command is started, the default drive is changed to B and the current user number is changed from 0 to 7. A>CPM [CP/M] 0A> [CP/M] 0A>B: [CP/M] 0B>USER = 7 [CP/M] 7B> The example below assumes the CPM command is already running, and that a CP/M disk is in drive A: and a Concurrent DOS disk is in drive B: The example shows how to copy all the files from A: to B: The files will be converted to DOS format as they are written to B: [CP/M] 0A>COPY *.* B: ///1CUT&PASTE You can use WMENU's WRITE option to "cut" information out of a window into an ASCII text file. Then you can use the application's facilities for reading in ASCII files. ///1DATE Syntax: DATE [mm-dd-yy] DATE [dd-mm-yy] DATE [yy-mm-dd] Explanation: The DATE command is used to display or set Concurrent's internal date. It is a good idea to set the date each time the computer is started or reset. To be prompted automatically, include the DATE command in your START001.BAT file. To change the date, replace mm with a one- or two-digit number from 1 to 12 indicating the month, dd with a one- or two-digit number from 1 to 31 indicating the day, and yy with a two- or four-digit number indicating the year. The date format selected by Concurrent depends on the COUNTRY entry in the CCONFIG.SYS file. Example: DATE 5-11-65 ///1DEL See the help topic: ERASE. ///1DIR Syntax: DIR [d:][pathspec\][filespec] [/D|/S|/A][/L|/W][/P|][/R|/C] Explanation: By default DIR displays the names of directory files (/D) in the current or specified directory in a long format (/L). The /S option displays system file names only. The /A displays all files. The /W option displays the wide format without size, time, and date display. The /P option causes DIR to pause when the screen becomes full. Using the /R causes dir to remember the specified options as the new defaults. The /C option changes the default options without displaying a directory output, which may be used to set your favorite options in the STARTnnn.BAT files. Wildcard characters are allowed in the filespec. The following examples assume default options: Example:  Display: ------- ------- A>DIR all directory (non-system) files on A: A>DIR B: all non-system files on B: A>DIR C:\WORK/S all system files in directory WORK A>DIR *.CMD/S all system files with type CMD on drive A: A>DIR C:\WORK\MYFILE/A files named MYFILE (with any type) in dir WORK A>DIR C:A* all non-sys files starting with A on drive C: A>DIR/W PROGRAM. the file named PROGRAM (no type) in wide form A>DIR/A/C (sets the default dir to All files) A>DIR B:.TXT/A all files with the type TXT on drive B: ///1DISKCOMP Syntax: DISKCOMP [d: [d:]] [/1] [/8] [/V] Explanation: DISKCOMP compares two entire diskettes - for example to check that a DISKCOPY operation has worked correctly. If you specify DISKCOMP with no drives, DISKCOMP will assume the current drive. If you don't specify two drives, DISKOMP will prompt you to swap diskettes as necessary. The options are: /1 This compares only the first side of the diskettes, even if the diskettes are double-sided /8 This compares only eight sectors per track, even if the first diskette contains more sectors per track. /V This verifies that the whole disk can be read. ///2Examples: A>DISKCOMP This compares the first diskette in drive A with a second diskette in drive A, and prompts you to change diskettes where necessary. A>DISKCOMP a: b: This compares the diskette in drive A with the diskette in drive B. ///1DISKCOPY Syntax: DISKCOPY source-disk destination-disk Explanation: DISKCOPY copies the entire contents of one disk to another. The source and destination drives must be specified on the command line. For instance, to copy a disk in drive A: onto a disk in drive B: you would enter the command DISKCOPY A: B: The destination disk does not need to be formatted. Note, though, that any existing files on the destination diskette will be destroyed by the copy operation. It is possible to copy a diskette using only one diskette drive. For single drive copies, you are prompted to first insert the source diskette and then later the destination diskette. It is advisable to put a write protect tab on the source diskette to prevent erasure if it is accidentally inserted at t he wrong time. ///1DOS_PROGRAMS Refer to the "Running Applications under Concurrent DOS" supplement for a description of some DOS applications that run under Concurrent DOS. ///1DREDIX Syntax: DREDIX [filespec] Explanation: Use the DREDIX command to start the DR EDIX text editor. DR EDIX enables you to create and edit text files. You can get online help while using DR EDIX by typing Alt-H or by pressing function key F7. Press Alt-X to exit from DR EDIX. ///1DSKMAINT Syntax: DSKMAINT Explanation: When DSKMAINT is invoked, the menu displayed offers these options: F3 Verify a disk: Use this option to check a disk for unreadable sectors. F5 Copy from one disk to another: Use this option to duplicate the contents of one disk to another. F7 Format disks: Use this option to prepare new disks for use or to reformat used disks. Use the Esc key to go back to the previous menu. If a verify, copy, or format operation is being performed, Esc aborts the command and returns you to the previous menu or prompt. ///2FORMAT The first menu prompts for the drive on which you want to format. The second menu displays the various types of diskette which can be formatted in the selected drive. DSKMAINT works with the following drives: 1 Single sided, single density 5 1/4" drive (180Kb) 2 Double sided, single density 5 1/4" drive (360Kb) 3 Double sided, 5 1/4" 'hyper' drive (1.2Mb) 4 Double sided, single density 3 1/2" drive (720Kb) 5 Double sided, double density 3 1/2" drive (1.44Mb) DSKMAINT works with the following permutations: A 180Kb drive can format 180Kb diskettes for DOS or CP/M. A 360Kb drive can format 180 and 360Kb diskettes for DOS or CP/M. A 1.2Mb drive can format 1.2Mb diskettes for DOS. (It can also format 180Kb diskettes for DOS and 360Kb diskettes for DOS or CP/M. However, you may not be able to use some of these diskettes in a 180 or 360Kb drive.) A 720Kb drive can format 720Kb diskettes for DOS. A 1.44Mb drive can format 720Kb and 1.44Mb diskettes for DOS. ///1EDIT_KEYS The Editing Keys are used when entering commands from the command line or entering lines into some application programs that use the standard operating system call for an edited entry. Ctrl-A Move backward to the start of the previous word. Ctrl-D Move forward one character. Ctrl-E Recall the previous line from the history buffer. Moves "upward" in the buffer from newest to oldest. End-of-buffer is an empty line. Ctrl-F Move forward to the start of the next word. Ctrl-G Delete the character under the cursor. Ctrl-H Delete the previous character (Same as the Backspace key). Ctrl-J Like Ctrl-M, except that the line is NOT saved (Same as Ctrl-Enter). Ctrl-K Delete from the current cursor position forward to the end of line. Ctrl-M End the current line, saving the line in the history buffer if needed. May be used from any position in the line (Same as Enter). Ctrl-Q Move to the start of the line. Ctrl-R Turn search mode on/off for the current line. Search mode finds only those lines that match the character(s) to the left of the cursor. Use Ctrl-E & Ctrl-X to move through the matching entries, or type more characters to match. After entering the line, search mode reverts back to the default set by Ctrl-_ (normally OFF). Ctrl-S Move backward one character. Ctrl-T Delete forward to the start of the next word. Ctrl-U Delete backward to the start of the line. Ctrl-V Toggles between insert and overstrike mode. The current mode is remembered for future line editing. Initially ON. Ctrl-W Move to the end of the line. Ctrl-X Recall the next line from the history buffer. Moves "downward" in the buffer from oldest to newest. Ctrl-Y Delete the entire line, saving it if it is new (or edited). Ctrl-\ Enter the next typed character without special interpretation. For example: to enter a Ctrl-G, type Ctrl-\ Ctrl-G. Ctrl-_ Toggle the default search mode on/off. Normally, search mode is OFF for each new entry. Pressing Ctrl-_ will set the default mode to ON and set the current search mode ON also. Thus, at the start of the next line, search mode will be enabled unless Ctrl-R is used to turn it off temporarily, or Ctrl-_ is used again to turn the default off. ///1EDITMENU Syntax: EDITMENU [filespec] Explanation: EDITMENU is used to create a new menu file or to edit an old one. Starting editmenu without a filespec edits the default menu file, MENU.DAT. You can use editmenu to create, change, copy, or delete menus within the menu file. See the Concurrent Reference Guide for a detailed explanation of the usage of EDITMENU. ///1EMM These letters stand for Expanded Memory Manager. Expanded Memory is that memory installed in your computer which functions under rules set down by the Lotus-Intel-Microsoft (LIM) memory specification, or its superset, the AST-Quadram-Ashton-Tate (AQA) specification (also known as "Enhanced" Expanded Memory). An Expanded Memory Manager is a software program which allows Concurrent and other programs to access the extra memory. Concurrent XM makes very efficient use of AQA memory, but must have an EMM installed into the system to do so. This is done by inserting the name of the file which is the EMM into a file named CCONFIG.SYS. The latter file must reside in the root directory of the boot disk, and will be loaded automatically when Concurrent begins. Concurrent's default EMM is called EMM.SYS. See CCONFIG.SYS. A memory board conforming to the AQA specification is most efficiently exploited by Concurrent, because its special memory may form the area used for application programs, and Concurrent may quickly "bank" that memory in or out of context. This means that several large programs, none of which know of the existence of the special memory, may run concurrently with Concurrent managing the memory hardware. For Concurrent to operate in this way, memory in your machine from address 0 to 256k should be comprized of "normal" memory, and memory from 256k to 640k should reside on the AQA board. ///1ERASE Syntax: ERASE [d:][pathspec\]filespec Alternate names: ERA, DEL Explanation: ERASE attempts to erase the file(s) specified in the filespec. The wild cards * and ? are used to specify a group of files to delete. Though the files are erased without prompting, erasing "*.*" will generate a single prompt to make sure this is what you want to do. Any unerasable files are listed along with an error. Examples: A>ERASE DRAFT.BAK A>ERASE C:\WORK\LETTER.* A>ERASE D:*.BAK A>ERASE B:*.* ///1ERAQ Syntax: ERAQ [d:][pathspec\]filespec Alternate name: DELQ Explanation: ERAQ erases a file or group of files as ERASE does, except you are prompted for a yes/no answer before each deletion. Answering Yes will delete the file. Use it with wildcarded filenames to selectively delete a group of files. Example: A>eraq b:*.DOC B:TEST.DOC (Y/N)? y B:THESIS.DOC (Y/N)? n B:JUNK.DOC (Y/N)? y B:POEM.DOC (Y/N)? y A> In the example, the user instructs ERAQ to delete all th e files except for B:THESIS.DOC. ///1FDISK Syntax: FDISK Explanation: The FDISK command allows you to prepare one or more hard disks for Concurrent DOS and to prepare a hard disk with partitions. See the Reference Guide for a full description of FDISK in action. ///1FIND Syntax: FIND [/H] [/C] [/N] [/S] [/U] [/V] "string" filespec Explanation: FIND searches for a text string in a group of files and displays the lines containing the search string. Multiple files may be specified on the command line. If no files are specified FIND will read from standard input. The options are: /C Show only the total number of lines that contained "string". /N Display line numbers /S Search files in subdirectories that are derived from the current directory /U Case-sensitive search ("A" doesn't match "a") /V Display the lines not containing "string". ///1FILEMANAGER The File Manager takes the most common computer commands and lists them in a menu format. You can select commands from the menu by pushing a few keys, thus saving time and keystrokes. While you are in the File Manager, you can also enter commands directly at the command line prompt whenever you want to by-pass the menu system. The File Manager contains set up procedures for initially configuring your Concurrent system. When you invoke the File Manager, the Main Menu of the File Manager appears on your screen. It contains three parts: the command panel, object panel, and prompt panel. The vertical command panel lists the important Concurrent commands. When you invoke the File Manager, the cursor is always positioned at the top of the command panel, to the left of HELP. Use the keypad arrow keys or the spacebar to move the cursor up and down the list of commands. Only one command can be selected at a time. When the cursor points to the command you want to select, press Enter, and the cursor moves to the top of the object panel. Use the Tab key to move back and forth between the command and object panels without selecting a command. The horizontal object panel contains the files that the selected command can act upon. Use the keypad arrow keys or the spacebar to move the cursor from object to object (or file to file). When the cursor points to an item you want to select, press the Ins key. The item is then highlighted. You can select multiple items for some commands. Press Del to cancel a selection after you move the cursor to that item. Then the item is no longer highlighted. Press Enter to activate the command after you select all the items you want. You can use Enter to select just one item at the cursor position. If a command has already been selected, the action is executed; if not, you are prompted to select a command. You can press function key F4 to cancel all selections, if you wish to start over. After executing a command you can recall the same set of file selections for another command by using function key F3. You can press function key F1 while the cursor is in the object panel to display help on special keys used in the File manager. The prompt panel is the narrow horizontal box near the bottom of your screen. It contains a prompt line which describes the currently selected command and when necessary displays questions you need to answer to execute a command selected from the menu. If you press function key F10, the prompt panel displays a command line prompt where you can type a command directly, if you prefer to by-pass the menu system. The prompt panel also displays prompts for the next required action and it displays information about special function keys appropriate in your current context. (See FILEMANAGER HELP for a description of the function key definitions.) ///2CHANGEDIR The SIZE/DATE ON command allows you to switch back and forth between short and long directory displays. Before the command is selected, the short directory format menu is displayed. Select SIZE/DATE ON from the command panel and press Enter to switch to the long directory format. The short directory format can be viewed on the File Manager Main Menu. It is the default directory format. The long directory format lists the filename and extension, the size in bytes, and the creation date and time for each file displayed. As a result, fewer files can be displayed on the screen at one time with the long directory format (13 files versus 52 files on the short directory format). The dotted lines at the bottom of the object panel indicate that there are more items than fit on the menu. Use the keypad arrow keys or the End key to scroll the menu in order to view the additional files. ///2COPY This command allows you to duplicate one or more files and place them on a different drive, directory, or on one of the two preset directories in your Concurrent system. After you select the command, a new menu will appear and you will be prompted to select a copy destination. Then press Enter to execute the COPY command. The following table summarizes the commands for the COPY FILE(S) menu. Command Action HELP Offers help in using the COPY FILE(S) command. COPY TO A: Duplicates one or more files and places the duplicates on drive A. COPY TO B: Duplicates one or more files and places the duplicates on drive B. COPY TO C: Duplicates one or more files and places the duplicates on drive C. COPY TO D: Duplicates one or more files and places the duplicates on drive D. COPY TO DRIVE Duplicates one or more files and adds them to the  selected drive for drives other than A, B, C, or D. COPY TO DIR #1 Duplicates one or more files and sends them to Directory 1. Be sure to set DIR1 to the desired drive or directory destination first. COPY TO DIR #2 Duplicates one or more files and sends them to Directory 2. Be sure to set DIR2 to the desired drive or directory destination first. COPY TO DIR  Displays File Directory Menu and allows you to select another directory. Files displayed in the lower portion of the screen are the ones to be copied. COPY TO NEW NAME Duplicates one or more files with several options possible. A prompt appears for each selected file. The following options are available: new filename only, different drive and new filename, or different drive only (name remains unchanged). When you copy files to a drive, they are copied to the current directory. If the destination drive is the same as your current drive, or if the filename destination entered is the same as the filename source, the following prompt appears: Single drive copy (Y/N)? If you type Y, you are prompted to change disks during the COPY operation. If you type N, the following prompt appears: Copy aborted (Pres s Enter): This message also appears if you attempt to do a single drive copy on a hard disk drive or in a subdirectory on DOS media. The Copy to Drive option on the menu displays all the valid drives and allows you to select the destination drive you want. This operation is similar to changing drives. The way to copy one or more files to the same directory or drive is with Copy to New Name. This command allows you to enter a new filename and/or extension. A prompt appears for each selected file. The following table lists the function key assignments for the COPY FILE(S) menu. Function Key Action F1 Offers help for the COPY FILE(S) Menu. F10 Moves the cursor to the command line prompt in the prompt panel, allowing you to enter command lines directly to the system. Esc Stops the COPY FILE(S) operation and returns to the previous menu. ///2COPYDISK "Copy Diskette" copies the entire contents of one disk to another. A menu of drives is displayed to allow you to select the source drive containing the disk you want to copy. You are then prompted to select the destination drive containing the disk where the copy will be placed. Both the source and destination drives must be diskette drives (not a fixed disk). If not, you will be prompted to reselect the drive. You are then prompted by the DISKCOPY program to insert the source disk and then press RETURN. You are prompted to insert the destination disk that will contain the copy. If the destination disk is not formatted it will be formatted as part of the copy operation. Note that any pre-existing data on the destination disk will be destroyed. When copying disks in a single drive system, the potential for confusing disks and copying to the wrong disk is high. Be sure to pay strict attention to the prompts for the source and destination disks. You are strongly advised to cover the write-protect notch on the source disk before beginning the copy to prevent writing to the wrong disk. The "Copy Diskette" command requires that the DISKCOPY.COM program to be on the system drive. Type "DISKCOPY" for more information. ///2DELETE This command is used to delete one or more files. The erasure is permanent. After the command is selected and if no files are highlighted, move the cursor around the top of the object panel on the Main Menu to choose up to eight files you want to delete. Press Ins when the cursor points to the files you want to delete. When you press Enter, the prompt panel queries: ERASE, are you sure (Y=yes)? Type Y for yes or N for no. After you answer the prompt, press Enter again. If you select more than one file to be deleted, the prompt panel queries you sequentially until all selected files are deleted. The Main Menu is displayed without the deleted file(s). Press Esc to cancel the DELETE operation. However, after you answer Y to delete a file, it is too late to save the file by pressing Esc. ///2DIRECTORY The FILE DIRECTORY command allows you to select a different file directory from the one appearing on the currently displayed menu. After the command is selected, a new menu appears. On the object panel, the current directory is highlighted to show you exactly where you are relative to to other directory levels. Move the cursor around the list of directories to choose a new one. Press Enter when the cursor points to the file directory you want to select. The following table summarizes the commands for file directory menus. Command Action CHANGE DIRECTORY The cursor is at the current directory, which is highlighted. Move the cursor to another directory selection and press Enter. This will change the  current directory to the highlighted directory. HELP Offers help on FILE DIRECTORY selection. You can also press F1. VIEW FILES Allows you to display the files in a directory without selecting that directory. You can also press F2. SET DIRECTORY 1 Assigns the directory 1 key to the directory at the cursor position. You can also press F3. SET DIRECTORY 2 Assigns the directory 2 key to the directory at the cursor position. You can also press F4. ROOT DIRECTORY Changes the current directory to the root directory. The root directory is the main directory on a disk from which you can explore any other path of subdirectories on the disk. This command is especially convenient if you are several directories deep on a path and wish to explore another directory path. You can also press F9. MAKE DIRECTORY Creates and names a new DOS directory, then lists it on the FILE DIRECTORY Menu. The directory name cannot exceed 11 characters. This command requires DOS media. REMOVE DIRECTORY Deletes the selected DOS directory, provided that it is empty (that is, the directory has no files or subdirectories in it). This command requires DOS media. The following table lists the function key  assignments for the FILE DIRECTORY menu. Function Key Action F1 Offers help in using the FILE DIRECTORY Menu on the topic the cursor points to when you press F1. F2 Allows you to look at files in a directory without selecting that directory. F3 Sets the Dir #1 key to the directory at the cursor position. F4 Sets the Dir #2 key to the directory at the cursor position. F5 Selects Directory 1. Directory 1 is set in the FILE DIRECTORY Menu. After you press F5 and DIR1 is displayed, the function key assignment for F5 changes temporarily to DIR MAIN. This feature allows you to access the Main Directory by pressing F5 a second time. F6 Selects Directory 2. Directory 2 is set in the FILE DIRECTORY Menu. After you press F6 and DIR2 is displayed, the function key assignment for F6 changes temporarily to DIR MAIN. This feature allows you to access the Main Directory by pressing F6 a second time. F9 Moves you to the root directory. F10 Moves the cursor to the command line prompt in the prompt panel, allowing you to enter command lines directly to the system. Esc Returns to the Main Menu without changing directories. ///2DRIVE The DRIVE SELECTION Menu displays all the drives present on the Concurrent system. This menu allows you to select a different drive from the one on the Main Menu. After the DRIVE SELECTION command is selected, a new menu appears. Move the cursor around the top of the object panel under Select a Drive to choose a new drive. Press Enter when the cursor points to the file directory you want to select. The following table summarizes the commands for the DRIVE SELECTION Menu. Command   Action CHANGE DRIVE Allows you to select another drive. HELP Offers help on DRIVE SELECTION. VIEW FILES Allows you to display the directories in a drive without selecting it. It works the same way as the F2 key. The following table lists the function key assignments for the DRIVE SELECTION Menu. Function Key Action F1 Offers help in using the DRIVE SELECTION Menu on the topic the cursor points to if the cursor is in the command panel or object panel. F2 Allows you to display the files on a drive without selecting it. F5 Selects Directory 1. Directory 1 is set in the FILE DIRECTORY Menu. After you press F5 and DIR1 is displayed, the function key assignment for F5 changes temporarily to DIR MAIN. This feature allows you to access the Main Directory by pressing  F5 a second time. F6 Selects Directory 2. Directory 2 is set in the FILE DIRECTORY Menu. After you press F6 and DIR2 is displayed, the function key assignment for F6 changes temporarily to DIR MAIN. This feature allows you to access the Main Directory by pressing F6 a second time. F10 Moves the cursor to the command line prompt in the prompt panel, allowing you to enter command lines directly to the system. Esc Returns to the Main Menu. ///2FORMAT The "Format Diskette" command formats diskettes for use with Concurrent. A new menu is displayed containing the following entries. Command Action HELP Offers help on Disk Formatting. DATA DISKETTE Formats a diskette for use in storing data. SYSTEM DISKETTE Formats a diskette that is bootable (contains the system required when you power on or press Ctrl-Alt-Del). This diskette can also be used for storing data although it has less capacity than a diskette formatted with the "Data Diskette" command. LABEL VOLUME OFF Indicates that you will not be prompted for a volume label after the format is completed. If you select this command you will see it change to: LABEL VOLUME ON, indicating you will be prompted for a volume label after the format. The volume label is displayed by the dir command, identifying the diskette. The following table lists the function key assignments for the FORMAT DISK Menu. Function Key Action F1 Offers help in using the FORMAT DISKETTE Menu. Esc Returns to the Main Menu. When either the "Data Diskette" or "System Diskette" commands are selected you are shown a drive selection menu and prompted to select the drive containing the diskette to be formatted. You must select a diskette drive,  not a fixed disk drive, or you will be prompted to make the selection again. For the "System Diskette" command, you are prompted to insert a diskette containing the file CCPM.SYS required for system diskettes. This file will be on any existing bootable diskette. The "Format Diskette" command requires that the FORMAT.COM program be on the system drive or in the current directory. Type "FORMAT" for more info. ///2HELP The following describes special keys used in the File Manager. Key Effect Esc Stops any operation in progress/returns to previous menu. Tab Moves the cursor between command and object panels. Spacebar Moves the cursor to the next item. Ins Selects object positioned at the cursor and highlights it. Del Deselects the object positioned at the cursor. Enter Selects the object at the cursor and/or executes the command. Home Moves the cursor to the top left item in the list. End Moves the cursor to the bottom right item in the list. (Up Arrow) Moves the cursor up one item. (Down Arrow) Moves the cursor down one item. (Left Arrow) Moves the cursor to the previous item. (Right Arrow) Moves the cursor to the next item. File Manager Function Keys Function keys provide a shortcut to execute commands listed in the command panel. These keys are always assigned a task in the context of their menu.  Key Action F1 Place the cursor on a command and press F1 to get Help on that command. F3 Recall previous set of file selections. This is used for repeat operations (such as copying the same set of files to several disks). F4 Clear all file selections. F5 Display files in directory 1. F6 Display files in directory 2. Note: Directory 1 & 2 can be set in the File Directory Menu. F10 Command Line - this allows you to enter any Concurrent DOS command  line. File Directory Menu F2 View the files in the directory the cursor is on. F3 Set directory 1 to the directory the cursor is on. F4 Set directory 2 to the directory the cursor is on. Drive Selection Menu F2 View the files on the drive the cursor is on. ///2PRINT The PRINT FILE(S) command allows you to print a file on a printing device. After the PRINT command is selected, the files highlighted on the Main Menu are printed on your printer. You can switch to another window while the files are printing. PRINT FILE(S) does not offer any optional commands. During the printing operation, all keystrokes are ignored except for F1 (HELP) and Esc, which will cancel the operation. ///2RENAME The RENAME FILE(S) command allows you to change filenames but not their locations. After the command is selected and if no files are highlighted, move the cursor around the top of the object panel on the Main Menu to choose the files you want to rename. Press Ins when the cursor points to the files you wish to select. When you press Enter, the prompt panel queries: Rename (filename) to ? Type in the new filename and press Enter again. The Main Menu is displayed with the renamed file listed in the directory. The prompt panel queries you sequentially until all selected files are renamed. Press Esc to cancel the RENAME operation. If you press Enter when the new name is requested, you are returned to the Main Menu. If the selected file cannot be renamed (for example, if a file is Read/Only), the following message appears in the prompt panel: (Filename) is Read/Only, not renamed (Press Enter): ///2RUN The RUN A PROGRAM command allows you to run an application program from the File Manager Menu. After the command is selected, you are prompted to select one batch file or program. If no file is selected when this command is invoked, or if the file extension is not CMD, COM, EXE, or BAT, you are prompted with the following message: Bad filetype, only CMD, COM, EXE, or BAT files (Press Enter): If more than one file is selected, an error message is displayed. ///2SETUPSYSTEM This command contains the set up procedures for initially configuring your Concurrent system through the File Manager. SET UP SYSTEM changes Concurrent system parameters and disk maintenance procedures. This command requires that SETUP.CMD and/or other  utilities described in the following table be present on the system drive; otherwise, an error message is displayed. The most important function on this menu is "Copy to Sys Disk" which places programs on your system disk so that they are easily accessible from all drives and directories. In the table below, the CMD files in parentheses must be present on the system drive when you invoke the designated function. Some commands require that one or more files be selected from the object panel. Command Action COPY TO SYS DISK Copies selected files to the system disk and sets them to the system and Read/Only attributes. This procedure makes your files more accessible. SYSTEM ATTRIBUTES Allows you to set programs to the system and Read/Only attributes. If these programs exist on the system drive, they can be used on different windows at  the same time, independent of the directory you are in. LOCAL ATTRIBUTES Reverses the system attribute function, giving selected files the Read/Write and Dir attributes, which are necessary if you want to ERASE or RENAME files. LOAD FUNC KEYS Allows you to install a particular set of function key (FUNCTION.CMD) definitions. Only files of type PFK (programmable function keys) are accepted. See the FUNCTION command for more information. ASSIGN FUNC KEYS Allows you to set up function key assignments. The (FUNCTION.CMD) values are defined for the current work session unless they are written to a special file that can be loaded with LOAD FUNC KEYS. SERIAL PORTS Allows you to configure the serial ports COM1 and COM2. (SETPORT.CMD) SYSTEM DEFAULTS Allows you to set up certain parameters, such as (SETUP.CMD) function key assignments and serial port settings so that they are in effect each time you boot up your system. MEMORY DISK Creates a memory (virtual) disk in a reserved area of (SETUP.CMD) your Concurrent system memory that behaves like a fast disk drive. CHECK DISK Verifies the currently selected disk structure. This  (CHKDSK.CMD) command reports any errors or corruptions on the disk and allows you to correct them. For more information, refer to the User's Reference Guide. ///3ATTRIBUTES SYSTEM ATTRIBUTES allows you to set programs to the system and Read/Only attributes. If these programs exist on the system drive, they can be used on different windows at the same time, independent of the directory you are in. LOCAL ATTRIBUTES reverses the system attribute  function, giving selected files the Read/Write and Dir attributes, which are necessary if you want to ERASE or RENAME files. ///3CHECKDISK The CHECK DISK command verifies the currently selected drive and reports lost clusters. Lost clusters are data that is no longer associated with any file or directory, but which have not been properly erased. If lost clusters are found, the CHKDSK program asks you if you wish corrections to be written to disk. If you reply `y` (yes), lost clusters are placed in files in the root directory with the type .CHK. You can examine the files and either recover the lost data or erase them if desired. This command requires that the CHKDSK.CMD program be placed on the system disk and set to read/only and system attributes (see COPY TO SYS DISK). It invokes the CHKDSK command with the /F parameter. Type "CHKDSK" for more information. ///3LOADFUNCKEYS LOAD FUNC KEYS allows you to install a particular set of function key definitions by loading it. Only files of type PFK (programmable function keys) are accepted. FUNCTION.CMD must be present on the system drive when you invoke this command. ///3SYSTEMDISK COPY TO SYS DISK copies selected files to the system disk and sets them to the system and Read/Only attributes. This procedure makes your files more accessible as they can be invoked from any drive or directory. ///2SUBSET This command limits the group of files you see on one menu. SUBSET OF FILES allows you to look at only the files you are working with, rather than having to scroll your menu to see them all. When you are ready to select files for an operation, SUBSET OF FILES makes the selection process easier because there are fewer files to search through. This command displays the chosen group of files in the object panel only; it does not highlight them. Later, if you want to COPY FILE(S) from SUBSET OF FILES, for example, you still need to press Ins and Enter to execute the operation. After the SUBSET OF FILES command is selected, a new message appears in the prompt panel: Enter wildcard (? matches any character, *.* matches all): The question mark substitutes for any character, while the asterisk can match a whole sequence. After this prompt, if you type *.* or press Enter only, you will see all the files in the directory rather than a subset. If you select *.TXT, the top of the file display contains the message: Subset of Files = *.TXT ///2TYPE The TYPE FILE(S) command allows you to display the contents of one or more files on your menu. After the command is selected, a new screen appears. The files you select from the Main Menu are displayed on the screen, and the names of the files appear at the top of the screen. If the files do not fit within the screen, you are instructed to press Enter to view the next page. If more than one file is selected, the next file is displayed automatically after the first one has been typed. Press Enter at the end of the first file to begin typing the next file. After the last file, press any key to quit and you are returned to the Main Menu. To stop the operation before all files are typed, press Esc. If you press F1, the HELP Menu for File Manager TYPE FILE(S) is displayed. ///2FREE_MEMORY The File Manager uses the STOP program to display the currently running programs and the amount of memory used and free in the system. See the STOP command for full details. ///1FM See topic "FILEMANAGER". ///1FORMAT Syntax: FORMAT [d:] [option] Explanation: The format program will prepare new disks for use or reformat used disks. New disks must be formatted before they can be used to store files. Note: The format program completely erases all existing files on a disk. Before formatting any disk, make sure that it does not contain any needed files on it. The FORMAT options are as follows: Option Description /H Help option /S Copies Concurrent onto the formatted disk. This option can't be used with 160 and 180Kb disks because of their limited capacity. /V Allows a volume name to be given to the disk. /1 Forces single sided formats on a double sided drive.   (Only allowed on 5 1/4" drives.) /4 Forces single density. Use this to format single- density diskettes in a double density "hyper" drive. Note that diskettes formatted this way can't be reliably read by single density drives. /8 Formats 9 sectors but uses only 8 (only allowed on 5 1/4" drives). The default is to format 9 sectors and use all 9. /T:80 Sets tracks to 80 - used in conjunction with /N:9 /T:40 Forces double stepping on 80 track drive. (Only allowed on hyper drives.) /N:9 Forces 9 sectors per track. (Allowed on 3 1/2" 1.44Mb drives or 5 1/4" hyper drives in conjunction with /T:80 or /T:40. /N:8 Forces 8 sectors per track (on hyper drives in conjunction with /T:80). /B Formats 9 sectors but uses only 8. Reserves space for DOS system files. (Only allowed on 5 1/4" drives.) ///1FLOATDRIVE Concurrent allows you to use up to 25 drives, from A: to Z:, excluding L: (which Concurrent reserves for its own use). All the drives that are not associated with diskette, hard disk, and memory drives are free  to be used as "floating drives". A floating drive temporarily replaces a drive-and-path specification. For example, you could assign drive W: to replace C:\sub1\sub2\sub3. Then, instead of having to type out the path each time, all you need to enter is the floating drive letter. Floating drives remain assigned until you re- assign them or restart the system. ///1FUNCTION Syntax: FUNCTION FUNCTION [d:]filename[.PFK] Explanation: The FUNCTION command allows you to reassign the function keys and the keys used to switch windows. Entering just FUNCTION starts up the menu guided format. Including a filename by-passes the menus and sets the function keys to the values specified in the file. You can create such a file with the save option in menu mode. Function key assignments generally apply only to command line entries. Many Concurrent commands and application programs use function keys for their own purposes, superseding the user-assigned functions. When you exit some application programs, however, the function keys do not return to their original assignment. You should, therefore, save your default key assignments in a file and run FUNCTION with that file if you need to restore the function key settings. The following table describes FUNCTION's main menu options: Selection Description F3 Assign Function Keys: Select this option to display or change the  current function key assignments for those commands you use most often. F5 Save Function Keys in a File: Select this options to save new function key assignments in a file. F7 Change Window Switching Keys: Select this option to change the key combination used to switch windows. All function key assignments take effect as soon as you exit the FUNCTION command and affect the current window only. They remain in effect until you turn off or reset your computer. If you want to save your assignments, use option F5 from the main menu. If you want these settings to take effect when you start Concurrent, you can save the current window's settings with the Save System Parameters option of SETUP. ///2ASSIGN When you select the Assign option, the first page of function keys (F1 thru F10) are displayed. You can press the Return key to view each of the three pages of function keys in succession, or press any of the definable function keys (even if it is not on the current page) and it will be highlighted and cleared, ready for entry. To make an entry, type it exactly as you want it to appear when used. Use the backspace key to edit the entry if needed. Be sure to include a return if you are entering a command you want executed without further input. It will display as \0D as you press it. When you are satisfied with the command, press Ctrl @ or enter \00 to conclude the entry. You can then select another function key or exit. For example, if you want to define a function key to display all the files on the current drive, you could select function key F1, type the word DIR/A then press the key and then Ctrl-@ to end. If, on the other hand, you wanted Concurrent to wait and let you specify which drive to list, you would put a in place of the . Note that when you press the spacebar during function assignment  that it displays as \20 instead of a literal space. In fact, all Ctrl chars (plus space) display as their hexadecimal equivalents preceded by a backslash. To actually enter a backslash, enter \5C. The maximum length for each of the 10 main function keys is 20 characters long. All other function keys have a maximum length of four characters. Press Esc to return to the main menu. Make sure you have ended your function key editing first, or you will enter the Esc into the definition. See the topic FUNCTION SAVE on how to save your function keys. ///2SAVE After you have made your command assignments, you use the SAVE option to record your assignments in the file of your choice. If you do not save the assignments either in a file or through the SETUP command, they will be lost when you turn off or reset the computer. The default filename is KEYS.PFK. If you want to choose your own, press F3 and type the filename of your choice. The PFK file extension remains on the screen and there is no cursor. Press Return or period to end the entry. After you have decided on the name, press the F5 key to save the file. To recall the entries in the future (or for another window) use the command: FUNCTION where is the filename you chose, with or without the .PFK extension. ///2SWITCH This option lets you change the keys used to switch windows. This is needed when an application you are running uses the defined window switching keys for another purpose. The entire range of combinations is shown on the screen. The current key combination is indicated by the flashing arrow. Notice that option F2 allows you to change windows by pressing the numeric keypad key only. All other options require the use of the numeric keypad key in combination with one or more other keys. To select an option, press the associated function key and Esc. This returns you to the FUNCTION main menu. The current assignment is saved in the SAVE FUNCTION KEYS option (main-F5). It is not saved by SETUP. ///1HELP Syntax: HELP [topic] [subtopic1 ... subtopic8] [[NOPAGE|LIST]] Explanation: Typing just "HELP" displays the list of topics you can choose from to see summarized information about Concurrent commands. Including the optional topic/subtopics on the command line will go directly to the desired information. Once running HELP, type either a topic name or, after cho osing a topic, type a period and a subtopic name to view the desired information. Two or three letters is usually enough to identify the topics. After the summarized information for your topic, a list of any subtopics is shown. o Enter ? to display list of main topics. o Enter a period and subtopic name to access subtopics. o Enter a period to redisplay what you just read. o Press the Enter key to return to the Concurrent system prompt. o the [NOPAGE] option does not pause at 24-line page-breaks o the [LIST] option removes extra lines between headings; use with Ctrl-P or redirection to print. o Press any key to exit a display and return to the HELP prompt. Examples: A>HELP A>HELP DIR A>HELP DIR EXAMPLES HELP>DSKMAINT HELP>.FORMAT HELP>DSKMAINT FORMAT ///1HOWTO? For help on performing the following tasks, consult the listed HELP topic: TASK HELP TOPIC Back up hard disk files BACKUP Check on free space on a disk SHOW Copy diskettes DISKCOPY, DSKMAINT Copy files COPY, XCOPY Create a memory drive SETUP MDISK Define function keys FUNCTION Delete a file ERASE, ERAQ Edit command-line input EDIT_KEYS Execute a series of commands BATCH subcommands Format diskettes FORMAT, DSKMAINT Print files PRINTING Read a file TYPE Recall previous commands EDIT_KEYS Rename a file REN See a directory of files on a disk DIR, XDIR Set baud rate for a printer or modem SETPORT, SETUP Set the date and time DATE, TIME Switch windows ACTION_KEYS Use passwords PASSWORD ///1LABEL Syntax: LABEL [d:] [Label] Explanation: The LABEL command allows you to create, modify or delete the label on a DOS disk. If no drive is specified the default drive is used. You will be prompted to type a label if you don't specify one at the command line. Example: A>LABEL b:maggie's This assigns the name "maggie's" to the disk in drive B. ///1LIMSIZE Syntax: LIMSIZE [nnnn] Explanation: LIMSIZE limits the amount of Expanded Memory available to an application, and can be used with either Concurrent DOS 386 or Concurrent DOS XM. (To limit the size of conventional memory, see the MEMSIZE command.) You will probably only want to alter LIMSIZE if you want to: * Make room on one window for a program with unusually large memory requirements. * Decrease the available memory space on other windows so that one window can have a very large memory allocation. Typing LIMSIZE without an associated number shows the current LIMSIZE on the current window. Note that all LIMSIZE values are rounded up to the nearest 16Kb. On Concurrent DOS 386, you can change the maximum LIMSIZE with the SETUP command. ///1LOADSYS Syntax: LOADSYS [ASK|INSTALL] Explanation: LOADSYS allows you to load Concurrent from the DOS command-line. You must have the CCPM.SYS file in the root directory,  and the LOADSYS.COM file on a DOS disk where it can be executed. To start Concurrent, first start DOS. At the DOS command prompt (e.g., C>), type LOADSYS and press Enter. You might find it convenient to place the LOADSYS command (or LOADSYS ASK) in DOS's AUTOEXEC.BAT file so that Concurrent starts automatically when your computer is started. The ASK option will prompt you if you want to load Concurrent. LOADSYS must be installed under Concurrent before it may be used under DOS. To install, type LOADSYS INSTALL. This installation is necessary to allow the program to work on a wide range of machines. An installed version of LOADSYS may not work properly on another computer. ///1MD See the help topic: MKDIR. ///1MEMSIZE Syntax: MEMSIZE [nnnn] Explanation: MEMSIZE limits the amount of conventional memory available to an application. (To limit the size of expanded (EMS) memory, see the LIMSIZE command.) Each Concurrent window has a default MEMSIZE set at the maximum possible MEMSIZE, around 512Kb. This provides sufficient room for applications to work and, since each program only takes up the amount of memory it needs, several programs can run concurrently on different windows. However, a few programs are designed to occupy all the memory that they can find. Such a program will occupy all available conventional memory and prevent programs working elsewhere. You prevent a program from occupying all available memory by specifying a lower MEMSIZE value for its window. Typing MEMSIZE without an associated number shows the current MEMSIZE on the current window. The startup value can be set from the Maximum Memory per Process option in the SETUP command. ///1MKDIR Syntax: MKDIR [d:][dirpath\]dirname Abbreviation: MD Explanation: The MKDIR command creates subdirectories on DOS media. DOS disks initially have only the one (root) directory in which files can be stored. If you want to further divide your file storage, you can use MKDIR in any subdirectory to create a new one. You can then use this new subdirectory in the same manner you normally use the root, with one difference: you will need to specify the directory name(s) that lead to the new directory in referring to the files, or in the CHDIR command to set your default directory. Directory names follow the same rules as file names: up to eight letter names and an optional three letter extension. MKDIR will create only one directory at a time, so all directories leading to the new one must already exist. For example, to create the subdir LEVEL4 on drive B: in the existing subdirectories B:\LEVEL2\LEVEL3 you could use one of the following: A>MKDIR B:\LEVEL2\LEVEL3\LEVEL4 or B>CHDIR \LEVEL2\LEVEL3 B>MKDIR LEVEL4 ///1MORE Syntax: MORE Explanation: The MORE command takes input from a standard input device and then displays it a screenful at a time. At the bottom of each screen (except the last) is the phrase Strike a key when ready. . . You can move to the next screen by pressing any key. ///1MULTIUSER Concurrent enables several people to use one computer at the same time. One person can use the computer keyboard while others can access Concurrent's programs and files via the computer's serial ports. Use the following steps to prepare Concurrent for multi-user use: 1. Connect a terminal to the serial port with a cable. Alternatively, you can have a modem attached to the serial port and call it with another modem and terminal. 2. Configure your terminal's baud rate, data bits, and other communications parameters. 3. Use SETUP's F7 command and follow the instructions to tell Concurrent which serial ports are being used for multi-user terminals. 4. To begin using the remote t erminal, leave SETUP and then reset your computer by holding down the Ctrl, Alt, and Del keys simultaneously. Each time Concurrent is started, you should see the Concurrent system prompt (e.g. C>) on your terminal. Concurrent DOS 386 will allow most programs to run on remote terminals. For Concurrent DOS XM, the basic rule is that the remote terminals can run programs that are not screen oriented, or those that can be installed for a terminal. If you have a TERM.DAT file which supports your serial terminal brand (the TERM.DAT from DRI is for a Zenith Z-29), you may run FM, RUNMENU, EDITMENU, and COPYMENU on your terminal. When running FM on a serial terminal, use space-backspace to move the cursor in the command panel. ///1PASSWORD Syntax: PASSWORD [/H] filespec [[/R][/W][/D][/P][/G]:password][/N][/S] Explanation: The PASSWORD command is used to assign passwords to files or paths. Passwords can be up to eight letters long. The options are: /R:password The password will be required for reading, copying, writing, deleting or renaming the file. /W:password You are allowed to read the file without giving a password but a password will be required to copy, delete or rename the file. /D:password The password will be required only for deleting or renaming the file. /P:password The password operates on paths instead of files. This means that each time you try to use the path you will be prompted for a password. The password levels R, W and D can't be assigned to a path. /G:password Set global default password. Concurrent remembers this default password and tries it against each password- protected file that you then try to access. /N: This option removes any password protection. It can also be used in combination with the /P and /G options: /NP removes password protection from a directory /NG removes the global default password /S The password operates on files and subdirectories associated with the current directory. ///2Examples: The following example assigns the password SUZE to the file eyesoff.let, and ensures that the password must be given before the file can even be read. A>PASSWORD eyesoff.let /R:SUZE The example below protects all the files with the .BAS extension in the \handsoff directory and in all the associated subdirectories. The level of protection is set at W; the files can be read but not copied, renamed, deleted or altered. A>PASSWORD c:\handsoff\*.BAS /W:SIMON /S The following example assigns the password WINSTON to the path c:\secret\top: A>PASSWORD c:\secret\top /P:WINSTON ///1PATH Syntax: PATH [dirpath][;dirpath...] Explanation: Path displays or sets the command search path. When you enter a command, Concurrent searches the current drive first for the requested command. If it does not find it, it checks each path listed in the current path until it finds the command, or runs out of directories to search. Multiple directories are separated with a semicolon (;). Each window has its own path setting. Examples: PATH C:\CDOS PATH C:\;D:\ PATH C:\SUBDIR1;C:\SUBDIR2;C:\SUBDIR3;M: ///1PIFED Syntax: PIFED [d] [path] filename [.exe|.com] [/T] [/R] Explanation: PIFED allows you to create or modify the Concurrent program information embedded in a DOS .EXE or .COM file. This program information allows Concurrent, for example, to allocate the correct amount of memory for the program, to prevent corruption of interrupt vectors and to stop other processes from accessing devices manipulated directly by a DOS process. The option /T causes PIFED to work in TTY (teletype) mode, which is useful for running PIFED on very simple serial terminals. The option /R removes header information that was previously installed in the file. When you run you run PIFED for a particular program, you will see a screen displaying the current Program Information settings. A message at the top of the screen will tell you whether program information has already been installed, or whether Concurrent is using default values. The default values will usually enable your .EXE or .COM file to run successfully, but you can often improve the performance of programs by changing the information settings. The headings on the screen are described below: Program name This is simply a reminder of the name of the program whose program information you are altering. Memory usage The memory usage defaults will probably not need to be altered. However, you may find that increasing the 'minimum memory required' enables the program to run more quickly. Similarly, if you know a program always allocates for itself more memory than it needs, you can reduce the 'maximum memory desired' and free some memory for other programs to use. Screen usage PIFED allows you to specify one of six different types of screen usage for your program. Refer to your program's documentation to decide which type of screen usage best suits your program. You can toggle through the available options when the cursor is at the 'screen usage' heading by either pressing the spacebar or typng the option number (0 to 5). The six types of screen usage are as follows: * Program has no special requirements (24 or 25 lines). Use this for programs that only write simple messages to the screen. You can choose for the program to use 24 lines (option 0) or 25 lines (option 1). Choosing the 24-line option allows the Concurrent status line to be displayed while the program is running. * Program uses ANSI escape sequences (24 or 25 lines). All programs that require the ANSI.SYS driver require at least this screen usage type, and may require the more complex usage types described below. * Program makes ROS calls (25 lines). Select this option for programs that make calls to the ROM operating system - again, refer to the program's documentation for this information. * Program directly writes to screen, makes ROS calls and uses ANSI escape sequences. This option, the default, is used for programs that write directly to screen. The program's documentation should inform you whether or not the program writes directly to screen - most do not. Options The other PIFED options are as follows: * Maths Co-processor option: This allows you to specify whether the program needs a maths co-processor. Since most programs don't need a maths coprocessor, the default is 'off.' * 'Program runs only in the foreground' option: This allows you to specify explicitly that a program runs only in the foreground. Note that if you specify 'no' here, your program may still be suspended when it is put in the  background because of the option selected at the 'screen usage' heading. (Note: this PIFED option overrides the SUSPEND command.) * 'Program may run in banked memory' option: The default here is 'Yes'. If you specify 'No', Concurrent cannot page the program in and out of conventional memory. (Note: this PIFED option overrides the BANK command.) * 'Program waits in idle loop' option: Some programs execute loops while they are idle and waiting for user input. This can be wasteful on computer processing time. Concurrent has the ability to look for a program using 'idle loops', and reduce the slice of time that it allocates to that program. However, other programs execute 'idle loops' while they are also doing something else (such as recalculating a spreadsheet), and you do not want Concurrent to look for idle loops in this case. If you are sure the program only uses idle loops when  waiting for further user input, you can set this option to 'Yes'. Otherwise leave it at 'No'. * 'Program makes direct access to ...': Some programs directly access the ports COM1, COM2, LPT1, LPT2 and LPT3. This can cause a problem if another Concurrent window is using the port. Setting the switch to 'Yes' for the specified port will cause Concurrent to check whether or not the port is being used when the program is started up. If the port isn't already being used, Concurrent will reserve the port for the program that directly accesses it. If it is being used, an error message will be issued when the program starts. * 'Program uses interrupt vectors...': The default values for interrupt vectors enable most programs to run under Concurrent. Increasing the range of interrupt vectors may enable you to run certain complex programs that write directly to the interrupt vectors. Decreasing the  range of interrupt vectors for a program that doesn't write directly to the interrupt vectors may marginally improve the program's performance. ///1PRINTER Syntax: PRINTER [n] Explanation: PRINTER displays or selects the printer device attached to the current window. Several windows can share the same printer, but only one process can use a given printer at a time. When you enter the PRINTER command without a number, the system returns the number of the printer assigned to the current window. To select a printer, enter the PRINTER command followed by the printer number to be attached. On IBM-compatible machines, Printers 0, 1 and 2 refer to the three possible PARALLEL which may be attached to your machine. Printers 3 and 4 refer to the printers which may be connected to the first 2 possible SERIAL ports in your machine. ///1PRINTING There are several ways to print a file using Concurrent. Here are some of the most common: 1. Use the File Manager PRINT command 2. Use TYPE and output redirection (tabs expanded to 8 spaces) 3. Use COPY to send the output to PRN: (no tab expansion) 4. Type Ctrl-P to send output to the printer. Then TYPE the file. 5. Use the Concurrent PRINTMGR command. ///1PRINTMGR Syntax: PRINTMGR command Explanation: PRINTMGR allows you to print one or more files without tying up a window. Before you can begin using it, you must start PRINTMGR with the command "PRINTMGR START n", where "n" is one or more printer numbers you want to use. For example, if you want PRINTMGR to use printer 0, type: PRINTMGR START 0 Once PRINTMGR is started, you can use it to print one or more files with the "PRINTMGR file" command where "file" is one or more file names you want to print. There are several options you can specify when you print files--see the Concurrent User's Guide section on the printer manager. Other PRINTMGR commands include: PRINTMGR STATUS lists all the print jobs and their status. PRINTMGR DELETE deletes a print job. PRINTMGR RESET stops the printer manager and deletes all print jobs. PRINTMGR TERMINATE suspends the printer manager until its restarted. PRINTMGR HELP prints a command summary. ///1PROMPT Explanation: This built-in command is used to change the command line prompt. By default, the prompt consists of the current drive plus a greater-than symbol. PROMPT  can be used to display several system parameters in addition to any character strings. PROMPT's meta-string characters (which follow a $ character) are: $ $ character t time d date p current directory v version number n default drive letter g ">" symbol l "<" symbol b "|" symbol q "=" symbol h backspace e escape character - carriage return/line feed ///1REDIRECTION Explanation: Concurrent has command-line redirection that can be used in conjunction with many of the non-menu utilities and applications. You can redirect input from a single file or device, and redirect output to a file or device. To redirect the input of a program, use the '<' symbol followed by the file/device name. To redirect the output, use the '>' symbol to create a new file, or the '>>' symbol to append the output to an existing file. Use either one for output devices. For example: TYPE FILE.TXT >PRN DIR/L/A >>DIR.OUT both redirect output. The first types the file FILE.TXT to the printer. The second appends the directory listing to the file DIR.OUT. ERASE C:\JUNK\*.* NUL COPY OUTPUT.FIL both input and output are redirected. The first will erase all the files in the subdirectory C:\JUNK without pausing for user entry IF the file YES.TXT has a "Y" in it. Output is thrown away by sending it to the NUL device. The second example uses COPY's interactive mode by sending it one or more commands in the INPUT.FIL, and keeping a record of the session in the file OUTPUT.FIL. ///1REBOOT Syntax: REBOOT Explanation: The REBOOT command is a synonym for Ctrl-Alt-Del, and performs a system reset. ///1RENAME Syntax: RENAME [d:][pathspec\]oldname [d:][pathspec\]newname Abbreviation: REN Explanation: RENAME changes the name of the existing file ("oldname") to a "newname". If you specify a drive/path for the old filename and no drive/path for the new filename, RENAME will rename the file(s) in the given drive/directory. However, specifying two different paths on the same drive (even a floating drive "path" if it points to the same drive) will move the file from the first directory to the second, and also rename it if you have specified a different name instead of "*.*". If the file specified by newname is already present in the directory, RENAME displays the message, Access denied. Examples: A>ren oldfile.dat newfile.dat ; renames oldfile.dat on drive A: A>ren b:oldfile.txt newfile.* ; renames oldfile.txt on drive B: A>ren c:\subdir\*.* c:\newdir\*.* ; moves all files in subdir to newdir ///1REPLACE Syntax: REPLACE [/H] filespec [filespec] [options] Explanation: REPL ACE copies selected files from the source to the destination. For example, you can select to copy only those files that don't already exist on the destination, or only copy files that have been changed since the last copy. The first file specification on the command line is the drive, path and name of the source files; the second filespec shows the drive and path of the destination. The options are: /H Displays help information. (Make sure no filespec is entered when you use the help option.) /A Only copy files that don't already exist on the destination. /H Don't ignore files with hidden or system attributes. /M Merge changed files on source with unchanged files on destination. /P Prompt before copying each file. /R Overwrite read-only files on the destination with fresh copies from the source. /S Look also in the subdirectories of the destination for files that match the filespec. /W Wait for disks to be changed before starting to look for the source files, and wait also before starting to copy them to the destination. ///2Example: The REPLACE option is especially useful for, for example, updates of software. Imagine you have a program called WCOUNTER.BAS in various subdirectories on your hard disk. Suppose further you make improvements to the copy of WCOUNTER.BAS in the \wordproc directory. You can copy the improved version of the file to all the other places in the hard disk by using the following command: C>REPLACE c:\wordproc\WCOUNTER.BAS c:\ /s ///1RMDIR Syntax: RMDIR [d:][pathspec] Abbreviation: RD Explanation: The RMDIR command removes a specified subdirectory (not the root) if it is empty of all files and subdirectories (except for "." and ".." which are not deletable). Copy any files you want to save out of the condemned directory and then ERASE all the files inside it. If the RMDIR fails even though it is empty, then at least one drive (or floating drive) in one of the windows is currently set to the condemned directory. Find and CHDIR the offending drive. If the subdirectory to be removed is not in the current directory, be sure that you specify the correct path leading to the directory to be removed. For example, this command erases the subdirectory SUB3 on drive A: A>RMDIR \SUB1\SUB2\SUB3 ///1RUNMENU Syntax: RUNMENU [menufile [menuname]] Explanation: RUNMENU starts the specified menu file. Including a specific menu name runs that menu first. If you don't specify a menu file, then the default file MENU.DAT is assumed, starting with menu MAIN. Pathnames are not allowed in the menufile name. ///1SCEPTER Note: SCEPTER is only used with Concurrent DOS XM. It is not supplied or needed with Concurrent DOS 386. The SCEPTER.CMD program is run at the beginning of a work session (immediately after loading Concurrent) to initialize the memory banking routines in the operating system. For SCEPTER to have an effect, the banked memory DRIVER must have been previously installed (see EMM or CCONFIG). To convert the maximum amount of program memory into banked memory, SCEPTER should not be run within a BATCH file. SCEPTER is the key to enabling Concurrent's powerful banked memory manager, which will allow ALL programs, even those written without knowledge of banked memory, to use this special memory. Some programs may be incompatible with the banked memory software and hardware, and SCEPTER should not be run prior to running those applications. SCEPTER need not be explicitly executed. If your CCONFIG.SYS file contains the command "EEMM=EMM.SYS" instead of "EMM=EMM.SYS", SCEPTER will be run for you by Concurrent immediately after the EMM driver (EMM.SYS) has been loaded and initialized. ///1SET Syntax: SET [name=[string]] Explanation: Use SET to examine or change the environment strings associated with each window. SET with no parameters will display the current window's environment strings. Specifying only the "name=" will remove the corresponding NAME=string from the environment. If both the name & string are specified, name is converted to upper-case and the NAME=string combination is inserted into the environment space, replacing any previous occurrence of NAME. Examples: set set appdir=d:\ set oldvar= ///1SETPORT Syntax: SETPORT SETPORT parameter-list Explanation: Use SETPORT to configure COM1 or COM2 for a single Concurrent session. Changes made with SETUP are NOT preserved for the next time you restart Concurrent; if you want to save values for COM1 or COM2, use SETUP instead. Use SETUP also to configure any serial ports that are added to your system with a multiport expansion card. Before you run SETPORT, decide what devices you are going to connect to the serial ports. Find out what the devices' data-transfer characteristics are. Refer to the manuals provided with these devices, and do any configuration they require first. Then run SETPORT and select characteristics for each port that correspond to the characteristics of the devices to be connected. If you have no serial ports, and you invoke SETPORT, the following message will be displayed: No serial communications options installed. SETPORT has two modes of operation: menu-driven and command line. If you start SETPORT with command-line options, no menus are displayed. Instead, the options you specified are used to modify the serial port settings. This method is very useful in a BATCH file. Entering SETPORT alone displays the main menu summarized below. If your computer does not have both serial ports, the menu will be customized to reflect only the port you have. If you have a multiport expansion card, the menu will also be customized, because you will only be able to use SETPORT on COM1. F3 Port Configuration: Use this option to display and change the port parameters for both serial ports. The definable parameters are as follows: Baud rate: the number of bits input or output per second Word length: the number of bits in each word Parity: the use of odd, even, or no parity Stop bits: the number of stop bits appended to to each word F5 Port 0 Protocol: Use this option to set port 0's input and output communication protocol. F7 Port 1 Protocol: Use this option to set port 1's input and output communication protocol. All changes are implemented immediately, but only remain in effect until you turn off or reset the computer. To record values permanently as Concurrent's defaults, run the SETUP command instead. The following table lists the options for changing the ports from the command line. These values can be in any order, and must be separated by spaces. Choose one item from each column, or omit any column (except the port number) to leave a particular parameter unchanged. Note that the port number entries shown below refer to printer numbers rather than to the serial port numbers. P3  does, in fact, designate serial port 0, and P4 designates serial port 1. Port Baud Word Stop Input Output Number Rate Length Parity Bits Protocol Protocol P3 110 5 ODD 1 IDRX ODRX P4 150 6 EVEN 2 IDRN ODRN 300 7 NONE IDNX ODNX 600 8 IDNN ODNN  1200 INRX ONRX 2400 INRN ONRN 4800 INNX ONNX INNN ONNN The input/output protocol options use the letters DRX (in that specific order) & N to specify which protocol is on or off. D turns DSR/DTR protocol on, R turns RTS/CTS protocol on, and X turns XON/XOFF protocol on. Use the N in place of any or all the DRX letters to turn that protocol off. For example: INNX == XON/XOFF input protocol, ODNN == DSR/DTR output protocol. If you make an invalid entry in a SETPORT command line, a help screen is displayed. Use this information to identify the inappropriate entry and review your options. Examples: A>SETPORT P3 9600 7 EVEN 1 IDNN ODNN This command sets serial port 0 (printer 3) to 9600 bits per second, with a 7-bit word length, even parity, and 1 stop bit. The protocol selected for the input and output sides of port 0 is DSR/DTR. A>SETPORT INNX ODNX 110 P4 This command sets serial port 1 (printer 4) input side for the XON/XOFF protocol, the output side the DSR/DTR and XON/XOFF protocols, and the baud rate at 110 BPS. ///2CONFIG From the configuration menu, press F3 or F4 to set the baud rate for serial ports 0 and 1, respectively. The baud rate is the speed at which the computer sends data to and receives data from external devices. Pressing these keys changes the baud rate through the following list: 110 150 300 600 1200 2400 4800 9600 Word length is the number of data bits in each character transmitted. It is almost always either 7 or 8, but you can select as few as 5. Press F5 and F6 to change the word length of ports 0 and 1, respectively. Parity checking verifies that a character was transmitted correctly. You can select odd, even or no parity checking by pressing function keys F7 and F8. One or two stop bits are always appended to every byte transmitted. This is to indicate the end of the byte so that the receiver and sender stay byte-synchronized. Press F9 and F10 to select the number of stop bits. ///2PROTOCOL From the main menu, press F5 or F7 to define the communication protocol for ports 0 or 1, respectively. The main menu is then replaced by a screen listing the different input and output options available. The screen also shows which options are currently ON and which are OFF. To change a setting, press the corresponding function key. To determine which protocol is appropriate, if any, consult the device's user manual. ///1SETUP Syntax: SETUP [option] Explanation: SETUP is a menu-driven program that allows you to change certain system options and save your changes as Concurrent's default values. You can perform any of the following operations:  o Set the default function key assignments and serial port configurations. o Install an MDisk -- a reserved portion of memory used as a disk drive. o Change the scrolling mode of the color monitor. o Enable/disable serial consoles. o Have Concurrent verify the accuracy of every floppy disk write operation. o Change hardware settings for floppy disk and/or clock. o Define a maximum memory allocation for each programs. o Increase the memory reserved for installed device drivers. SETUP modifies a file called CCPM.SYS, which is used to load Concurrent each time you start or reset the computer. To save the changes you make with SETUP, you must have available the CCPM.SYS you want to modify. SETUP's main menus are summarized below: F2 Reserve System Space: allocates additional space for installable device drivers. F3 Save System Parameters: Allows you to save the current window's function key assignments as the new default values. F4 MDisk: Allows you to set aside a portion of memory as an MDisk. F5 Diskette Drive Parameters: setup for non-standard drives. F6 Verify After Diskette Write: Allows you to enable or disable the Concurrent disk write verification feature. F7 Select Serial Console: Allows you to set up your serial ports for multi-user terminals or other devices. F8 MENU TWO: Switch to the second menu of choices. F9 Color Monitor Scroll Mode: change the speed of color scrolling F10 Update And Exit: Records your changes in the CCPM.SYS file. MENU TWO: Provides menu choices for: * Setting the Maximum Memory Per Process (that is, the default MEMSIZE). * Clock Calibration * Install an optimized hard disk driver in the system * Setting Expanded Memory parameters. Changes you make using SETUP become system defaults only when you exit the main menu by pressing F10 and then restart Concurrent. If you want to exit SETUP without saving any changes, exit the main menu by pressing Esc. You can by-pass the initial display of the main menu by entering a command option when starting SETUP. The following table lists and explains the available options. The slash must precede the option name. Option Definition /PARAM specifies the Save System Parameters menu /MDISK specifies the MDisk menu /DISK specifies the Diskette Drive Parameters menu /VERIFY specifies the Verify After Diskette Write menu /SERIAL specifies the Select Serial Console menu /MEMORY specifies the Maximum Memory per Process menu /CLOCK specifies the Clock Calibration menu /HDISK specifies the Select Hard Disk Driver menu /SYSDAT specifies the Reserve System Space menu /SCROLL specifies the Color Monitor Scroll Mode menu /PFKSAVE* selects Save System Parameters, saves the  current programmable function key assignments, and leaves you at the SETUP main menu. * Note that the function key assignments and serial port values are not actually saved as part of the CCPM.SYS file until you exit the main menu by pressing F10, Update and Exit. ///2CLOCK This option is useful for compatibles which include timer chips which are driven at a different frequency than IBM machines. If the time-of-day on Concurrent's status line runs slow or fast, follow the instructions to calibrate the clock. ///2MDISK The MDisk menu allows you to setup the size of disk drive M in your system memory. The M disk will be created the next time you restart Concurrent. Disk drive M is a block of memory that has all the characteristics of a disk drive, with one important exception: all information on drive M is lost when the computer is turned off. You can use it just as you would a fast disk drive, just  be sure you remember to copy any valuable information from the M disk onto disk before you turn off your computer. The MDisk menu provides the following options: F3 Increase MDisk size: When you press F3, the size increases in increments of 16K. At the same time, the starting address value decreases in increments of 16K. SETUP does not let you allocate space to the M drive below starting address 4000:0000. F5 Decrease MDisk size: When you press F5, the size decreases and the starting address increases in increments of 16K. To exit the MDisk option and return to the SETUP main menu, press the Esc key. The memory disk created by SETUP is in conventional memory only. If your system contains banked memory, you may find that the space available to run application programs (use STOP.CMD to observe) is not sufficient, and SETUP's memory disk should not be used. An alternative is to use an expanded or extended memory ram-disk driver provided with some EEMS boards. ///2DISK The Disk Drive Parameters menu is for the few users who need to customize Concurrent to their non-standard hardware. Be sure you know the technical specifications of your floppy drives in order to set them up correctly. You can adjust the head step/settle/load/unload & motor startup time. After customization, if you get frequent floppy disk errors, the parameters are probably incorrect for the drive. ///3LOAD If your machine is made up of drives which incorporate a head-load solenoid, change this parameter according to the written specifications accompanying your drives. ///3MOTOR If your machine is made up of drives which require a different length of time to reach proper operating speed than standard floppy drives, change this parameter according to the written specifications accompanying your drives. ///3SETTLE If your machine is made up of drives which require a different delay interval after track-to-track stepping than standard floppy drives, change this parameter according to the written specifications accompanying your drives. ///3STEP If your machine is made up of drives which require a different step-pulse frequency than standard floppy drives, change this parameter according to the written specifications accompanying your drives. ///3UNLOAD If your machine is made up of drives which incorporate a head-load solenoid, change this parameter according to the written specifications accompanying your drives. ///2HARDISK This option lets you increase Concurrent's hard disk performance on XT-only compatibles which are built with 100% IBM-compatible hard disk controller hardware. Background task performance during hard disk operations is improved when this option is selected, because Concurrent is able to send commands directly to the disk controller hardware instead of using ROM interface routines. This option is ignored when Concurrent runs on an AT or AT-compatible. Be careful when using this option! If your machine is not a 100% compatible, data may be corrupted on your hard disk. Test your system rigorously before permanent selection of this option. ///2MAXMEM The Maximum Memory per Process menu lets you set a limit on the amount of memory available to programs. Some programs attempt to claim all available memory for their  use. This is not a problem as long as this program is the only one you are running. However, it is a problem when you want to change windows and run another program. If your programs are grabbing too much memory, you can set their limit maximum memory limit to a lower value. Before you change the maximum memory value, consider the programs you expect to run and their memory requirements. Many applications, especially spreadsheet programs, require larger amounts of memory as the amount of data being manipulated grows. By limiting the amount of memory the program can claim, you may be placing an artificial limit on the amount of data the program can handle. Of course, if this becomes a problem, you can always run SETUP again and increase the maximum memory value. The Maximum Memory per process becomes the default MEMSIZE when Concurrent is next restarted. ///2PARAMS The Save System Parameters menu allows allows you to save the current window's function key settings that will be in effect when Concurrent is started. Press function key F3 to tell Concurrent that the current function keys assignments should become the startup function key settings. To cancel the save command, press the function key again. ///2SCROLL The Color Monitor Scroll Mode menu allows you to change the way your color monitor displays rapidly-changing information. The three choices are: Fast/Flicker, Slow/Smooth, and Wide Open. Fast/Flicker allows text to be displayed faster on the color monitor but sometimes allows an annoying flicker to occur. Slow/Smooth eliminates the flicker, but text will display more slowly on the color monitor. Wide Open does not control flicker or display speed. To specify a scroll mode, press function key F3 until the desired mode appears. Then press function key F10 from the SETUP main menu and follow the on-screen instructions to update the CCPM.SYS file. The scroll mode will take effect the next time Concurrent is restarted. It is recommended that you experiment with the scroll modes to see which one is most appealing. The FAST/FLICKER mode is usually preferred, unless the application causes the screen to flicker a lot. ///2MULTIUSER This SETUP menu allows you to configure the serial ports. You can designate them as either aux/printer ports or as terminal ports. A terminal port is a serial port with a computer terminal (console and keyboard) connected. In other words, this feature allows several people to use the computer at the same time. (Concurrent XM supports up to four serial terminals, each with one virtual console. Programs can be run on the serial terminals so long as they don't directly write to the screen. Concurrent 386 supports up to nine serial terminals. If these terminals are PC emulation terminals, each may have up to two virtual consoles, and programs that write directly to the screen can be run on each terminal.) F4 from the Select Serial Console menu allows you to switch on or off the "soft-boot" option, . Normally, pressing resets the computer. However, if your computer is used by several people at once, you may want to disable this option. If you do disable this option, note that users will still be able to reset the system with the REBOOT  command. ///3MULTIPORT F3 from the Select Serial Console menu introduces a new menu that allows you to setup a multiport expansion card (by pressing F3), or to reconfigure Concurrent after removing a multiport card (F5). Page through the list of cards by pressing F3 repeatedly. Then press F7 to select a menu that enables you to setup the characteristics of each serial port available on the chosen expansion card. ///4CONFIG F2 selects t he individual ports on the expansion card (numbered from 'Serial port 1' upwards). F3 designates what the chosen serial port will be used for. It toggles between "Multi-user terminal" and "Aux/Printer port". F5 allows you to select the parity checking convention for the chosen port - odd, even or none. F6 selects the number of stop bits. F7 selects the number of data bits. F8 defines the preferred communications protocol. ///3FEATURES In this menu, which only applies to Concurrent DOS 386 that is set up to run serial terminals: F2 selects the multiuser terminal ports. F3 toggles between a non-PC emulation terminal or a PC emulation terminal for the chosen serial port. See your terminal's manual if you don't know which to option to choose. F4 selects, for a chosen PC emulation terminal, either the US keyboard or the national keyboard currently setup on the main console. F5 toggles between one virtual console or two virtual consoles for a chosen PC emulation terminal. Concurrent 386 allows each serial terminal to run programs in two separate windows simultaneously. You switch between the two windows by pressing -1 or in the usual way. F6 selects either the 84-key keyboard or the enhanced keyboard for the chosen PC emulation terminal. ///2SERIAL F5 from the Select Serial Console menu allows you reassign the use of COM1 and COM2 and to change their configuration. (Note that COM2 is disabled if a multiport card is fitted). If you choose to change the configuration you will see another menu with further options. ///3PORTSET F3 - Port Configuration. Use this option to display and change the port characteristics. The definable characteristics are as follows: * baud rate: number of bits of input or output per second * word length: number of bits in each word * parity: the use of odd, even, or no parity * stop bits: number of stop bits added to each word F5 - Port Protocol: Use this option to set port 0's input and output communication protocol. The values set here for COM1 and COM2 will become current once Concurrent is restarted. If you want to change COM1 or COM2's configuration without restarting Concurrent, use the SETPORT command. ///2LIM The LIM page frame base address places the page frame at an available location in the first 1MB of the address space. The page frame is the 64Kb address through which expanded memory is accessed by applications using the LIM emulation. The page frame base address can be specified in an available space in the range from C0000h through D0000h. Note that if any of the 16Kb segments within the 64Kb space are unavailable, LIM emulation is automatically disabled. To use LIM emulation in this case, move the LIM page frame base address to a different address. The LIM memory per process controls the maximum amount of LIM memory that the Concurrent 386 system can allocate to a single process. If the value is too large, certain applications may "hog" the system's memory, and prevent other programs from running concurrently. ///2HI-MEM This menu allows you to allocate blocks of high memory in the address space above the 640K boundary, for Concurrent to use for buffer space allocation. This leaves more space in normal memory for applications to run. On this screen, F3 allows you to highlight different specified 16Kb segments of high memory. F4 toggles between 'enable' 'disable' and 'autoscan'. 'Enable' will try to allocate the 16Kb segment of high memory for buffer space allocation at the next restart, after performing simple checks for ROM or RAM at the segment location. 'Disable' prevents the segment being used for buffer space allocation. 'Autoscan' means that Concurrent examines the highlighted segment at the next restart. If the memory segment appears to be free, Concurrent switches its state to 'enable', and uses the segment. If not, Concurrent switches its state to 'disable'. Note: you can only allocate high memory in Concurrent DOS XM if you enable Concurrent's built-in EMS driver. Segments of high memory may already be in use if you have fitted certain expansion cards, for example: * An EGA card (this commonly takes up 16Kb of memory at C000) * A network card * An intelligent I/O card Your expansion card installation instructions should contain details of what portions of high memory a card uses. LIM emulation (Concurrent 386 only) also takes up 64Kb of high memory, with the location in high memory set by the Set Page Frame Base Address option within SETUP. If you do not need LIM emulation you can free an extra 64Kb of high memory by disabling the emulation. ///2SYSDAT The System Data Space menu reserves additional memory for use by installable device drivers. The default setting of 0 is usually adequate for average users. However, if you find that the system does not have enough memory to install everything, change this value according to the instructions within SETUP. ///2UPDATE Leaving SETUP causes the changes to be saved. This updates the CCPM.SYS file on the drive you select with the changes you selected. Subsequently, whenever you start or reset Concurrent, the features you selected are the default values. When you want to abandon your changes, exit SETUP by pressing Esc from the main menu when you want to abandon your changes. SETUP looks to the current directory of the update disk to find the CCPM.SYS  file. The menu options let you select an alternative drive or use the current drive designation. However, you cannot change the current directory from within SETUP. Remember that the changes save from SETUP do not take place until after you restart Concurrent. ///2VERIFY The Verify After Diskette Write option is for those users who require data integrity at the expense of speed. This option affects only the floppies. Normally, Concurrent writes information to a floppy disk and proceeds with the next operation. When you enable this option, Concurrent reads the information back from the floppy disk and compares it to the original to ensure that the data was recorded accurately. When a verification error is detected, the Concurrent automatically tries to write again. ///1SHOW Syntax: SHOW [d:][SPACE|DRIVES|LABEL|HELP] The SHOW command without options displays each of the logged-in drives, whether they are Read/Only or Read/Write, and the unused disk space available on the drive in kilobytes. Use the SHOW options to display a single specified drive, or one of the following options: Options: SHOW SPACE ; Same as the SHOW without options. SHOW DRIVES ; Displays the drive characteristics of logged-in drives on ; the system, or for a specified drive. SHOW LABEL ; Displays the directory label, if it has been created. SHOW HELP ; Displays a list of the SHOW options.   Examples: SHOW SHOW A:SPACE SHOW DRIVES ///1SORT Syntax: SORT [/R] [/+n] Explanation: SORT reads data from the standard input device, sorts the data, and then writes it to the standard output device. Uppercase and lowercase letters are not significant. The options are: /R Sort in reverse order /+n Start sorting with column n ///2EXAMPLES The following example reads and sorts the file INDEX.DIS and writes the output to the printer. A>SORT PRN: You can also use SORT to "filter" information from another Concurrent command and present it to you in alphabetical, date or size order. The following example uses SORT to present a directory listing in reverse alphabetical order and then writes it to the file REVERSE.ORD. A> DIR | sort /r >reverse.ord ///1STOP Syntax: STOP STOP program window Explanation: The STOP command has two distinct forms: if you do not specify any command options, Concurrent runs STOP.CMD which displays a list of the currently running programs and the amount of memory used and free in the system. It then prompts you for the program number to terminate. Press just Return to leave them all running. Use this form when you have access to STOP.CMD and enough memory available to run the program. The second form is internal to Concurrent and should be used when you cannot access STOP.CMD or you do not have enough memory to run it. This form of STOP terminates only the program specified. No memory allocation information is displayed. You must enter the program name and the window number in which it is running. Note: Use the STOP command to terminate a program only if the application cannot be terminated normally. To use it, change windows, if necessary, and enter the STOP command. When you return to the window on which the program was running, the command line prompt is displayed and you can enter another command. The following is a summary of the program/memory display: Entry Number -- Sequential numbers given by the STOP command to all programs running. The highest number indicates the first program invoked and the lowest indicates the most recent program invoked. STOP always appears first on the list with the designation **. Program Name -- The name of the program running. Memory Used -- The amount of memory used by the program. Window Number -- The number of the window in which the program is running. The following is a summary of the free memory display: Type of Free Memory -- Conventional memory or banked memory window. Conventional memory may contain only one program in a single memory address. A banked memory window is an address range where several programs may reside, each in a different physical bank. Size -- The length in kilobytes of the contiguous block of memory. Assuming enough physical memory is available on your banked memory card, the largest program you may load is the largest of the conventional memory blocks and the banked memory windows. An EMPTY banked memory window is one in which no programs reside. This type of banked window can be used to load programs when the "BANK = OFF" command has been given, or when the CHSET command has been used on a CMD program to prevent it loading into occupied banked memory. Address -- The address of the free memory block as a segment and offset value in hexadecimal notation. Enter the Number to delete or RETURN to exit--This prompt invites you to terminate a program or return to the Concurrent command line prompt. ///1SUBST Syntax: SUBST [d: d:path] SUBST d: /D Explanation: SUBST allows you to replace a drive-and-path specification with a single drive name. So, for example, you can replace a path like \wordproc\simon\letters with the drive S:. This can save typing and it can also be used for programs that don't recognize subdirectories. Drives assigned by the SUBST command are called "floating drives". Any drive can be a floating drive except: * Drives that Concurrent already recognizes as physical drives (typically A:, B:, C: ...) * Drive L:, which Concurrent reserves for its own use. Entering SUBST without any parameters displays the current assignments. The \D option removes the assignment for the drive you specify. ///2EXAMPLES: The following example assigns drive S: to the path \wordproc\simon\letters on drive C: A>SUBST S: C:\wordproc\simon\letters The example below removes the assignment from drive H: A>SUBST H: /D *** ///1SUSPEND Syntax: SUSPEND [ON|OFF] Default: SUSPEND=ON Explanation: SUSPEND displays or changes the suspend flag for the current window. If suspend is on, Concurrent will suspend the operation of any DOS programs in the current window when it is switched to the background. Many DOS programs do not follow DOS conventions for sending characters to the video display. When these programs output characters while occupying a background window, they can write through the foreground window to display characters on your screen. This "writing through" is not a threat to your data. It can, however, be distracting. Most of the applications you will use with Concurrent respond immediately to your commands. For example, a word processing program displays characters immediately after you press appropriate keys. Because of the interactive nature of most of the popular applications, having SUSPEND set to ON is really more of a precaution than a necessity. If an application does not output characters when switched to the background or you wish to experiment, set SUSPEND to OFF. ///1TIME Syntax: TIME [HH:MM:SS.XX] HH is a one- or two-digit number from 0 to 23 for the hour. MM is a one- or two-digit number from 0 to 59 for the minute. SS is a one- or two-digit number from 0 to 59 for the second. XX is a one- or two-digit number from 0 to 99 for the hundredths of a second Explanation: TIME lets you display or set the time of day on your system in terms of a 24-hour clock. If your system has a status line clock, resetting the time with the TIME command also changes the time displayed on the status line clock. ///1TOUCH Syntax: TOUCH [/H] filespec [/T:hh:mm:ss] [/D:mm-dd-yy] [/P] [/R] [/S] Explanation: TOUCH resets the time and date stamps for a single file or a group of files. The options are: /T:hh:mm:ss Time to be set. The time is set in 24 hour clock with midnight being 00:00. The default is the current time. /D:date Date to be set. The date format depends on the current country code, set up in the CCONFIG.SYS file. The default is the current date. /H Display help information. /P Prompt before touching each file. /R Include read-only files in the touch operation. /S Touch files in subdirectories associated with the current directory. ///1TREE Syntax: TREE [/H] [d:][filespec] [/F] [/P] Explanation: The TREE command displays the hierarchical path of directories and subdir ectories. When used with a filespec, TREE will find all the files matching the filespec on the disk. Valid options are: /H Displays the help information. /F Displays all the files in the subdirectories, as well as the subdirectories themselves /P Pauses after each screenful in a long TREE display. ///1TYPE Syntax: TYPE [d:][dirpath\]filespec [/P] Explanation: TYPE displays contents of one or more ASCII (text) file on the screen. Use wildcard filespecs to refer to more than one file at a time. Entering a Ctrl-P prior to the type command causes the output to be echoed to the printer until another Ctrl-P is entered. Press Ctrl-S to stop the display from scrolling. To restart scrolling, press Ctrl-Q. Press Ctrl-C to abort the display. The /P option causes the text to be displayed a screenful at a time; move to the next screen by pressing any key. ///1VER Syntax: VER Explanation: This displays the version of Concurrent DOS that you are using. ///1VERIFY Syntax: VERIFY [ON|OFF] Explanation: VERIFY ON causes Concurrent to check that data is written to the disk correctly after each write operation. This, however, causes your system to run slightly slower and the default value for VERIFY is OFF. Entering VERIFY with no parameters shows whether VERIFY is currently ON or OFF. ///1VOL Syntax: VOL [d:] Explanation: VOL displays the volume label of the specified drive, or of the default drive if no drive name is given. If the disk in the drive has no label then the message "Volume in drive d has no label" will be issued. ///1WINDOW Syntax: WINDOW VIEW WINDOW TOP number=n WINDOW FULL number=n WINDOW WRITE number=n type=[w|c|s],file=filename WINDOW CHANGE number=n field name=field value Explanation: WINDOW is a command that allows you to make changes to your Concurrent Windows by entering values in a WINDOW command line. WINDOW is a command line version of WMENU, a menu-driven command. WINDOW's principle use is that you can include WINDOW command lines in a BATCH file. In fact, by using WMENU, you can generate an instant BATCH file containing WINDOW commands that set up your windows the way you want them. See the Help topic ACTION_KEYS for information on switching windows. The Concurrent window manager does not have to be present in your computer's  memory for you to use WINDOW. WINDOW is divided into five subcommands: VIEW, TOP, FULL, WRITE, and CHANGE. WINDOW VIEW allows you to view a table of the current values associated with your Concurrent Windows. The WINDOW TOP command has the same effect as pressing Ctrl and 0, 1, 2, or 3 to switch windows. The WINDOW FULL command has the same effect as pressing Ctrl-Del to switch your window between full-screen and its former size and position. WINDOW WRITE allows you to write any of three different kinds of files: o the text contained in a window (type=window). o the text contained in the entire window that lies beneath that window (type=window). o a BATCH file that produces the window setup that exists at the time you execute the WINDOW WRITE command (type=setup) WINDOW CHANGE is the command to make changes to your windows. You can change the size, location, colors, and other properties of your windows. With all of the WINDOW subcommands except VIEW you must specify a window number in a WINDOW command line. ///1WMENU Syntax: WMENU Explanation: WMENU is a command that loads the Concurrent window manager into your computer's memory. Once the window manager is in loaded, WMENU lets you manipulate Concurrent's windows by pressing keys on the numeric keypad. Type WMENU and press Enter. WMENU returns the message, "Window Manager installed." You will notice that the letters Win appear on the Concurrent status line. To use the window manager, hold the Ctrl key down and press the + key on the numeric keypad to obtain WMENU's main menu. This menu offers you a choice from Place, Size, Scroll, Tracking, Display, Color, Write, and Abort commands. You can press the Esc key to exit the main menu. When you press the arrow keys on your numeric keypad (or the space bar) you can move the menu pointer, a reverse-video box, from item to item in the main menu. When you press Enter, you receive the submenu for the item that appears in the menu pointer. In the submenus, you make changes to your windows by pressing the arrow keys. The changes take effect instantaneously, as you press the arrow keys. Press Esc to return to the main menu from a submenu. MAIN MENU OPTIONS Place allows you to move the window around on the screen. Size allows you to change the size of each window. Scroll allows you to change what portion of a screen you see through a window. Tracking lets you select between row tracking and no tracking. With row tracking selected, Concurrent always keeps the row that the cursor is on in view when you scroll or size a window. With no tracking, Concurrent does not keep track of the cursor's row when you scroll or size a window. The Display option lets you choose where a window will be displayed, on a color or on a monochrome monitor. Selections made in this option take effect  only if you have both a color and a monochrome monitor connected to your computer. Color lets you change the foreground and background color of a window displayed on a color monitor. One of WMENU's more useful options is WRITE. After selecting WRITE from the main menu, you can, with a single Enter keystroke, create any of three different files: 1. A BATCH file containing WINDOW commands that set up your windows exactly as they are set up at the moment when you press Enter. 2. A file containing the characters in a window. 3. A file containing the characters in a screen that lies beneath a window. The Abort option allows you to remove the window manager from your computer's memory. After pressing Enter from the Abort submenu, you must re-invoke WMENU to load the window manager. Remember that you can press Ctrl-+ to obtain WMENU's main menu even when you are in an application program. Also you can switch windows when you are in the main menu or while in a submenu. This means that you could, for example, change the size of window 1, press Ctrl-2, and immediately change the size of window 2. ///1XCOPY Syntax: XCOPY filespec [filespec] [options] Explanation: XCOPY selectively copies groups of files. It can be used to copy whole subdirectories. The first file specification on the command line is the drive, path and name of the files to be copied. Wildcard filenames are allowed. The second file specification is the destination drive and path to which the files will be copied. You can also rename files while copying them by specifying a new file name for the destination file. The options are: /A Copy only those files that have the archive bit set. The attribute of the source file is not changed. (See the ATTRIB command for an explanation of the archive bit and other att ributes.) /D:date Copy only those files whose date is the same or later than the date specified. The format of the date depends on the current country code (see the DATE command). /E Create subdirectories on the destination even if they end up being empty after all the copying is complete. /H Include system files. (Files with the system attribute are explained in the ATTRIB command description.) The default is for system files to be ignored. /M Copy files that have the archive bit set, and then reset the archive bit on the source file. /P or /C XCOPY prompts you as each file is copied. /R Overwrite read-only files. /S Copy the files in the source directory and files in all the sub- directories below it. /V Verify that the data written to the destination is a true copy of data in the source.  /W Wait for a diskette to be inserted before beginning to search for source files and (if necessary) wait again before the files are written to the destination. ///2EXAMPLES: Suppose you have files in a directory called C:\wordproc which has two subdirectories \wordproc\jenny and \wordproc\olivia. You want to copy all the files that have the file extension .LET from these directories on drive C onto a diskette in the A drive. You also want the approprate subdirectories to be created on the diskette in A. The command is: C>XCOPY \wordproc\*.let A: /E /S The following example copies all the files that you have marked for archiving from a diskette in drive A to another diskette in drive B. (Note that you mark files for archiving by setting the archive attribute - see the ATTRIB command.) You will be prompted to insert a diskette in drive A before the copying operation starts. The archive attribute will be turned off at the source file to show that the file has been copied. A>XCOPY *.* B: /M /W ///1XDEL Syntax: XDEL [/H] filespec [/D] [/N] [/P] [/S] Explanation: XDEL is a powerful tool for deleting files in subdirectories and removing empty directories. XDEL normally warns you before deleting files, but note that if you use the /N option, no warning whatsoever will be given. You may find this useful, for example, in BATCH files, but care is needed that you don't delete files by mistake. The options are: /H Displays help information. /D Removes empty subdirectories. /N Deletes all the specified files without asking further permission. Use this option with care! /P Prompts you before deleting each file. /S Deletes files in subdirectories derived from the current directory. ///2EXAMPLE: The following command will delete all the files with the .OLD extension from the current directory and all the subdirectories below it. It will prompt before deleting each file, and any empty subdirectories will be removed. A>XDEL *.old /D /P /S ///1XDIR Syntax: XDIR [+|-ADHRS] [filespec] [/B] [/C] [/L] [/P] [/S] [/T] [/W] Explanation: XDIR is an expanded version of the the DIR command, offering extra options for displaying the contents of directories and subdirectories. The options are: +|- [A] [D] [H] [R] [S] You can specify to include (+) or exclude (-) files with a certain attribute. The default is for all the files to be displayed, including system files. See the ATTRIB command for details of the different attributes. /B Produces a "brief" directory display, only showing filenames and paths. /C Computes and displays a hash code for each file. A hash code is a four-digit hexadecimal number calculated from the bytes within the file. It can be used to verify that two files are the same. /L Produces a "long" display format. This is the default option. /P Pauses after each screenful of display. /R Reverses the sort order - either the alphabetical order by filename (the default) or the chronological order, set by the /T option below. /S Displays the files in subdirectories derived from the current directory. /T Sorts the directory by date and time, rather than by filename. /W Displays the directory in a wide, abbreviated format. This is useful if your directory display would otherwise be too long for the screen. ///2EXAMPLES: The following example displays all the read-only files in the current directory and the associated subdirectories: A>XDIR +R *.* /S The following example displays all the files that match the specification  MEMO*.* on the current directory, and sorts them into reverse chronological order, so that the most recent are at the top of the list: A>XDIR memo*.* /T /R ࢳд!T!!2ㆠ3+u ub t/<+tHu^GtG3Ҡ.!3|uVGOr dursuy DDXَэ&P3ɋUVN]010486Concurrent V5.0COPYRIGHT 1986, DIGITAL RESEARCHXXXX-0000-654321CSEG patch areaE> s PG uGG[u FFH\9>Ft>\t\PY<uP oF?[u^>] t>]Su변>]Uu맀>]Hu 뛀>]Du>\t4 1 냀>]Lus UPFP]U P]U^?t 7F]U P P]Uv]U PP]UPFP]UPv]U젌s]À>u]Êˀ`:u]ðPPY]UPvF]U^??t@PS*]UPP|]UPP]UPv]U4PP]UPP]UPP]UPP]UPP]UP\P]UPP]U PPn]U PFP]]U#PvM]U.PFP:]UePFP']U찘PFP]UPP]UƊNL]U^?$tƋLF]UF0P]UFPF$P]Uv:P]UF 1PF 1R]Uv/PH]U>u]À>u]àƋL]U> u]U,0< r@]UssF$<t¢r@s,0r@sK볠:Fr:Fvo]U]:FtWvvh]UF ~Ns F$<u ~s  ]UN 1!N1N!]UF 1PF 1X]UP PȢ">"t@)s( "K(/PP6(!#/PPcP$>#u$$<t )s]$N:rD"*m#PQQY+Q6$6"YJGW"$m#P6$6"Y^PcQ QYPNQQ~Y+ȋJOPPPJG:PP;P1PJGJ?u > :u:PP;P (JG]ð:PP;PPbJG]UF F]U$NPm$$<uPnN;Pw]áP)N$$"v*"Ȣ"<s+"+;Ns]]UJG%G&G'GNH1*S+$$<u >N;v+z"+N+Ȉ#"]UJ?u*WP\ P:6"6#6$ P6%6&J?u6'U]UTFJÍOL?t?u t7J?t?u&LƋLT]U-v.-PyH>H wH3GHu]U&Oเ\]U-PP1FPps -PPPsP-PP>u]U^JP?P}6^>J u>Yu]UvNA ]U<wƋ^:tu]U u>sM<w P<<v<,t<:t<*t<.t <>t<6t>6uذ,P]U6u5s t v5]U788<w3Ƌ^^7^ȿ 1718u]UPPPqPPPd^7^G:9>9w&:s9`Pa.:9uӸPPJ]U^G$;o/G]U&O^G6&"DW ˆG'Y]U젊APg/P~]U^\^?r /^]Upr<tt&;Gw,Fs 6t<<s pPrPtsǡp]Uv2P!c;PvG6&D@PQPPjP&G@PP&G PxP&GP_Pt&OPGP\&76PK&w $P9O]UGP:P]UvGF]U1x=>xtxs6=F1Vؾ 1z;t 8>u?s?>0P]U>0sJ PPP6P'PkP]UZRPFsOWPP]U| ~@>|tB|s->\t \:@u>@ s6@Dt{BBABw+&:Gw?uA"B~>Bv&G@B&G@+B+D]UIIs PJqPNPdPPTP1CC<wÊ s PdPP^CunPCC<w"Ê s"dPP#Cu]U P]U>0s0P]U>0sDP]U츍PP:>tˀ` u]<]UgIIs XPk*>0sl6D>DwP1s︄P$︩PD$@<@uPPPzD$F w&>F u.PFƋ$PFu]UFF>FuPF?]t?:uFF?uF] DSEG patch area %,  ;Zx0N Copyright (c) 1984, Digital Research 12/10/84SHOW 3.3Sun$Mon$Tue$Wed$Thu$Fri$Sat$??????????????Directory Passwds Stamp StampLabel Reqd Update Label Created Label Updated------------ ------- ------ ------ -------------- --------------: Drive Characteristics128 Byte Record CapacityKilobyte Drive Capacity32 Byte Directory EntriesChecked Directory EntriesRecords / Directory EntryRecords / BlockSectors / TrackReserved TracksDrive Status : SHOW DRIVE: SHOW d:DRIVE:Directory Label : SHOW LABEL: SHOW d:LABEL:Free Disk Space : SHOW SPACE: SHOW d:SPACE:Invalid Option, use the following:, Space: This command/option requires CP/M media.Active User :Active Files:# of files :Option not compatible with this O.S.Not yet implementedNot yet implementedThis command/option requires CP/M media.Label for drive AccessCreate on off on off on off No Directory Label existsRequires Concurrent to run.Disk I/O error on drive ࢳд!T!!2ㆠ3+u ub t/<+tHu^GtG3Ҡ.!3|uVGOr dursuy   "b}R(&2PV#Z +ێCOZero divide error$XYZ+^gVDRQSVRSSSP6 [ZB;v Stack overflow. $+RSñ uPPt<v`AbÃԱi@t+ P X"r.t " t5 t 5t+Ɉfd%Ë-++Ë6_Cr Ë6_+́;s;rË-UPPPe+]You must link with LINK86 V1.2 or later. $66 UVWv v~v2f_^]Y[ڎ^6-6'6!6666 6SV++4,S$p{ȳ+^t&u+[+u@fCP/M V1.35 6/12/85 SMALL Model CLEAR library. Copyright 1983-1985 Digital Research.$UWVVNj*^_]UF^2FF^?t0FPFF[؊2PPD^?u +PP*]UVW^PP u'&PP uBPP uzPPPPPPzPPPPPPF:PFF[؊2PPm:^?uPUDDzPPHPP:PP,zPP+P PP-P@FFF+1P[P[G P[GFr+fP [fP [G fP [G fP [G fP [@2fP [@@3fP [4fP [Pƻd+P52[[fP [Pƻd+ +P62[[fP [Pƻ +P72[[fP [8fP [9Fs+PƱ[ؠPƱ[ؠGPƱ[ءGPƱ[ءGPƱ[ءG+PƱ[PǓ[GrܸPƱ[ Pƻd+0[PƱ[ Pƻd+ +0[PƱ[ Pƻ +0[PƱ[PP ufP [FsFAF<<PPJF t6~u,A<PP)F t~sF~y+D6P[6P [G6P[G6P[GFrPP~ug+ Ɠ Fr+<PPFr<PPkF<PPXA<PPEFk~tb+T% u1<PP t<PP<PPP%[ÉF^ r^ w@+F^G 6P[P^G[G6P[G6P[P^G [GF6PF2[؊F+u~t)6P[؊GP6PF2[؊G[:s*6PF2[P[6P[؊F"FF6PF2[؊FGrFs:PP#PP 2FufP 2 [؀?u +PF2%[؀?tFr߃u jF2@%F+!6PF2ƻ+[؀tFrفu #F2@+F~uF2Hƀ~uF2HǸ P$[ÉFF FFF~$r P$[ã PPF t  P$[؊F P$[PDZ%A[ P$[P%A[ P$[PP P$[PPF t P[P[P[GP[G P[ؠ G P[G> uyF*P[@FP P$[@F퓊[F~rF3P[@PF[P P$[ F퓊[F~r,FP[@FP ^[F~ rۀ> uP[GP[ؠ GP[ؠ G uP[ؠ GP[GP[PP[؊G[GP[GP[GP[؊ F FPP[@F퓊[F~ rڸP[؊G  P[؊G P[؊G P[؊G  P[؊G 6P[PP[؊G[G6P[P[G6P[PP[؊G [G` 6P 2[؀ut6P 2[؊G2ǸP[؀ tHPDZ[9t(PDZ[ãPDZ[PP> s  v> s + +FP[؋GFPDZ[PP[[P PF[؊[P[؁u` P$[PP% tP[؀OP[GP[P[;6 sO6P 2[؀u  6P 2[؊G2FPf[؀ t  PF[ãPF[PPUPf[؃v> P$f[PP*Pf[Pf[ P$f[PP  P$f[  P$f[PP Pf[G >:tA<PP :PP| Pf[؊2]_^<P!PJ Pf[؊2F븦Pf[ÉF+PF[PFǓ[Gr⸺ P$f[ÉF+PF[PFǓ[G$r߸<P"P A<PP Pf[؊2ƸPf[Pf[G Pf[GF6PF2[؊F~t)6P[؊GP6PF2[؊G[:s*6PF2[P[6P[؊FFF6PF2[؊F늸6P[GƢ Pf[؊G%t   2Ǹ6P[؀u 6P[؊G2F=u P$f[PP<  P$f[PP$ Pf[Pf[G Pf[G6P[6P[G6P[G6P[GF6PF2[؊FF+fF2;uA6PF2[؊F6P[6PF2[؊FF"FF6PF2[؊FFr~tfP6P[؊G2 [PP _^]<P!P P%[ÉF^G <P"P A<PP PPn _^]<P!PO P%[ÉFPP. P%[ F@r<P"P A<PP6P[6P[G6P[G6P[G >:u   FPPu 2]^_<P!PO t X 2 tH 2P]2[;t2 2]^_<P!P t y 2F븺PF@[؀? t8PF@[؀?t(+ PPF[؊[F@rF > t< ~t ~ 2EdPPQEEEEEDESEP FƓ Fr+pCPƱ[PP E PƱ[PP0.,*fP [؊2.u?+#fP [؀?tfP [؀?wFr:<PPf_^]ABCDU챚&2]U챚&GK]UVW v&_ tFFAf_^]UFF]UVWFVf_^]UVWFFÍf_^]+P Pjp]n%+PPnn@'nnj= t=1t="t=1t:7n/-+p="0t=" t="t=1t=1t=0t=0uz+PDP|>jt>jt n+ LST000: There was not enough queue buffer space in your system to start the spooler. The spooler can only be invoked by printmgr.SPL.DSPMXSPL SPLIN SPLOUT MXSPL SPLIN SPLOUT DSP INDEX DSPCprogramCON:LST: t/<+tHu^GtG3Ҡ.!3|uVGOr dursuy MZ P s/v%p66 $U #~}P; Y^_:u-^__*t^__* hucP Y, .+0tFF;F|^9:uN"u:uG*t* su *GиPF^Ó7*Pf벃>,tPF^Ó7+PCF^Ó,RtR0R.RRP^ #tP^7+PF+>tu$+WuA+_AVWt_^>0u&0PP6.g#}dP.PVPP6.A#}dP.PVz F>*t FFFP0P6RvtRP ރt tt#PtP0gPP+P#t tuSu PD4>t.~t P.FYS0P=YYP0P YY럃~tFa uXt"t<.tG=.tC+tWuA+_WuA+_AځtVW_^F~t u P6,+P+P]VW P> r# P, P%>/t/\PP #u PY@PtY#u PY_^UxVW~>*t2+NWuA+_A^VW~_^WFPYYa+WuA+_AVW~_^^VNWuA+_WuA+_A݃NVW_^FPFP)6W#}fRRP|FPYHtF<t< uPFPYY~v 6~FF=sP6^YY+PPRP^#uD=Pu?n~u/FPYHu'FVF:t PVRqYY=tdPN6 YPPFPv~#v~t+PVNQRVNFPF:uqP+PP#u+Pvv6 FV"} fPPv PP6 #}@fPPV365 LF:u PpY+PvvN6 Y#}ePPVP5Y_^]UPVW~9*P8*P P~t P Y=uuJ F^*tF, F:9t F:8t #u+uuPr Y#t 8*P 9*PP YY_^Y]+ "У$&UVW~>"t+o; sÓGN@P66F veP(PV +$&@"6 WY_^]UPVW~>"t++; s ;vÓG^FF;u\@P66 F=veR)RP$ +$&F@"F +Pv`YY_^Y]UW^#tFV+$&|+ +$&N^+}F+$FVx+Pvv6 FV"}eP*Pvr@P66 veP+PWJFV$&A"> _]á+$&øPYøPYUVW~v^ w t7ujt8t,t;dtneufugtVxV:VRP Y#t*P"P YYV,V6P *PPfP eu *APMP*APP :2P Y߃tt uP_ PPQ YY~ftPY_^]UW~߃t tct&yNP YoP *PPfP U*P *PPfP P P &P bP P P *PP +P uP YPY_]U>tP Y6gFPi ]U!]U;V!s+]UVGVv!s+^]ø7!*UF. %# !]UF. 5$!. . %$ !] %$! %#!ӎ. . . . .6 .6 <u %$! %#!ӎ. ϴL!UVW~v +F:t3}:u-*tV*t* -a^F^vv @@PF*PFP #u v Y#uy^ ?tWSF Y#uN+PPW F#~<t8+NWNuA+_AVCCVW_^^^ |t^aD:+_^]UPVW+^ ^ ^NWuA+_;uO#t^ߊ<;t:Fu^Ó?;u'v S P#uU#tO#t ^ߊ:FuA};^ߊ:FuG+FF^"t<;t } ^ ވFF |6+^ Ӌڈ;~^ފ^ވF~N+^Ӌڈ_^Y]UVW~+;v}G^F"u+F_^]UVW~+"t<.tFG=tG+=tFG~+_^]UVW~vG"u_^]UVW~vG"u_^]UVW~^*t'^:u^*t ^* -a*+TWuA+_AVNW`_^avp`3ҋ^:tB;tSR YY#t 9F%V+҉N ;u/^?t +WuA+_AVWb_^>tFtFtF  v Y#tuv P6"P*P`P #ud7t2>t$>@.t@P 9 ㉇YY>>tP@PYY#t"+"PS Y+_^]UVW~>u>t8 #t!㋗;u pP_Y#t ㋇;u>  us xP ㉇vPf #t u-vP6#t"pPY#utu "P*P`P8 "P?Y#uY7t2>t$>@.t@P  ㉇YY>>tP@PYY#t"+ +_^]UVW~^?u=.u(F.G=.t .F}CG F+}1"t <.t*t ݈GGG Fʀ=.uGF. },=t*t ݈GGG Fύ~+ }^+Y_^]UVF=!s]U^>!s+]UV!u]ô!ô!ø3!˜UV3!]UB^VNF !sؙ]ô?@U^VN!s]U0!^GgDQ!r^Gg^]UVW~+WuA+_:t^:t:Qt ވވA+WuA+_NWuA+_AFVW_^_^]UW~=t*t G_]XXL!UVW8ZVRv~>Z+YY#tWVP+_^]UVW8ZVRv@>Z+YY#t WVv+_^]UW~>ZFPv Z+YY_]U>VW~GF"ur<%t<+FFF FV-u FGF~0uF0=*u^FFGGF*FGF<0r<9wF V*Ѓ0Vۀ~.uD=*u^FFGGF*FGF<0r<9wF V*Ѓ0V3Ҁ~luBV#tGF^*Xt#dt utxt6~u^F/~tFFƒFWFVF‰F^F+҉FV^*Xt9ct^dtst:utxt Nvv vvPFP vvFP(+vWuA+_VFFFvшF+ƉFF;F}F~tFN;F~FZZF"t'V;V}< u ZZ ZZFӃ~tFN;FZZ ~ uZZ ZZ FZZZ_^]UVW~F F uO0s~ uFv vFP+WuA+_ڋNWuA+_AvW_'^\OFV FV uً_^]UW~^nOFVFV uً_]UVW+vFFF~t$Nj^,0<9v, +NNN_^]UVW+WuA+_AVW~_^WuA+_AVW~_^#t*F Ft"Ft FPFPBFPP:~^Nҍ~=0uG+WuA+_A^VW_^WuA+__^]UCVNF!s+~t~u]UV!VNN UV!O!s+]UW~"t<*t<?uG+_]UPVW~v"u<.uF~}AP?Y#t*t F"t<.u <*tq?GF빀<*uF"t<.uXF.GF ~ }9PY#t*t F<u <*u?GFG<*uF<t+_^Y]UPVW^?u&+NWuA+_A^V^Wa+^WuA+_VO#t:t<;tON<;tvv+NWuA+_AFVW_^_^Y]UVWvFY=t~}:u*t* -aFGGTF+WuA+_AVW~_^VV:uGVFVRYF#tX"uL<.u[@}<.t:u ݈GGF<.t:u݊G:uNGFPYF#t"t:t ݈GGF:uGGFPuFY=tpPPvF#}PFPFPpPpPcF ~}\fPpP6gu P_Y7fPFPFPF=u6JP1Y~uF랋F#|F_^]UW=t FG:Eu+ 3Ҁ~ vB_]UPVWvvYY#t8F*䓃t t ~O+ۃ }GF^ӋڈGċ^;Ó_^Y]Uv ]UPvY]U+~uA+BV~uA+BVF;r‹V;rPvvW ]initP|P Pm v.q&&;v+ر&+شJ!+یЋ;s+ر.TX+@("tPX%t)3*>*&*?>*?u>**u..*&,&3&"@$+>R0!1&33&=NOuL&}87uD&}=u=PW>*t2* O&=t&"t!G ! !_X&=u>1s 3R&-&+G+&-ϋ&"@@@+&.qv6+P>t>ͫu;u  ! ı=@r-@ =r--UFF]ÌUV t6d6d6L@6L@V t 6d6L@]UP 6i 6vD VY>uY]U+FFFF6+FFFFF;v6^@FF< t< u~tւ~uK`~"u~u~u~uHFF묂~\u!~tF;w6x"uF"FF6^@FFn~t$6^@FF~^@6߉F;w*v@F@]HEAPCODEeach_item U9v^#t!;wtVP v^Vv^Vv^VFF~u]each_free_itemU FF`vv| Ut VP JvD ;FtvP F.v#t ;wtVP} v^VFFvD F~u]remove_from_free_chainUv|r*| uD  vD t D v\ #tD G ]USY]insert_into_free_chainUPv^#t/ Uu);u6vvD^G47v\SCv\#t>^ Uu5;6uvDvD^G47^v#t\v{&v|r ^\ #tw vD 6 Y]search_free_chainUPU$P@FfFY]USvD^;GrwY]set_limits UPP]sysallocU>u+ҋN+Nvz+;Vw u;Fs+FVF]add_new_chunk UPV;rЉVwDvxF#t7+v\D UVTD;t7F>uv Y]malloc2U>t FsF~v+F vF#uv[vF~uvPvD+FF= w DFFFvDD D,TVT vV^ VF#vDvvv^7\DD UD,TƗu;u6v#F>t/F]zUSY]hmallocUPU&PvvF>t#tV#v ʋ~FY]mallocUPv6 FY]errUSvtPsnfreeUP~uvFFF>t|v| Duv#t ;wtvD UV86| Uu$v|>t6#tv>tfY]check_heap_integrityUU'P]USY]UU.*P ]U>/t .*P /F.]UvDDD]U0P]PQRSPPVWU~r6& 6$ FPFP2PZ64 A]_^[ZYXPQRSPPVWUFPnnv&<u^ RP64 []_^[ZYXPQRSPPVWU6. 6, FP]_^[ZYXUPVR1FV$ & +PVRFV( * #PVRFV, . +P;(RR+P(RP+P(P#P]U6& 6$ P6* 6( +P6. 6, #P]Uv~N+rt@H]UvvDu R FvDtv|tDt+vvDte|}^DtP+PPDPv+DPtDP$Fv+T;uFR FvL vDDFF]U+FZ +ɋv++ًƋӹ F#|Z=Uv|tLvDt/Dt VFY vDt*vDu Dut YvDPvD R FF]UPFF ` tZ ;tPFYF=sF61YY]U]UP< FV< Y]U< d+;t < < ]UF? N s> R +> B D ]UFFF> ^Vvv]UvD PJ P]UF*@ >P]UF> LPv]Uvvc]UPF*B Y]UPT  F> =Pv> Y]UAPv]UvP64 &PPG]U츜Pi|]UPXk]Uv4FFVP6PP]UvP,|X *P]U P]U64 P]UF.Q-]UF5!~E]UVF%!]UVF%!]U~VRˎuE] MUu}ÌuE] MUU~VW~EE]U ~^W~EE]Uv4FFVP?]U6PP)]UPvFB F*@ ?P+> Y]UPvhFB V*@ @R> ;Fs >R uR > Y]U+PFPF*P]UPF*@ > DPD uFD tFD tFFFY]UF*@ F > FB FD BP]D F> FFV]U> @ B D 6F >H 6L 6J !]ݏJ L > @ B D 6F >H N ]u, t2*.cmd*.cmd.cmd.cmda:a: (%c/%c)? %c%c"%s" ...YNInvalid file name "%s" Invalid path or path not found "%s" File not found "%s" Invalid number of parameters Drive %c: not ready Failed to get current path on drive %c: (OS error code %d) Invalid password Invalid option '%c' in parameter Invalid parameter "%s" Insufficient memory ...not in a valid .CMD format Searching file(s)... ...instal patch ...random password patch already installedaccess denieddrive not readyfile already openOS error code %dPath too long CB86 patch program V1.0 Digital Research (UK) Ltd(c)1987. fixcb86 [%cHelp] [d:][path][filename[.CMD]] [%cS] This utility will patch programs compiled with the Digital Research basic compiler CB86. The patch will stop the compiled program assigning a random password to any files that it creates.  d: drive which fixcb86 is to search path directory where search is to begin filename.CMD program to be patched (wildcards allowed) %cS patch programs in sub-directories %s ...path password? 4%s ...file password? L d:..d:pathname.exta:*.*a:*.*0123456789abcdef0123456789ABCDEF000000001000000001000000000000000000a:a: *."/\[]:|<>+=;,S ((((( AAAAAABBBBBB   ,vZ f r ***RANGE OR NIL CHECK ERROR***!***QUOTIENT OVERFLOW ON DIVIDE***HEAPMGMT - heap error Aborting...)*** Cheap-heap linked in => no heap dump.&Cheap stack dump linked in => no dump.***Program aborted.******STACK/HEAP OVERFLOW***d+MetaWare High C Run-time Library Copyright (C) 1983-1986 Metaware Incorporated.. ࢳд!T!!2ㆠ3+u ub t/<+tHu^GtG3Ҡ.!3|uVGOr dursuy Xَэ&P3ɋUVN]010486Concurrent V5.0COPYRIGHT 1986, DIGITAL RESEARCHXXXX-0000-654321CSEG patch area   <0r P<r@YPu@Y"s PF!*.26&> u9>w-1uPrP$ù>u'PC~PG8u P< t@YP t@Y s׸oP:w:ˊ<0r<9wա  0Љ ȴ;vW뮃> v6 U                                                        ]UPP]UPPx]UPFPg]UPPV]U PPG]UPFP6]U찍Pv&]U Pv]U Pv]U PP]U찏PP]U찚PP]U찜PP]UF GP6 ]U P* P$]U^F1]UFPFP]U~rJ~ruF,8w Puv~luF,8w Pu]U~rJ~ruF,8w Pcuva~luF,8w P;u]UF:F wh~ ruF *F8w P u:Fw^&$PFu~ luF *F8w Pu] UFd11 11>t   Pc>u >u P  C 6]UF '1 1 й1 1 йd1 1 й 1 1>t   P> t>t   P> t>t g  PY> t>t   P8 +]U~rJ~ruF,8w Puv<~luF,8w Pu]U~rJ~ruF,8w Puvm~luF,8w Pu]U@PPPP!PPPPPP{#Pt-Pm]U^   <v5Ƌ^0r"9w&   ɸ ]U  &0 &GZ( 9(t' (&OƉD&OF &(>(u@P> Pr@Y"sY ËDF 6(&;Lu &LF"  (&OƉD&OF(&G  &Gp$9$u@P>@r@Y"rW$&9Gu9&O;t*<w#$&PÈu֠$É$&G,,&G((&OƉ&G:(&G>8<8&8w"<&t &t<uπ>u(&G  ,&G ,&?t6&,,&G9 t(6(&L6,&D$&G$ &0tX>0u@0P&t@Y"s&0ظ90t' 0&OƉ$&O& &0>0u@P> Pr@Y"r>0u@0P&u@Y"s&GP Y& &0>0u@0P&t@Y"s&0؃>0up  0&OƉ$&O& A &0tT>0u@0P&u@Y"s&0ظ90t# 0&OƉ&O&0>0u@P> Pr@Y"ss>0u@0P&t@Y"s &O&0ǃ>0u@0P&u@Y"s&0؃>0uy N&Gr$9$u@P>@r@Y"r$&G%t&O È+ <w#$&PÈ0 u֠$É) LJ- $&tw&G,,&G(Ƈ/ 6(&L- ,&G ,&?t6&,,&G9 t(6(&L- 6,&D$&4tƇ/ $&G>w8v>u 7PPrP6.P PrPPÍ0 PdË- @1- RrRPKPmPrPÊ+ P-À/ u>PtPSPx |Pn> u> u PV> tb: wTP7ËF@1 QrQPKP PrPDPiu> u% : vPË&@1 QrQP~KPH PrP$P> u@ P: v@Z"ŠP: t@PȳƋ;*r@Y Y"sc;&u P  Ë@1 QrQPKP PrP P=t> t  ]U FÊ+  ) <wFõΊ0 uڍ P > tPA] DSEG patch area[]EH01234567890123456789ABCDEF Entry $ Program $ Memory $ Window$ Number$ Name $ Used $ Number $ ------$ --------$ -------$ -------$ **$ (Banked Memory)$Type of Free Memory Size Address$------------------- ---- -------$None$Conventional$:0$Banked Window$:0$ (Empty)$:0$ (Empty)$ The selected program has not been stopped$Requires Concurrent to run$ Enter the Number to delete or RETURN to exit $ Invalid Entry number.$ Invalid Entry number.$MZ HPҰq!#n44AAA $U&+ ~~;^_: u-^__*(t^__* hucPYF;F|^Ó: uPP|PP PSE #tP6Y>|u,+WuA+_AVW|_^a|>t +WuA+_AVW_^+WuA+_AVW|_^a| WuA+_AVW_^F;F}c^9: tPOY"t@: uG*(t* ftpt  P YGF땋F;F}PY2P P6 FzR|R6x QPPRg uuPY#t ttu PYz#t/>t P|PzYYzGWJ>uPQ66|P +zP|P} YN>t u PYP(PM +P66'6P8 +P66+Pw]VW2PPPp > /t/\ vP Px #u PIY_^U>ttP YP Pv v yPvvlvPz ]UVW~PE*P) Puu6PG uu-vP VP" _^]UVWvvPFPz +2WuA+_AV$W~_^ #|;݊_*(t+t t#u N݈GN݊G݈GOF#t+N#~ ݀ u#}++ } ݀ uF݃SQ Y_^]UW~+WuA+_s W@P& YY *PWDP _]UVW~F DZ%?F>!uFa#u  | Fp ~ F*Pv*PVJP _^]UVWF P+ҹdF%FF%F*䖋tt WVvVvvVvVW WVvVvXP; _^]UW+}C-G+FFtFrFtFsF tFaFtFdFtFhFtFvFPjP YY_]U #t$V;} P ` pP YY]ørP YøPYøPYUW~߃ctcK v. "'tP2 YmP *PPPP HP *PPPPP.PlP *PP *PP uP YPY_]U>2t2P Y6vVFP]U!]U;V!s+]UVGVv!s+^] 7!*UF.%#P!]UF.5$!..%$m!]%$!%#!ӎ.....6.6<u%$!%#!ӎ.ϴL!UV8!s+]UVW~v +F:t3}:u-*(tV*(t* -a^F^vv @@PF*PFP #u v Y#uy^ ?tWSH Y#uN+PPW F#~<t8+NWNuA+_AVCCVW_^^^ |t^aD:+_^]UPVW+^ ^ ^NWuA+_;uO#t^ߊ<;t:Fu^Ó?;u'v S P#uU#tO#t ^ߊ:FuA};^ߊ:FuG+FF^"t<;t } ^ ވFF |6+^ Ӌڈ;~^ފ^ވF~N+^Ӌڈ_^Y]UVW~+;v}G^F"u+F_^]UVW~+"t<.tFG=tG+=tFG~+_^]UVW~vG"u_^]UVW~vG"u_^]UVW~^*(t'^:u^*(t ^* -a+WuA+_AVW_^a3ҋ^:tB;tSR YY#t 9F%V+҉N ;u/^?t +WuA+_AVW_^>tFtFtF Bv Y#tuvP6P*PP #udt2>t$>.tP9㉇YY>>tPPYY#t+PUY+_^]UVW~>u>t8#t!㋗;BuPIY#t㋇;Bu> usBP㉇BDP #t u-vP6#t"PY#utuP*PP: PAY#uYt2>t$>.tP㉇YY>>tPPYY#t+ +_^]UVW~^?u=.u(F.G=.t .F}CG F+}1"t <.t*(t ݈GGG Fʀ=.uGF. },=t*(t ݈GGG Fύ~+ }^+YY#tWVP1+_^]UVW8VRv@>+YY#t WVv+_^]UW~>FPv +YY_]U>VW~GF"ur<%t<+FFF FV-u FGF~0uF0=*u^FFGGF*FGF<0r<9wF V*Ѓ0Vۀ~.uD=*u^FFGGF*FGF<0r<9wF V*Ѓ0V3Ҁ~luBV#tGF^*Xt#dt utxt6~u^F/~tFFƒFWFVF‰F^F+҉FV^*Xt9ct^dtst:utxt Nvv vvPFP vvFP(+vWuA+_VFFFvшF+ƉFF;F}F~tFN;F~FF"t'V;V}< u  FӃ~tFN;F ~ u  F_^]UVW~F F uO0s~ uFv vFP+WuA+_ڋNWuA+_AvW_'^OFV FV uً_^]UW~^OFVFV uً_]UVW+vFFF~t$Nj^,0<9v, +NNN_^]UVW+WuA+_AVW~_^WuA+_AVW~_^#t*F Ft"Ft FPFPBFPP:~^Nҍ~=0uG+WuA+_A^VW_^WuA+__^]UCVNF!s+~t~u]UV!VNN UV!O!s+]UW~"t<*t&?>?u>u..&,3&@$+> R0!#33&=NOuL&}87uD&}=u=PW>t2 O&=t&"t!G ! !_X&=u>#s 3R&&+G+&ϋ@@@+&.ov6@+P>Lt>UͫuY;Wu Y ! ı=@r-@ =r--UFF]ÌUt6^d6`d6^L@6`L@t 6bd6bL@]UP 6dK 6dvD dV6Y>duY]U+FFFFO6@+FFFFF;Dv6<^@FF< t< u~tւ~uK`~"u~u~u~uHFF묂~\u!~tF;Dw6<x"uF"FF6<^@FFn~t$6<^@FF~^@6@߉F;Dw*v@@F@]HEAPCODEeach_item Up9v^#t!;wtVP v^Vv^Vv^VFF~u]each_free_itemUnFF`vv| Ut VP JvD ;FtvP| F.v#t ;wtVP_ v^VFFvD F~u]remove_from_free_chainUv|r*| uD n vD t D v\ #tD G ]USY]insert_into_free_chainUPv^#t/ Uu);ru6rvvD^G47v\SCv\#t>^ Uu5;6rurvDvD^G47^v#t\v{&v|rn^\ #tw vD 6nY]search_free_chainUPU P@FfFY]USvD^;GrwY]set_limits UtPtP]sysallocU>tutt+ҋN+Nvz+;Vw u;Fs+tFVtF]add_new_chunk UPV;rЉVwDvxF#t7+vr\D UVTD;t7Fr>pupv Y]malloc2U>ht FsF~v+F vF#uv[vF~uvPvD+FF= w DFFFvDD DTVT vV^ VF#vDvvv^7\DD UDTƗu;ru6rv#F>ht/F]zUSY]hmallocUPU"PvvF>jt#tV#v iʋ~FY]mallocUPv6lFY]errUSvtPUnfreeUP~uvFFF>ht|v| Duv#t ;wtvD UV86r| Uu$v|>tt6r#tv>htfY]check_heap_integrityUU#P]USY]UU*P]U>t *PF]UvDDD]U츒P]PQRSPPVWU~r66FPuFPP<6#]_^[ZYXPQRSPPVWUFPnnv&<u@ P6[]_^[ZYXPQRSPPVWU66FPs]_^[ZYXUPVRFV+PVRFV#PVRFV+P9$RR+P$RP+P$P#P]U66P66+P66#P]UvvDu FvDtv|tDt+vvDte |}^DtP+PPDPv+DPtDP$Fv+T;uFFvL vDDFF]U+F+ɋv++ًƋӹ F#|Z=Uv|tLvDt/Dt VFY vDt*vDu DutsYvDPvD FF]UPFF t;btPFYF=sF6b1YY]U]UPFVY]U졞D';t ]UFs+]UFFF^Vvv]UvPP]UF*䣢>P]UFLPv]Uvvc]UPF*䣤uY]U+PFPF*P]UPF*䣢DPuFtFtFFFY]UF*䣢F FFBP]FFFV]U6>66!]ݏ6>]d:\d:\*.**.*d:\d:\*.**.* %s %s%10lu %s%s%c%2d%c%02d%c %2d%c%02d%c%02d %s Invalid path Invalid parameter: filename expected Invalid parameter: option expected Invalid number of parameters File not found Insufficient memory Path too long more...total files total bytes H%s ...path password? ` bytes files pathtree [%cHelp] [d:][path][filename[.ext]] [%cF] [%cP] Show directory structure V1.2 Digital Research (UK) Ltd (c)1987. d: drive which tree is to search path directory where search is to begin (default is root) filename.ext file to find %cF display all files %cP pause after each page d:..d:pathname.exta:*.*a:*.*0123456789abcdef0123456789ABCDEF000000001000000001000000000000000000a:a: *."/\[]:|<>+=;,S ((((( AAAAAABBBBBB   ***RANGE OR NIL CHECK ERROR***!***QUOTIENT OVERFLOW ON DIVIDE***HEAPMGMT - heap error Aborting...)*** Cheap-heap linked in => no heap dump.&Cheap stack dump linked in => no dump.***Program aborted.******STACK/HEAP OVERFLOW***D'MetaWare High C Run-time Library Copyright (C) 1983-1986 Metaware Incorporated.. ࢳд!T!!2ㆠ3+u ub t/<+tHu^GtG3Ҡ.!3|uVGOr dursuy MZp; "P5' ]]]j]0],%@ $UP'F;~}b^Ó:%u:^Ó_*%t^Ó_* hucPq^Ó7 FGY;~|o^Ó:%tP8Y^0"t@:%uF*%t* rttt PYFG뉋^#tuPYPY>t >tK +P]VW1P*:P**%>%/t/\&F.+PF.(P`4#u PWY_^U~PnP*P(P&Pv + #tw>*uP*P&P6(U-P}YY>nuWnP*Y#u<PP&P6(!-PI*P)@~*P&P6(,@ Pv)+Y]UW~EEEFEEEU E /+ɉM E;Nt* UE_]UVW~F~t } u+*^ ~t uF+u^ E LP+PPv,FV"}FF,FV^ FV F_^]UVW PP1-+*WuA+_AV*W~_^nRVR,PVR+ t+NWuA+_AVvWd_^dWuA+_WuA+_AbVW_^RdQj+YYus+NWuA+_AVvWd_^dWuA+_ WuA+_A݁VW_^PdP*YY#} FPWYYW Y#tt FPFPP+YY VP+ FPW*YPYY_^]UVW P"P++*WuA+_AV*W~_^nRVR*PVRI* =t+NWuA+_AVvWd_^dWuA+_.WuA+_A(\VW_^RdQ)YY=\tu+NWuA+_AVvWd_^dWuA+_:WuA+_A4݁VW_^PdPF)YY#} VRPYYPPbP6 #t tu$^P`PPb6 @@E+߃we.PYRLP)^`P7P)P)P)^`PS WP})#tPo)PPP #uyDPS)PFPE)PP& #tRbtPP6 #t"W~P6p YY#t WP(YYFP6'YP YY_^]UVW~EP P(EPLP(E*PV PP(P(E%PrP(E%PaPn(E%PPRPZ(E%P< P PPA(E %P# PP,(E % P PP(E %P PP(E %P PP'E %PE *PP'E *PP' _^]UVW~EP P''RP]S%EEPLP~''RPEPE6 P PW'sV PP8'FE*PV P 'RPVPEP'E%P P&EPRTP&E%P"P&EPR.P&E%P$P&EPR RP&E%P~&P&EPP P P P P(Pi&"E %PH4PU&E PR P6P?&E % P!<P.&E P R P>P&E %PDP&E PRd  PFP%E %PLP%E PR: PNP%E %PTP%E PPE *PP%E *PE E *PP%E *PE _^]UVW+FVF~uTFVFVk$F*%u-0F+R Rvvv~,N+ډN^FV+Ӌv~}FVFVF Ft'#tF*PVP$+F*PZP$GY#tU^P$G^*#tAt t/t#u% RPvvv~-F V`@F}#F*䓃KtSu=#u RPvvv~,FVdP$~OY#vt+P#Y#tFvhP#FYY_^]UVW+FV#u FVFV"F*%DtXSFV^+ˉFNY+FV}FVFVF FtF*PlPP#FY^*#t;t t,us#ufRPvvv~+FVp=+A1"F*䓃KtSu4#u'RPvvv~x+FVtP"vNY~P!Y#tFvxP"FYY_^]UPVW~v!F^*%tF, F:u!*P|.F:u <*P~ uRfP PxPYYWY_^]UVW+^ctcKv. %19")$z0VP8P!YG$$P%*PPPp$P$P$P%*P$P%*P0%P+P"#t%*PPPp$PWY_^]U6FP]UVWvFPav9Jjv/vF +PRUh PZFPvH #t+PP, P1PRPPR,P PPZP+ F^*%t^* cwY.vFY#t.'<v;.vY PY#tru#uvY_^]UW~ELENE*PPE%أRE%أTE%أVE%أXE %أZE % أ\E %أ^E %أ`E %أbE *dE *fY_]UPVW~LENE6PEEF6RFPR6TVPz6VVPn6XVPbEE 6ZVPL 6\V P=6^VP16`VP%6bVPE dE fE _^Y]UVW~v~t <!_^]U^* w5.+ ]U^w).#'+/3+  ]UVWF"P+PRVR F P+PPPPPRPNQ v+PPPPPRRNQm ,F P+PP1%RnRRPF*QNQ@ FFP+PRNQ F^, PvPB%RLQ;Q+SNF*QNQ ,v PvPB%PNP;PPVF*RVR FFF PPPP?PFPR FP+PPVR $PPPFP Pv#P%PvP+RNF*QNQP FFXP+PRNQ "F^@ Pv"Pd%RRQ>Q+SNF*QNQ FBP+PRNQT F^v Pv"Pd%PTP>PPFF*PFP ,FLP+PPFP F^ Pv"Pd%RVQ>QSNF*QNQg F^P+PRNQ F^ Pv"Pd%RXQ>QS^F*S^S ,FFP+PRNQj F^ P+PPPPPPV*RNQV  Pv"Pd%RZQ#QQv^S , Pv"Pd%R\Q,Q(QvNQ  Pv"Pd%R^Q5Q1QvNQj $ Pv"Pd%R`Q>Q:QvNQB  Pv"Pd%PbPGPCPvFP $FF\!P+PRVRi F^$ Pv P%RdQQ+Q^*SNQ^ FL Rv R%RfR/R'RvVR ,F%PvWFPl %PWvFP] "&PVvFPN ?&PvVFP? Pv~!^VFGY_^]UVWF*PF*P| ^+҉FVYYtFVFVF*%t@-0F#u'+P Pvvv~N+ڋv~N+ۉN^^* w t1#t2us td t ?tRt\FV+|F*䓃t6;t'H wZ.       =83#u RPvvv~v~+FVPiY'+FV} FVFVF;Fu F;FuJF*PV*RFV vvhPFPv +sF^_^]UVWF*@@PF*P ^+҉FVYYtwFVFVF*%Dt3SgF#uFVN+N+ۉN^^* w t1#t2us td t ?tRt\FV+|6F*䓃t6;t'H wZ.z!!!!!!!!!!!!!=83#uRPvvv~Jv~+FVP Y+FV} FVFVF;Fu F;FuJF*PV*RFV> vvpP=F@@Pv% +F^_^]UVF*%t-0F*%t F*䖃 -7^]UVW~F*@PF*PYYt F^*%tF, F:t:u3ҊF:uB;tJB^* w t`#tat { t?urt|J@F*PV*RFV+PWF@Pv F+A0 F*䓃t';tHtKtMt Pt P _^]UVW~u<^_7t'v^*PF*Ps F*YY%DtSPF^G;FwHF^* w t@#t@u uov t?t]ukb@^;Gr+@T+P( F*䓃t6;t'H w..$$$$$$$$$$$$$ P Y;vu JF*PF*PV^_Ó7xPz ^_7 _^]UVW~+F;t]7V]Ó7P: _^]UFv% Y]UW~~u55P YY_]UW~~u=u*P=u*PP YY_]UW~~u55P YY_]UVWvt <;>rw^_ ;?w+*_^]UVWvt <;>rw^_ ;?r+*_^]UV3ҋvt vt ;vB^]UV3ҋvt vt ;sB^]UPVWF^#tNuuUYY#t;~uEFu#t"| tD*PD*PPt T =뮃~t>CPRzP P Pv PP_Pd F_^Y]+PRCr+PR6e+PR)X+PRK+PP>UPVW~*P*PP~t PY=uuJF^*%tF, F:t F:t #u+uuPY#t *P *PPuYY_^Y]UVWP FEFEF EF E FE FE FEFE+EY^;u?^7D#t5|_^]UVWP[ FEFEF E+Y^;u?^7#t<_^]UVWP F EFFEF E^?Y_^]UVWP FEFEF E+Y^;u?^7#t<_^]UVWv<#tQE#tE}u!F+NWuA+_P+EFF*PE*Pu}_^]UVWv<#t&} tE*PE*P+Pu U }_^]UVW~#tB+E*F]؋?t$U*RVFRF_]^ 7`F̋=뺸2PP?\PA[h"u^vv@+PP h P _^]UVW^7FY#t/~#t ~uY^?u^^7}Y#ulD*PD*Pt T Fw.* + +**** +t9#uF4E#uFǖ vtYY뜋^7F_^]UW~#t } u}_]UW~#t } u=_]øPYUF* PF* PP]øPYøPYøPYU!]U;V!s+]UVGVv!s+^]ø7!*UF.|,%#,!]UF.z,5$!.~,.,%$8,!]t,%$!t,%#!ӎ.|,.,.,.~,.6,.6,<ut,%$!t,%#!ӎ.z,ϴL!UW~"t<*t!s+]UV!u]ô!ô!ø3!˜UV3!]UB^VNF !sؙ]ô?@U^VN!s]UVW~+WuA+_:t^:t&:Qt ވވA+WuA+_NWuA+_AFVW_^_^]XXL!UVW8^%VRv~>^%+YY#tWVPA+_^]UVW8^%VRv@>^%+YY#t WVv+_^]UW~>^%FPv ^%+YY_]U>VW~GF"ur<%t<+FFF FV-u FGF~0uF0=*u^FFGGF*FGF<0r<9wF V*Ѓ0Vۀ~.uD=*u^FFGGF*FGF<0r<9wF V*Ѓ0V3Ҁ~luBV#tGF^*Xt#dt utxt6~u^F/~tFFƒFWFVF‰F^F+҉FV^*Xt9ct^dtst:utxt Nvv vvPFP vvFP(+vWuA+_VFFFvшF+ƉFF;F}F~tFN;F~F^%^%F"t'V;V}< u ^%^% ^%^%FӃ~tFN;F^%^% ~ u^%^% ^%^% F^%^%^%_^]UVW~F F uO0s~ uFv vFP+WuA+_ڋNWuA+_AvW_'^`%OFV FV uً_^]UW~^r%OFVFV uً_]UVW+vFFF~t$Nj^,0<9v, +NNN_^]UVW+%WuA+_AV%W~_^%WuA+_AV%W~_^#t*F Ft"Ft FPFPBFPP:~^Nҍ~=0uG+WuA+_A^VW_^WuA+__^]UCVNF!s+~t~u]UW~=t*%t G_]Uvm ]UPv+ Y]initP5P P .5&&&;v+ر&+شJ!+یЋ";s+ر.5TX+@ "tPX%t!3">"&"?>"?u>""u..d7"&,3 &@$+>R0!)33&=NOuL&}87uD&}=u=PW>"t2" O&=t&"t!G ! !_X&=u>)s 3R&%&+G+&%ϋ@@@+&.5 "6&+P>&t>&ͫu&;&u & ! )ı=@r-@ =r--UFF]ÌU^F㑋Fʖf ֒]U>&uN #u3NF+؋F+{fFf+fvfff]^VF"tĊ*ߊ*r #uP+RPv vZYv^;wu ;vI^v ++ґ]Uv vvvG֋]U>&ubV V#}+ҋFV RPRvV1V#}+ҋFVRPRvFt+ʋFt+΋]fFff~fff]Uv vvvg#}^v ֋]Uv vvvB֓]UJ(t6&d6&d6&L@6&L@J(t 6&d6&L@]UP 6&K 6&vD &VY>&uY]U+FFFF&6&+FFFFF;&v6&^@FF< t< u~tւ~uK`~"u~u~u~uHFF묂~\u!~tF;&w6&x"uF"FF6&^@FFn~t$6&^@FF~^@6&߉F;&w*v&@F@]HEAPCODEeach_item U'9v^#t!;wtVP v^Vv^Vv^VFF~u]each_free_itemU'FF`vv| Ut VP JvD ;FtvP| F.v#t ;wtVP_ v^VFFvD F~u]remove_from_free_chainUv|r*| uD ' vD t D v\ #tD G ]USY]insert_into_free_chainUPv^#t/ Uu);'u6'vvD^G47v\SCv\#t>^ Uu5;6'u'vDvD^G47^v#t\v{&v|r'^\ #tw vD 6'Y]search_free_chainUPU=P@FfFY]USvD^;GrwY]set_limits U'P'P/]sysallocU>'u''+ҋN+Nv+;Vw u;Fs+'FV'F]add_new_chunk UPV;rЉVwDvxF#t7+v'\D UVTD;t7F'>'u'v Y]malloc2U>&t FsF~v+F vF#uv[vF~uvPvD+FF= w DFFFvDD D 'TVT vV^ VF#vDvvv^7\DD UD 'TƗu;'u6'v#F>&t/F]zUSY]hmallocUPU?PvvF>&t#tV#v &ʋ~FY]mallocUPv6&FY]errUSvtPUnfreeUP~uvFFF>&t|v| Duv#t ;wtvD UV86'| Uu$v|>'t6'#tv>&tfY]check_heap_integrityUU@P]USY]UU"'*P]U>#'t "'*P#'F"']UvDDD]U$'P]PQRSPPVWU~r6(6(FPuFP&'P<6((#]_^[ZYXPQRSPPVWUFPnnv&<u@ F'P6(([]_^[ZYXPQRSPPVWU6"(6 (FPs]_^[ZYXUPVRFV((+PVRFV((#PVRFV ("(+PQARR+PARP+PAP#P]U6(6(P6(6(+P6"(6 (#P]UvvDu F(FvDtv|tDt+vvDte|}^DtP+PPDPv+DPtDP$Fv+T;uFF(FvL vDDFF]U+FN(+ɋv++ًƋӹ F#|Z=Uv|tLvDt/Dt VFY vDt*vDu DutYvDPvD F(FF]UPFF T(tN(;&tPFYF=sF6&1YY]U]UP0(FV0(Y]U0(\D;t 0(0(]UF3(B(s2(F(+2(6(8(]UFFF2(^Vvv]Uv8(P>(P]UF*4(>P]UF2(LPv]Uvvc]UPF*6(F(uF(2(Y]U+PFPF*P]UPF*4(2(DP8(uF8(tF8(tFF FY]UF*4(F 2(F6(F8(BP]8(F2(FFV]U2(4(6(8(6:(><(6@(6>(!]ݏ>(@(2(4(6(8(6:(><(B(] %s .EXE.EXE.COM.COM Disk error %d %s .EXE.EXE.COM.COMDisk error There is no Program Information installed in the file. File is not in valid .EXE format. File contains Program Information in an unrecognised form. This will be overwritten. Disk error %d Do you wish to change the Program Information Do you wish to install the changes you have just madeFailed to install PIF info into .EXE file (%d) Failed to install PIF info into .COM file (%d) %s%s[%d] %s %s %s %s %s %s %s%s[0] %s%s[%d] %s%s%s%s %62s %62s %62s %62s %c%c0  %d%c  %X%c%c%c[%c].EXE.EXE.COM.COMDisk error error %d Failed to install PIF info (%d) Program information installed in file. PIF patch bigger than gap in EXE header. To Be Done %s ...[%4lu][%2lX]%s[%d]%s[%d]<%4d>[%4d]<%c>[%c]<%2X>[%2X] (%c/%c)? %c%cCLS,CPOS ROW COL,INV ON,INV OFF,CLR EOLEHY%c%cpqKYNYESNOInvalid path Invalid parameter: filename expected Invalid parameter: option expected Invalid number of parameters Invalid combination of options Path not found File not found Path too long Insufficient memory Insufficient disk space Too many open files Access denied File already open Locking violation Drive not ready General failure (OS error code %d) get current directoryProgram Information removed from file "%s" No Program Information found in file "%s" Memory usage: Minimum memory required (K bytes) [%4u] Maximum memory desired (K bytes) [%4u] Options: Program requires an 8087 co-processor Program runs only in the forground Program may run in banked memory Program waits in idle loop Interrupts: Lowest vector used by program (hex) [%2X] Higest interrupt vector used (hex) [%2X] The Digital Research Program Information EditorUsing Program Information already installed in the file.No Program Information currently installed in the file. Using defaults.Bad Program Information found in file - will be overwritten. Using defaults.Program name:Memory usage: Minimum memory required [ ]K bytesMaximum memory desired [ ]K bytesScreen usage: < l Program has no special requirements (24 line) Program has no special requirements (25 line) Program uses ANSI escape sequences (24 line) Program uses ANSI escape sequences (25 line) Program makes ROS calls (25 line) Directly writes to screen (ANSI, ROS, 25 line) Enter the number of the most appropriate mode [%d] Options: Program requires a maths co-processorProgram runs only in the foregroundProgram may run in banked memoryProgram waits in idle loopProgram makes direct access to COM1COM2LST1LST2LST3Program uses interrupt vectors [ ]hex through [ ]hex inclusive.TAB or cursor keys to move between entries, ? or F1 for help, ENTER when done.Do you wish to (I) install the above Information in the program and quit,(Q) quit without installing Information,(C) continue editing Program Information, or(R) revert to original values? There are invalid entries which have been . These must becorrected before the Information can be installed into the program.Press any key to continue(tUse the TAB key or the cursor keys on the numeric keypad to move from fieldto field. When you have completed editing the information press the ENTER key.<>Memory usage If the program runs faster when given more memory you should set the Maximummemory desired value appropriately. If giving the program access to more memoryhas no effect on its preformance you should make the Maximum the same as theMinimum value. Note: the smallest value that may be entered into the Minimum memory requiredfield will vary from program to program (the default Minimum memory valueshould not be reduced). The Maximum memory value may not be less than theMinimum memory value. Neither value may be bigger than 1023."rScreen usage. Use the spacebar to scroll through the available settings, orenter the setting number (0..5) directly. P<(*pBWProgram has no special requirements (24 or 25 lines). Use thissetting for programs that only write simple messages to the screen.If the program does not require 25 lines of text you can select the24 line setting and the Concurrent status line will be displayedwhile the program runs. Program uses ANSI escape sequences (24 or 25 lines). If the programrequires the ANSI.SYS driver you should use this setting (orpossibly one of the following). Program makes ROS calls (25 line). Use this setting if the programis known to write to the screen via the ROM operating system. Program directly writes to screen memory, makes ROS calls and usesANSI escape sequences. In order to gain speed improvement a programmay be designed to write directly to screen memory. This may meanthat Concurrent has to stop executing the program when it is putinto the background.l4@Program requires a maths co-processor To save time Concurrent does not normally save the state of the mathsco-processor when it switches from one program to another. If you run two ormore programs at the same time that make use of the maths co-processorConcurrent needs to ensure that the data belonging to each program does not getmixed up with any other. If the program uses a maths co-processor you should select YES for this option.v XZ ^J If you do not want the program to continue to be executed when it is put intothe background you can tell Concurrent to suspend the program by selecting YESfor this option. For example, you may have a program that does no useful work without directuser interaction, but which consumes processor time even while waiting for userinput. Since the program cannot get user input while in the background youcould stop the program slowing the system down unnecessarily suspending it. fh&v,\ If you do not want the program to be paged in and out of conventional memoryselect NO for this option. For example, you may have a program that expects to get hardware interrupts. Ifthe program is being paged in and out of memory you could not guarantee that itwould be in memory when the interrupt arrived. In such a case you would selectNO for this option. Note that Concurrent will be able to run more programs simultaneously if thoseprograms are permitted to run in banked memory. |~n2np Some programs use processor time unnecessarily while waiting for user input. IfConcurrent detects that a program is doing this it will allocate a smallerslice of processor time to the program, allowing others correspondingly morepr ocessor time to do useful work. However, some programs may appear to Concurrent to be waiting in an idle loopwhile in fact doing useful work. In this case you do not want Concurrent toreduce the amount of time it spends executing the program. If you find that the system runs slowly when you load the program, even whenthe program is waiting for input, select YES to enable the automatic idle loopdetection. 24  n !Z! Some programs directly read from and write to the serial and parallelcommunication ports (rather than going via the operating system). This cancause a problem if another Concurrent window is already using the port. If you select YES Concurrent will check whether the specified port is beingused when the program is started up. If it is Concurrent will not allow theprogram to be loaded and will inform you of the reason. Otherwise the programwill be loaded and the port will be reserved for the program while it runs.v!!!!!"P"""@###"$Program uses interrupt vectors... For most programs the default range saved will be sufficient and you need notalter this option. Some programs modify the interrupt table. When Concurrent switches from oneprogram to another it must also switch the interrupt table. To save time only apart of the interrupt table is normally saved, entries 8 through 2F(hexadecimal). Sometimes a program will modify an entry outside this range. Ifthe program does this via Concurrent the range of vectors saved will beautomatically extended. However, if the program directly writes to the tableyou will need to specify the range to be saved using this option.Digital Research (UK) Ltd (c) 1987. Program Information File Editor V1.2 pifed [%cHelp] [[d:][path]filename[.ext]] [%cR] [%cT] The Program Information for the specified file will be displayed. %cR remove Program Information previously installed in file %cT TTY mode: do not use escape sequences 0123456789abcdef0123456789ABCDEF000000001000000001000000000000000000S ((((( AAAAAABBBBBB   $N(Z(f(***RANGE OR NIL CHECK ERROR***!***QUOTIENT OVERFLOW ON DIVIDE***HEAPMGMT - heap error Aborting...)*** Cheap-heap linked in => no heap dump.&Cheap stack dump linked in => no dump.***Program aborted.******STACK/HEAP OVERFLOW***\DMetaWare High C Run-time Library Copyright (C) 1983-1986 Metaware Incorporated.. ࢳд!T!!2ㆠ3+u ub t/<+tHu^GtG3Ҡ.!3|uVGOr dursuy MZ P@!%p6: $U~~~2]:u']_*t ]_* hucPrY;v|vF:tePFY^"tO:uF^*t ^* +truFFFPPYY#tdFt>t>u>ujFvP66b +Pd]øPzPfc PbUVW>Wv~Y#v~t6+^WuA+_F6;vfPY_^]UVW@$+J+҉>F;6s8;rfPY^?F+WuA+_BV_^]UPVW+>;6s65"PF+ WuA+_YYBB;VtPVYFGG_^Y]UVv4v45YY^]UVv4v4YY^]UPVW^?^7+WuA+_V;s>+WuA+_V;s6VWYY_^Y]UPVW^?^7+WuA+_V;s>+WuA+_V;s6WVaYY_^Y]UVWrWv~. Y#~u ~#ufP'Y6>_^]øPYøPYUW~߃ucv.Tu&VPP*PPP$PPlWPP\*PPP$PPI*PHPP8*PdPP'PPYY uP YPY_]U6 FP]ø7!*UF.F%#!]UF.D5$!.H.J%$!]>%$!>%#!ӎ.F.L.N.H.6N.6L<u>%$!>%#!ӎ.DϴL!UVW~v*u'*t Ӄ0Љ+_^]ø3!˜UV3!]UVW~v"tR"tL**^ډ^^^:r>**^^^^:w:r:w GF먀=t <t+_^]XXL!UVW8VRv~>+YY#tWVP+_^]UVW8VRv@>+YY#t WVv+_^]UW~>FPv +YY_]U>VW~GF"ur<%t<+FFF FV-u FGF~0uF0=*u^FFGGF*FGF<0r<9wF V*Ѓ0Vۀ~.uD=*u^FFGGF*FGF<0r<9wF V*Ѓ0V3Ҁ~luBV#tGF^*Xt#dt utxt6~u^F/~tFFFWFVF‰F^F+҉FV^*Xt9ct^dtst:utxt Nvv vvPFP vvFP(+vWuA+_VFFFvшF+ƉFF;F}F~tFN;F~FF"t'V;V}< u  FӃ~tFN;F ~ u  F_^]UVW~F F uO0s~ uFv vFP+WuA+_ڋNWuA+_AvW_'^OFV FV uً_^]UW~^OFVFV uً_]UVW+vFFF~t$Nj^,0<9v, +NNN_^]UVW+WuA+_AVW~_^WuA+_AVW~_^#t*F Ft"Ft FPFPBFPP:~^Nҍ~=0uG+WuA+_A^VW_^WuA+__^]UPVW~v;tFNH|FGF_^Y]UVWF=+NnFF;~vnFPV YYH}G;}vnFPV YY@~N;~vnFPnFP_;vvnFPFFH+;~%v vWvFVv vv@nFP$v vFH+P@nFP'v vWv+_^]ô?@U^VN!s]Uvv4F4FFDtV vDt$v|uDvDu|uPD@tvPPv F#tPvtD*PvDDD |uvD@uD =t"+ɋ\+VN+FV||u2vPPvj F#usv< u~ tNFv| uDv| u|tvDHvD+ҋ ++ڋD +ӋN++ً|։FQv|u)PtD*PvD DD |uvT &?>?u>u..:&,3&@$+> R0!#33&=NOuL&}87uD&}=u=PW>t2 O&=t&"t!G ! !_X&=u>#s 3R&&+G+&ϋ@@@+&.z6+P>t>%ͫu);'u ) ! ı=@r-@ =r--nUF F ]ÌU4F+4vvDusFNvD@u7|uH| uBDt\PD+PDP@vDHuNvDD v|tvDtvDuPtDP`vDv|uvT|uA+щV+VFD;Vu;Ft LFDvDD v|fD =t+ɋt+ۉVN+FV|vT.u ~vvL>4t vL F4]Uv vDu 4L LvDtv ]vd|uDFnFV"| ++}4F Fu+vvv .+~F]Uvvd~;uDP F<t <tvL;FuvDP <u vdvL;FuvdvDt#PvDY#udvDDvD ]Ut6d6d6L@6L@t 6d6L@]UP 6/ 6vD V2Y>uY]U+FFFF6+FFFFF;v6 ^@FF< t< u~tւ~uK`~"u~u~u~uHFF묂~\u!~tF;w6 x"uF"FF6 ^@FFn~t$6 ^@FF~^@6߉F;w*v@F@]HEAPCODEeach_item U>9v^#t!;wtVP v^Vv^Vv^VFF~u]each_free_itemU<FF`vv| Ut VPw JvD ;FtvP` F.v#t ;wtVPC v^VFFvD F~u]remove_from_free_chainUv|r*| uD < vD t D v\ #tD G ]USY]insert_into_free_chainUPv^#t/ Uu);@u6@vvD^G47v\SCv\#t>^ Uu5;6@u@vDvD^G47^v#t\v{&v|r<^\ #tw vD 6<Y]search_free_chainUPUP@FfFY]USvD^;GrwY]set_limits UBPBP]sysallocU>BuBB+ҋN+Nvv+;Vw u;Fs+BFVBF]add_new_chunk UPV;rЉVwDvxF#t7+v@\D UVTD;t7F@>>u>v Y]malloc2U>6t FsF~v+F vF#uv[vF~uvPvD+FF= w DFFFvDD D\TVT vV^ VF#vDvvv^7\DD UD\TƗu;@u6@v#F>6t/F]zUSY]hmallocUPUPvvF>8t#tV#v 7ʋ~FY]mallocUPv6:FY]errUSvtP9nfreeUP~uvFFF>6t|v| Duv#t ;wtvD UV86@| Uu$v|>Bt6@#tv>6tfY]check_heap_integrityUUP]USY]UeU^*P]U>_t ^*P_F^]UvDDD]U`P]PQRSPPVWnU~r6V6TFPFPbP 6d]_^[ZYXPQRSPPVWnUFPnnv&<u$ P6d[]_^[ZYXPQRSPPVWnU6^6\FP]_^[ZYXUPVR7FVTV+PVR FVXZ#PVRFV\^+PRR+PRP+P% P#P]U6V6TP6Z6X+P6^6\#P]UPvFpF*n?PlY]UPvFpV*n@RWl;Fs >4u4lY]U+PFPF*P]UPF*nlDP ruFrtFrtFFFY]Uv~N+rt@H]UvvDu 4FvDtv|tDt+vvDte|}^DtP+PPDPv+DPtDPFv+T;uF4FvL vDDFF]U+F~+ɋv++ًƋӹ F#|Z=Uv|tLvDt/Dt VFY vDt*vDu DutYvDPvD 4FF]UPFF t~;tPFYF=sF61YY]U]UPFVY]U졶n#;t ]UFm|sl4+lpr]UFFFl^Vvv]UvrPxP]UF*n>P]UFlLPv]Uvvc]UPF*pv6z6x!]ݏxzlnpr6t>v|]%s SORT: invalid option - decimal number expected SORT: invalid parameter - option expected SORT: insufficient memory SORT: error reading from standard input SORT: insufficient disk space ASCII sort filter V1.2 Digital Research (UK) Ltd (c)1987. sort [%cR] [%c+number] [%cHelp] %cR reverse sort order %c+n start sorting with column n (default is column 1)   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~CUEAAAACEEEIIIAAEAAOOOUUYOU$$$$$AIOUNN?!""S0123456789abcdef0123456789ABCDEF000000001000000001000000000000000000S ((((( AAAAAABBBBBB ~  ***RANGE OR NIL CHECK ERROR***!***QUOTIENT OVERFLOW ON DIVIDE***HEAPMGMT - heap error Aborting...)*** Cheap-heap linked in => no heap dump.&Cheap stack dump linked in => no dump. ***Program aborted.******STACK/HEAP OVERFLOW***n#MetaWare High C Run-time Library Copyright (C) 1983-1986 Metaware Incorporated..MZ& P)!_%p66222 $U~}PXY^_:u-^__*8 t^__* hucPY;~|^Ó:t"u:uF*8 t* awo.               .&FgP^Ó7*PItP^Ó7+PG>t>teP Y>t>tfPY>t>tgPY>tpPIY^wY~~^_:tSPY>t>tr t+ PjY]VW P> r ++,rOPXP>/t/\pPP& #u PY_& _^UVW~jPZPPPPW+ #tPW+P>u&PP6#}hPPVb>Zu$+WuA+_AVWZ_^PP6#}hPPVP Y@PP+PPP6?#}hPPVPY_^]UVW~tvF=t-FPFPvPtPPW #tPW+Pw~tdPW+Pc,PP6t#}hPtPV=>vt$vP2Y#}ulPCYvPV YYvPP6t\#}hPtPV _^]UzVW+WuA+_AW~_ZRVR!FYY>t FFPF*PFP,#uZ#u.>tF t FPsY#u FPY΃>u>t#uFPY_^]UVWF>u+ FVRVR6RPPvPFt ttPvP+P kP Y~uO^#tH>tG t*^SY#|Ǻ+ҋÓN;VtFPFPlFY몃~u+;>rǺ؀?u>t.RdCdSFP +PP #u +#uWvP|fYY>tk#ug+WuA+_AVWh_^ǺShRdhPRdW *RPP G_^]UFVW؉F>tN FPFP6PvPvPZ߃ttPvP+P kP+ Y#tu=u BPF#tPFP&YY#| VFP[YYFPFPY_^]UVW~P'Y#|+>t)PPvE +PPx #uw _^]UVWrWv~.!Y#~u ~#u PY Y@$+HV++ҹ@$+_^]+UVW~6+MWuA+_AEVW_^VED EDEDY;u+_^]UVW~Wf+Y;6s/PWƺPv~9 #v~uFF˸_^]+3҃>(uBUVW~6+WuA+_AVW_^FVD TF V DT_^]UVW~W+Y;6s/PWƺPv~}#v~uFF˸_^]UlVWFF>u#tPlYvvYYPvPv~#v~u6?^FF:+NWuA+_A^VW~_^F؊W *RVRFYY#}N>tG+PPVR F#|2t.FPR+RP P^G *PFP#}+NWuA+_A^VWt_^vtR&6rv_F@~Z+WuA+_AVW~_^vVR6FP#} XPWtY#tWPYYVP+PPWFV"} FPvYYFP+PPPWPYY+FV|:#tq'+FV}\FPvvVWPFÓGPSVPPWVr+vv66vFFPvvWWFÓwwww VxPFÓGPSVPPVNrh+_^]UPWFPvYY#| Ft+_Y]UVW~vF F tf+FV |FV FVN^F *PvvW*vvvvVFV)FV _^]UVWF Ftm++FV|FV66v;t v WYY+RP66FVFV))FV_^]UVWF F to++F V |F Vvvvd;tv PWkYYPY+RPvvFVUFVFV)F V _^]UVFFPF+ҹY-} PYFPY<u PxYF+҉^]á áUVFP66T)^]U VFV $Nv+NvNv+Nv^wFV$ NFVFV^]UVFV $Nv+NvFV FVFV$ NFVFV^]UPVW~*P*PP ~t P Y=uuJ F^*8 tF, F:t F:t #u+uuPz Y#t *P *PPYY_^Y]UvxYPB Y=uS E]UPVW~+WuA+_AFW_vPVV)_^]øPYøPYøPYUW~#|a߃t/t4t*t/6tt u' *<NP P^PYY_]UVW~v#}\a<t VPtYYWiKY#u#tRP>uPF>u P.YWY_^]UVW~v^wtAt\t+t dt$ht_iujuVVV*PVPJpPY#t*PPYYVVP*P,PGu*APdP}Y/P*APzPf<t VPTYYWI+Y~jtE#u#tRP>uP >u PYPY_^]UVW+^w5uv;.c v .$+ZP P~Y2)$P]5-BPFYP;*P,P.nP'P PVP*PhP*P~P *PP *PP *P<P *PdP *PP *PP +P_#t*P,P YYh#u#tRP>uPd >u PL YWY_^]UV>rt##tPYP+PtP:V >tP Y>,t,P Y6pFP YY^]UCVNF!s+~t~u]U!]U;V!s+]UVGVv!s+^]UV!VNN UV!O!s+]ø7!*UF.%#`!]UF.5$!..%$}!]%$!%#!ӎ.....6.6<u%$!%#!ӎ.ϴL!UVW~v +F:t3}:u-*8 tV*8 t* -a^F^vv @@PF*PFP #u v Y#uy^ ?tWSY#uN+PPWF#~<t8+NWNuA+_AVCCVW_^^^ |t^aD:+_^]UPVW+^ ^ ^NWuA+_;uO#t^ߊ<;t:Fu^Ó?;u'v S P#uU#tO#t ^ߊ:FuA};^ߊ:FuG+FF^"t<;t } ^ ވFF |6+^ Ӌڈ;~^ފ^ވF~N+^Ӌڈ_^Y]UVW~+;v}G^F"u+F_^]UVW~+"t<.tFG=tG+=tFG~+_^]UVW~vG"u_^]UVW~vG"u_^]UVW~^*8 t'^:u^*8 t ^* -a+ WuA+_AV W_^a3ҋ^:tB;tS R  YY#t 9 F% V+҉ N ;u/^?t +WuA+_AVW_^>tFtFtF R   vY#tuvP6 P*PP #ud t2> t$> .t P  9 ㉇ YY>>t P PYY#t + PY +_^]UVW~> u> t8 #t!㋗ ;R u P3Y#t ㋇ ;R u> us R P ㉇R  T  Pn#t u-vP6#t"PY#utu  P*PP PY#uY t2> t$> .t P   ㉇ YY>>t P PYY#t +  +_^]UVW~^?u=.u(F.G=.t .F}CG F+}1"t <.t*8 t ݈GGG Fʀ=.uGF. },=t*8 t ݈GGG Fύ~+ }^!s+]UV!u]ô!ô!ø3!˜UV3!]UAV!s+]UB^VNF !sؙ]U +YY#tWVP+_^]UVW8 VRv@> +YY#t WVv+_^]UW~> FPv +YY_]U>VW~GF"ur<%t<+FFF FV-u FGF~0uF0=*u^FFGGF*FGF<0r<9wF V*Ѓ0Vۀ~.uD=*u^FFGGF*FGF<0r<9wF V*Ѓ0V3Ҁ~luBV#tGF^*Xt#dt utxt6~u^F/~tFFƒFWFVF‰F^F+҉FV^*Xt9ct^dtst:utxt Nvv vvPFP vvFP(+vWuA+_VFFFvшF+ƉFF;F}F~tFN;F~F  F"t'V;V}< u      FӃ~tFN;F   ~ u      F   _^]UVW~F F uO0s~ uFv vFP+WuA+_ڋNWuA+_AvW_'^ OFV FV uً_^]UW~^ OFVFV uً_]UVW+vFFF~t$Nj^,0<9v, +NNN_^]UVW+ WuA+_AV W~_^ WuA+_AV W~_^#t*F Ft"Ft FPFPBFPP:~^Nҍ~=0uG+WuA+_A^VW_^WuA+__^]UW~"t<*t&?>?u>u.. +&,3&@$+> R0!#33&=NOuL&}87uD&}=u=PW>t2 O&=t&"t!G ! !_X&=u>#s 3R&&+G+&ϋ@@@+&.)v6P +P>\ t>e ͫui ;g u i ! ı=@r-@ =r--UFF]ÌU t6n d6p d6n L@6p L@ t 6r d6r L@]UP 6t i 6t vD t VY>t uY]U+FFFF_ 6P +FFFFF;T v6L ^@FF< t< u~tւ~uK`~"u~u~u~uHFF묂~\u!~tF;T w6L x"uF"FF6L ^@FFn~t$6L ^@FF~^@6P ߉F;T w*vP @F@]HEAPCODEeach_item U 9v^#t!;wtVP v^Vv^Vv^VFF~u]each_free_itemU~ FF`vv| Ut VP JvD ;FtvP F.v#t ;wtVP} v^VFFvD F~u]remove_from_free_chainUv|r*| uD ~ vD t D v\ #tD G ]USY]insert_into_free_chainUPv^#t/ Uu); u6 vvD^G47v\SCv\#t>^ Uu5;6 u vDvD^G47^v#t\v{&v|r~ ^\ #tw vD 6~ Y]search_free_chainUPU/P@FfFY]USvD^;GrwY]set_limits U졄 P P]sysallocU> u +ҋN+Nvz+;Vw u;Fs+ FV F]add_new_chunk UPV;rЉVwDvxF#t7+v \D UVTD;t7F > u v Y]malloc2U>x t FsF~v+F vF#uv[vF~uvPvD+FF= w DFFFvDD D TVT vV^ VF#vDvvv^7\DD UD TƗu; u6 v#F>x t/F]zUSY]hmallocUPU1PvvF>z t#tV#v y ʋ~FY]mallocUPv6| FY]errUSvtPsnfreeUP~uvFFF>x t|v| Duv#t ;wtvD UV86 | Uu$v|> t6 #tv>x tfY]check_heap_integrityUU2P]USY]UU *P ]U> t *P  F ]UvDDD]U츢 P]PQRSPPVWU~r6 6 FPFP PZ6 A]_^[ZYXPQRSPPVWUFPnnv&<u^ P6 []_^[ZYXPQRSPPVWU6 6 FP]_^[ZYXUPVR1FV  +PVRFV  #PVRFV  +PK3RR+P3RP+P3P#P]U6 6 P6 6 +P6 6 #P]Uv~N+rt@H]UvvDu  FvDtv|tDt+vvDte|}^DtP+PPDPv+DPtDP$Fv+T;uF FvL vDDFF]U+F +ɋv++ًƋӹ F#|Z=Uv|tLvDt/Dt VFY vDt*vDu Dut YvDPvD  FF]UPFF t ;r tPFYF=sF6r 1YY]U]UP FV Y]U졮 t6;t  ]UF  s + ]UFFF ^Vvv]Uv P P]UF*䣲 >P]UF LPv]Uvvc]UPF*䣴 PP ]Uvb P,| *P]Uz P]U6 P]UF.a8]UF5!~E]UVF%!]UVF%!]U~VRˎuE] MUu}ÌuE] MUU~VW~EE]U~^W~EE]Uv4FFVP?]U6< > PP)]UPvF F*䣲 ?P+ Y]UPvhF V* @R ;Fs > u  Y]U+PFPF*P]UPF*䣲  DP uF tF tFFFY]UF*䣲 F F F BP] F FFV]U    6 > 6 6 !]ݏ     6 >  ]*.**.**.**.* (%c/%c)? %c%c %s ..."%s" %s ...YNInvalid file name "%s" Invalid path or path not found "%s" Invalid destination path "%s" Invalid option '%c' in parameter Invalid parameter "%s" Invalid number of parameters Invalid combination of options A and S Invalid combination of options M and S Invalid combination of options A and M Path too long Invalid password Drive %c: not ready Failed to get current path on drive %c: (OS error code %d) Insufficient memory Insufficient disk space file not foundpath not foundtoo many open filesaccess deniedfile already openlocking violationdrive not readyOS error code %d Press any key to begin copying file(s) Replace Add Replacing... Adding... Merging... %9ld File(s) added No files added %9ld File(s) replaced No files replaced File not found "%s" ...cannot be copied onto itself ...access denied on source directory ...access denied ...cannot copy to/from a reserved device %s ...path password?  Selective file copy V1.2 Digital Research (UK) Ltd (c)1987. replace [%cHelp] [d:][path][filename[.ext]] [d:][path] [options] The first file specification is the drive, path and name of file(s) to be copied (wildcard filenames allowed). This specification must be present. The second file specification is the destination drive and path to which files will be copied. Valid options are... %cA only copy files that do not exist on the destination %cH don't ignore files with hidden or system attributes %cM merge changed files on source with unchanged files on dest. %cP prompt before copying each file %cR overwrite read-only files %cS copy files in sub-directories %cW wait for disks to be changed d:..d:pathname.exta:*.*a:*.*a:a: 0123456789abcdef0123456789ABCDEF000000001000000001000000000000000000*."/\[]:|<>+=;,S ((((( AAAAAABBBBBB   _ ***RANGE OR NIL CHECK ERROR***!***QUOTIENT OVERFLOW ON DIVIDE***HEAPMGMT - heap error Aborting...)*** Cheap-heap linked in => no heap dump.&Cheap stack dump linked in => no dump.***Program aborted.******STACK/HEAP OVERFLOW***t6MetaWare High C Run-time Library Copyright (C) 1983-1986 Metaware Incorporated.. t/<+tHu^GtG3Ҡ.!3|uVGOr dursuy MZ LP]N #d*: $U.JaFF~^_:u-^__*t^__* hucPY^}:u.*uPaY*t* -aFGG+ }G݈G"tFG,P Pv@eP Y+vWuA+_AVrW~_^VVҍVRzY@ePY~tLFPY#tdPYFPFPv\~tFPvYY#tgPYFF*APPFPv~tFPPYPYPF FPvYYF"tX*GFPY#tdPYFPsY~tFPvYY#tgPYFPvYY#tCf9~t8&P+PRF~tFPvYY#tgPY+P]øPP P$f>/t/\ pPU,VW~FazFPPzP#uv"t<.tF_^]UPVW~"t)*P6~ YY#~u ^*uG+_^Y]UPVW~*P*PP~t PY=uuJF^*tF, F:t F:t #u+uuPRY#t *P *PPzYY_^Y]øPjYøP|YøPsYU^tcwT. B fPY%P *PP2PnP PY]U>,t,P Y6pFP]U!]U;V!s+]UVGVv!s+^]UV!VNN UV!O!s+]ø7!*UF.%#!!]UF.5$!..%$>!]z%$!z%#!ӎ.....6.6<uz%$!z%#!ӎ.ϴL!UV8!s+]UVW~FaE:FEEPF@PYY#t P+Y_^]UV!u]ô!ô!ø3!˜UV3!]U V!+]UF+YY#tWVP+_^]UVW8VRv@>+YY#t WVv+_^]UW~>FPv +YY_]U>VW~GF"ur<%t<+FFF FV-u FGF~0uF0=*u^FFGGF*FGF<0r<9wF V*Ѓ0Vۀ~.uD=*u^FFGGF*FGF<0r<9wF V*Ѓ0V3Ҁ~luBV#tGF^*Xt#dt utxt6~u^F/~tFFƒFWFVF‰F^F+҉FV^*Xt9ct^dtst:utxt Nvv vvPFP vvFP(+vWuA+_VFFFvшF+ƉFF;F}F~tFN;F~FF"t'V;V}< u  FӃ~  tFN;F ~ u  F_^]UVW~F F uO0s~ uFv vFP+WuA+_ڋNWuA+_AvW_'^OFV FV uً_^]UW~^OFVFV uً_]UVW+vFFF~t$Nj^,0<9v, +NNN_^]UVW+WuA+_AVW~_^WuA+_AVW~_^#t*F Ft"Ft FPFPBFPP:~^Nҍ~=0uG+WuA+_A^VW_^WuA+__^]?@U^VN!s]UV!]UV!]UV!]UW~=t*t G_]U+~uA+щVBF~uA+щV;VwF+]initP P P. &&;v+ر&+شJ!+یЋL;s+ر. TX+@"tPX%t3>&?>?u>u..n&, 3&@$+>R0!%33&=NOuL&}87uD&}=u=PW>t2 O&=t&"t!G ! !_X&=u>%s 3R&!&+G+&!ϋ@@@+&. :v6+P>t>ͫu ; u   ! ı=@r-@ =r--UFF]ÌUBt6d6d6L@6L@Bt 6d6L@]UPb66vD VY>uY]U+FFFF6+FFFFF;v6^@FF< t< u~tւ~uK`~"u~u~u~uHFF묂~\u!~tF;w6x"uF"FF6^@FFn~t$6^@FF~^@6߉F;w*v@F@]U*P]U>t *PF]UvDDD]UP~]PQRSPPVWU~r66FPSFPP6 ]_^[ZYXPQRSPPVWUFPnnv&<u >P6 []_^[ZYXPQRSPPVWU66FPQ]_^[ZYXUPVRFV+PVRFV#PVRFV+PRR+PeRP+PP#P]U66P66+P66#P]UvvDu >FvDtv|tDt+vvDte|}^DtP+PPDPU v+DPtDP Fv+T;uF>FvL vDDFF]U+FF+ɋv++ًƋӹ F#|Z=Uv|tLvDt/Dt VFY vDt*vDu DuteYvDPvD >FF]UPFF LtF;tPFYF=sF61YY]Uvy]UPv7Y]U]UP(FV(Y]U(2;t ((]UF+ :s*>+*.0]UFFF*^Vvv]Uv0P6P]UF*,>P]UF*LPv]Uvvc]UPF*.^ Uu5;6uvDvD^G47^v#t\v{&v|r^\ #tw vD 6Y]search_free_chainUPUP@FfFY]USvD^;GrwY]set_limits U졊PP]sysallocU>u+ҋN+Nvp+;Vw u;Fs+FVF]add_new_chunk UPV;rЉVwDvxF#t7+v\D UVTD;t7F>uv Y]malloc2U>~t FsF~v+F vF#uv[vF~uvPvD+FF= w DFFFvDD DTVT vV^ VF#vDvvv^7\DD UDTƗu;u6v#F>~t/F]zUSY]hmallocUPUPvvF>t#tV#v ʋ~FY]mallocUPv6FY]errUSvtPInfreeUP~uvFFF>~t|v| Duv#t ;wtvD UV86| Uu$v|>t6#tv>~tfY]check_heap_integrityUUMP]USY]Uv4FFVP?]U6PP)]UPv)F.F*,?P*Y]UPvF.V*,@R*;Fs >>u>*Y]U+PFPF*P]UPF*,*DPQ0uF0tF0tFFFY]UF*,F *F.F0BP0F*FFV]U*,.062>46866!]ݏ68*,.062>4:]U츾Pr6 fPatP]UPI\]a:\a:\a:\*.**."/\[]:|<>+=;,? (%c/%c)? %c%c YNInvalid drive specification Volume in drive %c: is %shas no label Volume label (11 characters, ENTER for none): Delete current volume labelInvalid characters in volume label Unable to get volume label Unable to set volume label Unable to delete existing volume label Display or change disk volume label V1.2 Digital Research (UK) Ltd (c)1987. label [%cHelp] [d:][label] d: drive for which label is to be displayed or changed label new volume label 0123456789abcdef0123456789ABCDEF000000001000000001000000000000000000S ((((( AAAAAABBBBBB    FR^***RANGE OR NIL CHECK ERROR***!***QUOTIENT OVERFLOW ON DIVIDE***&Cheap stack dump linked in => no dump.***Program aborted.******STACK/HEAP OVERFLOW***HEAPMGMT - heap error Aborting...)*** Cheap-heap linked in => no heap dump.2MetaWare High C Run-time Library Copyright (C) 1983-1986 Metaware Incorporated.. t/<+tHu^GtG3Ҡ.!3|uVGOr dursuy MZl `  sa_PP...>s.>.lмa6a6666+66;t6J!W+33kP.L! uñ..saA.3ùsCJ3Ɋ>2>#T%!..PSشQ!.;t[X˃ PPPPUVWv~J!r+a_^]J!UVWVF.؎F)!.)!K!s+_^]UFË]UVv{R tB P)PO6 NZPmPidV,F<:t tVs%J% V@!<t<:tV uVPU mP=PsP(PAO"P t+0OWPR  u~ M POOv6 mF6 PFPP%FtP6 l6~u0P6 lP8P' >uF]UFM >Wt>Wu:> t)P_'+PP!# tq/ > t7W t t!> t" u" t>> t7w+P`6$ +PL>* t* < Pd 뜸P`6& PSL>( t* ( , P< PYl" o]UF=w7.FPm`Pc`*.,PU&"PA&۷q ]UFWPZP#k]UVdžD džFF^?t|?"uDu+DF܃Du^?>u:FFFdžL<>udžLFvVP+PVvNIk벋^?* uFtt+P! u PO%6>* t< NF PF]J }P!"ʸP+PJJ+P KJ^ >( u ~uP! u x>( t' APP, P.%F, P, PJ"FFLt PvG] +Pv[JPy! }LtP+PPJmcPPIJPXJJ,^" >( t"  +^]UbWVv *P t<.u  vFFF*P t^FFN u^FPi$C=tDFP5i u+VF}t ?uuV VvUJ~uFPv+PbFP:iFPi=u~:u FP P#^_]Uv} t ^*P*-a PH ]UfVvFPFPhFPFPnh.PFPhF t FFFFFP *PvgF t FF~t>F^ヿZ t^Z vg u^ヿZ u FNj^FOPP u$=Pg@PF(PvgFFFvvvFPvv]F u veh+D~tF9FF;Pvf t DFF~ű^?u^]U4Vv v g^ :uF v g=v#v g^ N 8@t N Pv;fvv/fPv"fvfFF ~t^ +F΋㋇Z Fvv zf~tP Pv evv e PvPYF }*=t =t=uE~u0F΋^㋇Z F uvFFvHZFt ^ FΉ+^] U~u FN(F vv|&> t(vgF؀?uF6OGveP@FvPzeHF@Pe^P@PdvvvFP4GO~}"~uFvf FWC]UVWËI33&8tH~t >N~ u-UVWt~ u 3_^]UVW^ttۋ3:t uUVW.t-33&:uߋv &t&3&,KC&>mt&>zu & ~ك33Wʋvu_ Y&:u[Y-+r/;r)XZRP+RPQUFr;r]øPZPbUF=WsW]Y+r;rPZPbUZVvFPVP+PFPFP u~tPK FPV#^]UDVvAFF:N FFPDP=]FPP^]U VvVPFP+P tVbPAv|:u&*-aWDP%>W|>W~ N W<=u"F<t4V t7<u%PV0b<uv t6W# vABPP^]UV^?tSb uY\ P$ 2 PvD PFFP PC`~tvBFP^]U v8FPFP u^F*PP` uFPFP u^F*PP` tlFPFPy t]v=t=t?FFF FFFFFF=P| =cFlFPlB uFFFFF+]Uv+P|]UVvtt>X Ktt$?  t ^]UWVv+FFVP"P+Pp t<"""t'FPVPPcFPP+P/ tPP_WAP P*P_WA*N P*P_-PW@P ZFPnPn_(n:u;}((n(t(un:u-P(n_?nW@PY*PE?nPJP?FdžrV -"t+&tPPFPY "uF*%;&tF.PFP:^$ tF9$t $$dž$"tXr u "% PZ$FPFtN * Pr t WAPPY e"% P$FP-P:Ft 6P*vv@P~t EPv HPvV rtPY uFruPpP PFPW@PIM } Po"% PYRP+P Pv_RP_FVjPRvbPrKP\ "% P~t&tPvP1^_]UWVv~= t= uG<=u DP}VDP\:P\P,Pn\ u M|PPT\ u 3<u ;t> t WD> t|P`P^_]U> t>t6O>@+P=]UVv V t;6W- t P+$VM t=uP  ^]UWVvV<u6*WP t PPWX M<=t<;uFV[QF{[F@PPW>[V3\PWZW^_]UQP t_PEP+P:F+PP=Fv+P:ZPPZP[P~u P]UWVv<uaVZQFZF@PPWlZVWYWG^_]U]UVvVfP`P+Pt tbPV PP{PV PPhbPPP0 tPP+P tjbPb;t;P;u+P7PYbPP PPYbPvFРP *PvYF t+PY@PFҠP *PvXPvFYP*PFP3YFPPbPSFPvY`tbPnP>P+P tkFPP PXbPP ~tvҍbP+XPbPBV }  =u "P6FPT uS^]UVv V t;6W t P$VI t=uPr 8 ^]UV^?u'FvV tVFދv ~=tF^F u^?t;uQF^FVXV }P ^NF tV  t^]UWVvv<tVY uO" P~ Pr PeFFP P,9 ~t~CFP^_]U +FFFv FPFP* u^?t3F*PhPPV uFPFP u^?u+FFFFFFFFFP)8 ueb^F*PhPU tGFPFP t8^?tF*PlPU tFPFPl t ^?uu+]U ~tuoPV H]U VFF~tPPvVKF ~kF~t<t< t NF~u9vt+FPvP;LvF~t<uFvFFNFv랃~uv,^]UVvFVpPrP+P= tFPVPPE FPUpFPPP tPFPT9pt P -FP vP *Pv(Tx t.PT@PxP *PvSPxQTv tFV HzPPFPNFPvTFPP TxtxPfS PqPFt }P# e~t4FPTr%P+FPrP ,r%Ptr%PtGzPO uN^]UV H+PP]UPvP~ t{P! P+؎&?t|PdPT ]U4v F uPFPRWAF̸N PFPHRPFP:R6W4AP6P FPPFPhM u3FPR=v~.uFPFPyRFPNP  TP 6W t PP ]UvP]UvPpP+PR tFPvP\FPPP' tFPxP *PxpQz t.PQ@PzP *PxEQPzQp% FuQPPxQ u;zP ƆrƆsrP Pn3t$: t  ~uFP uFPI u|PPFPKFPxPFPtPPztz_PFPdžv~tFPnP P+Pvvt&PI t+ tFPP 6(|PL uZ]UF F FF%?F>u%Fa~uF ~ |Fp~ ~n F*PvPvP5 ]UF P+ҹdVF%FF%F*Fv=t=t*RvvvvvvvvvP vvvvv]U*FFP0F*PFPvFPvFPPr ]UFP0FFF*FFFFF PP2 v=t=t,vvvvvvvvvvP vvvvv]UPP(]UPP]UP P]UVVv uV v^]UV+^?tc tA<0r<8sf,0FN=u F6t F*P^*P+F볋^?\u F^*P t~t F*P}^]U~Ar~ZvF*F* ]U~ar~zvF*F*- ]U~0r ~9w+]UVv< t< uF^]UWVv= t= uG;tWVM < t < tF<u<u^_]UWV+vN 8t<:u+FGF<uvvL^^_]UWV^ ~t^^F*P t^?t7^-0^^*V uи+^_]UVv <*t t06& P(FvvP?vP(vvP?]UWVv |Z u}uuu؋㋇:F t PPW!^_]UWVv W<ta|:u[*Pq*-aW(6W'(;Wt+FW'>W| >W~t P+^_]UWVv F^*PF tV!> t  > tQ *t > u> u4 tV+P*t<@uDPVSA> t  ?u< ( * + *Ƈ, * P P3#+ *,  , F> =t!="u~u+F=!u!~uGW ~t&> t9=|u~u G( ҊGF+^_]UWVvG-FP@ u  v7 usvr@@G-F/=u~|=%tE8G1tFF^?tǃ~}F^F?tP0<PPv:F }v?@G-܉Fw-P Pv>vg@#^FG!^^_]UJV> tsvF uPۃFء*G+GGG GG ^N 8t@FPW@PH9v~tN  PFPN PWAP P1PevWAP PPK P>@Pڃ^G ڋ^GvP`>[ڋF*P P= t0F^F uF*P P= u^FF^F uFP>@PRڃ^?uP@ڃP1ڃ> u >" u" F*  ^]U > u]U> t46*ك*G * u   ]U*t+d*t8GU*w PK+PP u s P*w /F |*G]U> t"*t w0*G]Uvv,~t^?:t~u^?:u *tы]UWVF+F* u[= t&=uN=%tJ=|t3}^F؊Fc~ u^*u$?~uF ( ҃~tyN^FPtP; PtP&;tP<*؉FvFPtPփ tw^?ul~|dF^FوF<0r<9v~%u%DFF**G -0FWM; tWB;@FN uW.;=rWFP:W;*GF #<u *G *o_^_]U*t> t3*9W|#9Gr *;WP|;GwI*GW+PRww3PP*w/  *Gw*GWGW+*]U*G ]UVv> u<:uFvdž||sF|^*P u^*+GGGJ#~PP~:uPVP: t*t P^]U>WVՉF+FFvPv 9P Pv9 uFFPPv8P Pv9 uhFPFƉFċ^ĊF*P u ~*t~?uF݋^@PRPv8FPPvJ3 t P Pv 9 uoF P F*P u!FʋFL*-0Fʊ*P u٠W*9Fw+FVPv7vv<=tF< wP PVPk8 t|VpPi~G= w=uYEPGPv7vvG7 u+F~t~u+F~t vP^_]UVv2PӃF>tvӃ})VF|%u^G1< rٸP PVV7 uDPF|(uUӋ^G-b<)tbEӉFF*P PO6 u*P u <*t t6^҃ ]UHV> ti3ҋ PV5V5@PуPV5~$t F*P=F*P*=gtqv=$u=_tq=btf=dt=etm! FP @P/FPN P AP PK| Pp *Aw>q<k|eNZT6r P5$@-h=w&.::;;;:;:;v:;;;j:::F t^]UVvVC<tGV4<=uF|PV4 uO=PV4 uO&Ph>Ot|PnPL^]UVvV<tDV/4<=uF|PV3 u P6PV3 u+丄P t|P|P^]UVv<tV+PPrP! t " P6r P^]Uv FPF P u"^ ?uF9F|F9F^F+]UnVdžF0@:JdžvFP 3vIP2?P PXP+P tpv PXPPXt v+^auF^bu F0FPFؠR 8tƍFPSLF~vP PVPP[6LvHP6HF=uU~v+t P6H u6H PPPtFt F06Ha6H  t >0uF6L1Lx,uS|1L@~u/+t(6L  t 6LL6LA1L~u5+u.Ɔ L+u  u~u +u6HLv0FF~u*6H t6Lo t6Lf u@~r+u ^?,u++u@>@t >0uF6L  t >0uF4PBPx&4u PUXt P6HP/6LZP/P'>@u+2>@u P t+PPFP/Pi䉆FPP.*F~|FPO/FP.w/tXu Pf Xt~|P dž~} v `P@udžtRZPZP u+ZP㉆PFP.ZPPd :džutk>>u/>@t(+PZPPL  tZP@u8PZPP#  uZPPr@u >8twFPO*F uF^?,tF;rL?uDS}HP6HF6H PPPtFt F06HJ6HPi-PuFPC-PZPP⃾t0+PZPP  tP  tjJcPZPP t\ZPP:>8tP6DZP/F^?,tF;rÉF8F9Fr^?uS2ߣHP6H<F6H PPPtFt F06H6HP,PpZPP ჾt P< PZPPZPP6>8u/FF>>t686DZP>8uFP'F u%>>t686DZP>8uJ6J PPԻXt  ^]UWVv<=t<,t < vF<+uV DP݋R 8t<+t <=t<,u^DP<t ^ ^^_]UV^v<uYf~=t~,t~ vF^F<+uvFP ݉FؠR 8t<+t<=t<,u F@P܉F^?t^^]UWVvVC*F=u N 8u+_~u|:tV*=u|:uN 8DtV uΠN ^8@t+PPV#u |u^_]UVvVm uCV` u8V)؊@F<tN 8Ft~:t N PV( PV(^]UVv>>tMV u<tV uV t2+PVD } P>+^]UVvFFFvY tF>>u~uGVtFVtF~tPFPV^>2tRP6PVP&V>~t v <>2t5NFXufv؀?tNPvv!^]U<,v u ޸vlP t2>Pt>Fu *Pʃ>Pt >u4 PvT }PD<RP6P6T+P&+P6Nv"!N@ue,+]UV,F646B6TF.*=uv6TAZ>Ft 6.6B t F+B.49.t >PuF~t6T<,+^]UVF>,u><uvr@u )@t>>u.~t:PvSD>P+PP6DXt=6BF*v8 tރ><t6TC늀$FF.9Fr6.6B6D;.tP8,><t>:t6D>F><t>@u&686Dv>8uJ>8t+^]U WVvV u ܸVPV5D } P>>Fty+FFF646B6DF*=uWW6BF t F+>B9>4tF+~F9FtPvv6D }$R+FFP+PP6D }1+^_]UWV+ v$$ u#vq$~O=:uF |+^_]UWVv~ <uFO u+^_]UWVv~ aFF<tV$؀x.u V#@=tW#؀y.u W#AV#=v|:uFW#=v}:uFF8Ft+@tRP~݃><t 6Tl^_]UWVv~ aFFV(#=v |:uFW#=v }:uF~bw~bwF8Fu+^_]UVvV#N 8u AP P܃V P܃V"^]UVvVi#VnP܃P+Pe؉FV"F^]UVvV^]U VvFPFPF V*ŠN*-xRF* V*ŠN6PVF |"RP6PvPE v+ vX^]UVv<tP 8uF^]U PۃFt P PۃF t P P}ۃFt" P Piۃ P_ۃ+PP+PӈF׊F*=At-=Ft6=It=Rt}F ut+(FugFuY FuK]UP+PvFPPhF>׋^ ڃFAPFt  P Pڃ vFv+PvP F]U&4^F&2]UV!]ô!UV6!S^^^ ]ø89:;<=UVN!s]U^>ZUN^F?@U^VN!s]ôAUB^VNF !sؙ]U^D!s]UCVNF!s +~u]UVvGv3Z^]XXL!M!UV!VNNUV!OUV!s+]UW؎V~v__]UWF^^ ^!r+~u ^^ ]U*!^WG]U^W+!]U,!^͉W]U^͋W-!]ø7!*ôQ!U.F!]ôT!UV3!]ø3!˜øQD!r%3UVWfV!_^]UV]VW_^UVWFNV(_^]UVWFQOQOQOQOQ( _^]UVWfV!_^]UVWNV_^]UFF* ‹]UFЀ%|]-Q3ҋ-<r @+ȋ3һm uHmP3۹ .;SvSKƋσuu @;uB.+SXYX@R3һZË-=wwT.Su.S2ˀ s8r3.8Sr,.S2P-m[Ë-r +@;Zx0NmU/>PP.PP t*PPu.PPg.PPY.PPK]U.PP9]Utvrrr&*F]Uv~;Ft{{tvrrrt&?t &rr&r&F$=tÌ£NP%Pz]UFFF* t=t=t/<+8F^؊RF tF8Ft F߸ ^؋S]U>PP+Pv PF>PP~ vF5F@PKFPPv+PQ=tPZP=됋]UF>PPm P!F>PPRv]UF>PP$ PF>PP v]UWV9FuN9Ft~>&M*ȋFF&7+&G F+FFNP F t'P0Pv+P) t=tPZP^_]UWV>&M*ȋFF&7+&G F+FFNPF u++v0PvP t=tPZP~z^_]UV+PP*^^:u^v%-AF^?\uFF^]UF0~u^? t ^F.^< t ^F$FFF9Fuȋ^]UVv <\uF<u+^]UF^ƇOF~u]UFF=| " zPpу^N*O]UF&G@;FtE^OЈF tEF~t:NN*t$FFF*&;Gv+F* FF딋]UVF&s-F~tZ^v*F t PFFFvv**F t PFF~u͋F^]UWVv~F^8?t$ :t+ F~ u޸^_]UV&Oࣶ3+¹3+‹&G@+F^v7@>7*;ru*Pvc t^ tF t%^  ^ 9u^^F9u+^]U+FF&G*#FFl9Fu lF PFPFP6P F tE^*&O*#;Fu PFPPFFFl+]UVrFrFvB?F~ u^^PSvvFPt FFrF^]UFFFFF+FF#vnF^*FFF PFPFPvv F uRPFH+QP%FVF%+FV9Vtn^FFVFV]UWVv~<t ?FF^FF~ u+FFFq~u+FF<.uF~uFB!tF$F^㋇t`FFFFF*F^FF~}F^F*P@F^*P/F^F V‰v^^`^!]U>B!tF$F^㋇t`FFFFvaF^FF^FFF%?FF %FP^Fv^F]U VF~u+PP*FHFPF u~tp&G O&G O&Oࣶ3+¹3+‹&G@+FF6vv<F^s SFF 9FuFF9Fu‹^ 6&D@^&L^&D+F+F@+ҋ^7v vvv^]U+PP*PF u~u v]U+PPS*PSF u~u v]U+PP*PF u~u v]UVFPvFvF u~tv tv_F t=tFPFPvMF uF^vƀF~ uPv,ޠrvvF t z PFPPK p+WWnplFFPFPFPF@PFF vv?^]Uft+PvFPvFvmF u~tv! t>ptFPv+FFPFPFPvFP F u PFPFP)  PFPP vFPnpFp+WWlF+PPWP6Z vv]U~tT>puP>pu4FPFPFPXsF u+%vvF trFnV+‰FF$ u+FF3+¹3+F66F PPP 662F+PPP6P F tF$66F ~u+P_66W666Fpv]UV~tFFPFPFPv t=&s ^*f^**F6PF+F+ҋnp+WW;|;sF+Fn+WF+F9vvvFFF^FvFFF9Fu+WWFnp9W| 9WrFF9Ftvvv^]UV~tdFFPFPFPF+F+N;v+FF+FFFFF^FvFFF9Fu+WWWWnpFFFF;tpF u+vvF t~u &r~t&rzrF66F PPP66?FPP6RF uZF^ƇF~ uF9Ftvvv^]UFPvjFv"F u~tv tFPv+FFPFPFPvFPW F tiFPWFFt\^Ƈvv=F t 6F PFPFPvFP F u+ v7]U~uIF t =t=t( FVWWWW3FVWWFVnpv vvv]UFFPvFvF ux~uc~ugFPvuFtF+FFvFPFPvFP F tFPF*vvvT]U~u+PP*FHFPF u~u ^+ vv]U(VrF܋^GFPvFvF uS~t;vc t7FPv]+FމF~ur vFPFPvFP F^6&D8v~u=FPF PFPFPMvFP-^GW~uF*r~u~uF^+GG^FG PFPP^FGFމGFGFGPPvS PFPFP+vvv^]U(V^t*Fܸ PPFP[^GFGFފG*FFF v܍FPFPvFPp F^6&D8w?PdF PFPFPvFP^GWF~t~t~uh^F܈ PFPP^FGFމGFGPPv PFPFP+ v^]U&FFFPv0FvF u~tFPvFv tvy uFPvyFPvl+FډF+PFPFPvFP F t3 PFPFPvvF t F ~u+ vv]U~u,~t^W^ ^W^ +v vvvv]UWV~v׋N5;v;s NO s 3rIs&^_]Ëŋ^wgNO3ËF u@^wgON/UVW~3O~߹Aً_^]UW~3AيFO8t3_]UWVv~3AًD3:ErtIIы^_]UWV~3Aً~^_]UW~3@@_]UVvַAZ 3Ɋ :r:wȈ F^]UWVN&ً~3ˋvD3:EwtIIы^_]UWVv~N=AZ $ t tFG:r:w:r:w:u3:t rIIы^_]UVvַaz 2 :r:w*Ȉ F^]UWVS3F }׋VFVF }׋VF V uNF3؋F<؋NVF u3RPv v';Vwr;Fv3ҋ t؃[^_]UW~F ^Nt f_]U^WNs^W]USVF uNF3؋F<ȋ^VF u3RPv vk;Vwr;Fv3ҋ^[]2pc!exit!echo on Unknown LONGJMP Error %c:\. W%s a.l v /.-dsawlprcnd:d:%c:%c%-9s%-3s%-9s%-3s

%9ld %9d %s%10ld %s %*s $n$gc:..,p%s:VER=386XMx:*.* (%s)c*.*%2d%c%02d%c*?\.:;,=+<>|/"[]%2d%c%02d%c%02d%2d%c%02d%c%04d%2d%c%02d%c%02d.%02d%s E*****$CLS=p*****$ON=q*****$OFF= %sInternal Error Code %02xh  * 8 L h ~ *.**.*batchbreakcallchdircdcopydatedeldirdelqeraeraqerasemkdirmdmorepathpromptrenamerenrmdirrdtimetypeververifyvoluserclsechoexitforgotoifpauseremsetshiftja p,;va {  <   Qi  i    8V V : : F P;<!dd85 b6Q50123456789abcdef000000001000000000 Volume " in drive %c is %shas no labelFile(s)bytes free%s files exist SystemDirectoryInvalid option: `%c%c' Disk full Syntax ErrorBad command or file nameTerminate batch job (Y/N) ? Batch file %s missing retry (Y/N) ? Batch files nested too deep Directory of %s\%s ECHO is %s %s (Y/N) ? Are you sure (Y/N) ? File not erased: %s - Label not foundUnable to create directoryNo APPEND PathAPPEND=No PathPATH=Strike a key when ready . . . PROMPT=File already exists Invalid path, not directory, or directory not emptyBREAK is %s VERIFY is %s Auxiliary is %d Printer is %d Invalid Process Name or Console Number 8087 is %s BANK is %s SUSPEND is %s MEMSIZE is %d KiloBytes LIMSIZE is %d KiloBytes Copyright Digital Research (c) 1985,86,87 Concurrent DOS %s Release %s File cannot be copied onto itself File(s) copied Copy:- Out of environment spaceEnvironment errorIncorrect version of DOS Invalid number of parameters Cannot do binary reads from a device Content of destination lost before copy onoffMust specify ON or OFF Illegal operation on CP/M MediaIllegal drive in Path SpecificationFilename too longFile not foundInvalid directoryToo many files openAccess deniedInsufficient MemoryInvalid drive specificationFile Sharing ConflictPhysical Media ErrorInvalid PasswordLoading ConflictYNPath requiredFilename(s) requiredSunMonTueWedThuFriSatCurrent time is Enter new time: Invalid timeCurrent date is Enter new date (%s): Invalid date mm-dd-yydd-mm-yyyy-mm-ddInvalid Number CP/M MediaInput Redirection Already ActiveOutput Redirection Already ActiveUser Number = %d Note: Only applies to CP/M Media Invalid User Number - IGNORED Only of copy of CPM can be loaded is Local Mediais Remote MediaWrite protect errorNot ready errorI/O error Data errorSeek errorBad media typeSector not found %s drive %creadingwritingAbortRetryIgnoreFail* ;,=%c:%s%s%s%s%c:%s=notexisterrorlevel==indo[CPM] $u$p$g%c:%s%s%dcmdcomexebat\;/P   concon:prnprn:lpt1lpt1:auxaux:com1com1:nulnul:vszcabvszcabababab%8dh l q u z  *.*%c:%s , %s, %s, %s ? MXcpm MXcpm MXdisk @ WARNING alu vector exceeded # # $  t/<+tHu^GtG3Ҡ.!3|uVGOr dursuy QQrr6o*2PV"Z CP/M V1.35 6/12/85 SMALL Model CLEAR library. Copyright 1983-1985 Digital Research.$UWVVN*F*^_]+ێOsZero divide error$XYZ+^gVDRQSVRSSSP6 [ZB;v' Stack overflow. $+RSñ uPPt<vJALÃԱi@t+ P X"r.t " t5 t 5t+ɈPN%Ë-++Ë6_Cr Ë6_+́;s;rùË-UPPPe+]You must link with LINK86 V1.2 or later. $66 UVWv v~v2f_^]Y[ڎ^6-6'6!6666 6SV++4,S$p{ȳ+^t&u+[+u@fU PmP9P-P,~vvF2P PmDD+P/DD]UVWLL+FF؋F2G=s =r=P2[؊%t 22 uFF؋;FuF^78DD uN FNNvvV f_^]UVWƆPODDdžF6F؋P[:tFD~GF7PK;Dr⍆dž+ǓP[:u@ÉǓǓP[:u@ÉǓKǓP[:uǓdž$G(v2PDD7Ǔ?tY{PDDPPNPDDvdžPP PDD=} PDD ~ P|DD=} PmDD+PP6PIDDPPPDDPP"PDDPDD=2} PDD2 ~ PDD=2} PDD2+P$P&P)DDj2PDDYPPDD=t=ul=uR=uA=u=u=u=uY=u6=u.떃te>u PDD@;r8PDD+=dw6PrDD+O t*-.++PF7=uF70P+艆BB@B@>F؋dž2F7[؀?:uF؋F؋?uPP džP[rdž!P[P[rظPP PP |PPp PPb }2䉆WPDDPPwF7PXP]wPzDDDPqDDPeDDFP\DDPPDDHPGDDP8DDJP/DDP DD<PDD!|2<t<t<t<ut<ujTuPDDBPDDW Pd DD<u5PPT PDDP DD|}n !džFPP>P@PBP HPF2PFF=vPkDDdždžDBHD:udžF3P[PHD[DF9DrFtF9F}8PDDdžFudžPPP  t u uGuPDDdžP[ؠP[ؠ;>rPFDDdždžDP[P[DD(rܡPbPP PDDdžu P DDP DD|}RG;~s'+f_^]U >uW>uP>uI>uB>uPF F [ؠPF F [ؠF v HDDF >uF HF9tv "DDF $PF F [ؠPF F [ؠ;FvС tDFPF F [P[F~$rPfPF P F $PF F [ؠPF F [ؠ;rϋF v [DDF >tO$PF F [ؠPF F [ؠ;FrF v DDF F ]U F>u(FFFFP[F9Frߡ:FuL+󒓡+ÉFFFFFP[FF9FrߋFFF08FuFFFؠFFF؊F8Fu@PX+F]U|F}PP@ tP DDPU DD+]V 1P @[:uPc DDPPPL DDP [:u+^U FPP t$PP tPP u4P DD} t$hP DDjP DDpP DDPDD2PPLdP DDFbPF2[7 DDF~rFFF7DDFPfP1 ~r~vPG DDnP> DDkvP tP" DDlP DDFTPP t&PDDPDDvPDDxPDDFPoDDFF2;FsH~u!jPDDrPDDtPDD/\PP(/PDDPDDPP +]U^7DD=ukPIDDm=P^2[؊%u.P$DDH|^7pDD}2PP tPDDPPDD PDD+]áPDDPP]| }PPE+áPDDPP+| }PP+U|} PXDD0 tFPHDD>}u P2DD+"|} tFPDD>}uF^2PPF PF@PPxPDD^G@P^G2P^G 2PPpd^G@P^G2P^G 2PPF:PfDD/P[DD$"^G 2<t<t<t<uy<uf>}t+]UPPPPPPPP>|u<PDDPDD|2]UPDD~tT~tNPP; u$PP) uPP t(PkDD*PbDDavvFzFrvvFavvFPFHpF@6F8,PDD-+F=t=t=t=t=t=t=uvȸPDDF]U FFFk^P[:uZFFH?t FH?uFFPFF[:tҋFHP[:uN븋FH?u FIFFPFF[:uzFFPFF[؋FP[:tK+]ABCDU챚&2]U챚&GK]UVW v&_ tFFAf_^]UFF]UVWFVf_^]UVWFFÍf_^]UVWFDPDDF%;Ft+hdž22PEP+HP[؀?t5+"P[@ǓPǓ[:uGrكuFr+f_^]UVWvV!DD u( *,F% t% t=% u4EP8E P1X tP+PPVP.PVWDDFE2PdDDFEPP2=uFvE2PpV"DDVDD~uF(*,f_^]UVWvLL+FF=P2[؊% u<+uF <-uFF P2-0[Éǀ<0r<9v~t؉NjǍf_^]UvDD]UVW=uVeDDP[؋ǃ~u ~u 0Pvl7 u a6PvS7 u HPvV_ t VDD+ P+PPE2PR+PPPE2PA_^]U+Pvv5]U+Pvv!]UPvv ]UFPvPu]$ UFPvv`]UVWvP2P=u<u㸦P P_^]UVW FDVދFG[GDFPvVV+PeǍf_^]UVvDD uj% t+]% t( *,C% tvvVU +%tF+SPvVF+SPvV ^]UFFF^G2P=DDFF:v PF0Pvv+PPk'vv +P@PX tT%`u~~nT% t,vv +PPX t +۸SPF ^SPXZF*vv +PPX t +۸SPF ^SPXZFFv,P FPvF~t;~~ T% t * F *FFFPFRP&FFPFRP&F PFRP&FPFRP&FF vv +PPX tv^G2P ~t P,PJF^]UVWv%@t?"P+P@PD4PDP$V-SP+P@PUX t(*,$+_^]UVWv!P+P@PD4PvvVSP+P@P X t (*,DPvv$+_^]UV~u+&P Ps@9vtFHP P\^]U~tF9FtFHP P7]V+P [PDDF|^UVv DD u]~u+S% t( *,9%tvvVb#%tvvV vvV5^]UVWvdž~u]džFFF^?t^?%u郾~vPvFFFF?%tdžFFF<-uFFFF ~0uFFFFFdž~*uv^FFF>0}dž PF2-0[ÉFFF~0r~9vĿ~.u+FFF~*uv^ǃFFF. PF2-0[ÉNjFFF~0r~9vdž~lt~LuFFFFt.?6PP PPV tt.?6P+P PPV tt.?6P+PPPVu tPt.?6P+PPPV5 tv^Fv^2䈆ƆF2PWPVF2PWPVF2PWPVvF2PH/zF2f^]UVWv~ v vFF DP +PPFFDP vv> X t0VDD tvvV tF^+F^ D4PD%[ÉF~^F~u7 DPD P X tD PDPF^+F^ ~ uFDPPXX!GFn^ FDPPXX9Fsv v+PPt X tdv v+PP_ X tDPD PF X tD PDPF^f_^]UVWv^%t VPDD~sFu"+P@P~ۃƆ uƆP PXۃ2䉆9s PP7ۃ+=u^ +8FPG[N~vwȃ~vF G+Íf_^]UVWv~v vFFDP+PPFFDPX[% uDPvvX t'V8DD t=vvVv t&D4PD%[ÉF%GPFF[n^ DPPXX9Fsv v+PPcX uF^ u-DPD PCX tD PDPF^FVFFv v+PPFFvv+PPX t!PvvWvvVFVFPvvlDPvv+PPVvv+PPFPHvv+PPXZǍDP%D PoX tD PDP vvvv;X t F^+F^ F^ u F^VDD tvvV tF^+F^ iDPv vD4FGPFF[n^ v v+PPX u֍DPYD PRX tD PDP?EF^f_^]UVvDD u( *,]DPvvbDPvvSD PvDDSPDPD Pvv)(*,BF =t=t=tׁ$DP+PPX t DPPP|DPlX[^]UPHPPv(]UVFF+0F^#^#` u^Pvv<!FP+P@PBF|(*,f^]UP^XЙRP^PK+]V+P[PPDD[V DDF|^UVPF[؋ƸP+PV&VF[GDPPPx P PDPr&^]UVWvr( *,+*P[؋Nj% u( *,+_^]+P PՃ*R]T%+PPՃTT@'TT*= t=1t="t=1t:7T/-+R="0t=" t="t=1t=1t=0t=0uz+PDP_Ճ>*t>*t T+UVWvPF[؋FFWVQ t(*,}t vE[G~u$?P@Pf% t(*,^G2P*DDF~u WPԃ~u^%tEWvԃF~u%^% uE %tWFPSԃv^G2P~u(*,*~t~uF~+(*,f_^]Z[w7ZYX[GZ[YX[SPZ[YX+[SPUF UFF 3FFF tVV FV FtVVFV F Fu3FFFFVV VVQvvvvYYs$QvvvvOYYYF^VV VVFu"F^Ft ]YSPF^ZX[؃SPZ[YX;[u;uPZ[YX;[u;u+PUN ;N|N;Nwr4F ]+׸ҸUVWvFtt+PP=XZF+Pvt tX tpVDD tD\%SPD \-%SPaX tP+PD4P "F+SPV t$+PvDD D%F+F;~vFu+ vRWvD4FP!~DP+PW~)~ @+PvDD F=uVDD t!F~s`FF"PF+SPvF+SPV2;Ft(*,FFF~DP+PW~)~~wD\%SPD \-%SPX tP+PD4P F+SPV t\vvD4Pu  @+PvDD FFDP+Pv[FFtttt X t ttD DFf_^]UVWv~+PvFFFNDP+PPFFDPvv(X tgVDD tDPX[%SPD PX[-%SP(X tvvV tDPvvD4PD%[ÉF+PvFF:= u ~ tF GFNFFF @DPPXX9Fs~w9FrVDD tF^+F^<~u-DPD P.X tD PDPF^ ~vf_^]UVWv~FO _^]UVWv~v }~~ fuF~ et~ Eu@F ~ uF~~F F 2PvPP@Pv ~ fu WvVDDFH؀?.u FHF< t9vt Vv Ff_^]UF 2Pvvv']UF 2Pvvv ]UF 2Pvvv]UVWvF3=.u~)=eu$F@F9~sFFPG[ udG߀?uŋ+FHFG0FF;~F@NJF~5r*O=.uO߀?9v0=1s=.uH-1f_^]UVWv P+Pv P PF@P PFPVIƀ<:u,FPvt=u PFPFPƀ<*uP?PF@P[FPF@PFP<.uC PFPFPƀ<*uP?PF PFPF PFPS<;u) PFPFPƸPFPFP%+2< t< t<tf_^]UVWv~4GPu:P@@P߃=uP+PP@P=u@@PPB +P@P =t@PP ?PW  u*PW uF4PPWƃPWP F~u PWMFPF2PvFPDD@PtDDFFPv>vDDPWPF~uWDD2<>u<D2P}DDFDP#PvD2P܃D0P+PPX[-F^%uvv+PP:X uDPvvX t-vPDD tvvVۃ tDPvv+PP&cD4ǍFG;~s=uDPD4+ÙRP- DP+PP+CDPF^SP+PP DPD PlX tDPD PD PDP DPX[f_^]ZX[Ww7ZX[)_w7ZX[w7WZX[w7)_UVV]UF^!F!^ ]UF^ F ^ ]UF^1F1^ ]UN^ F^ F]UN^ FYXZ[WYXZ[)WYXZ[!!WYXZ[  WYXZ[11WZYX['WZYX[oUF f؋Ff؋FfډF^ ]ZYX[QSPZX[YSPQX[YZSPRQ&UVWvP[؋FD% =u>DP\X+ÉF ~-vDPP ڃ9~tL(*,HD%t|tD%tDDPDؙRPPDVD[G+f_^]UVW\=uzVDDP[؋ǃ~u 0Pv  u B6Pv  u )PvV t(#*, _^]U+Pvv^]U+PvvJ]UPvv5]UVWvLL2ljF2PP輻O Ff_^]UVWv2FF$+v8Ǔ?$u-^?$t v Pj$PP]@ÉFG;~|Ë9Ft v P6Ff_^]UVvDD u+ % t@^]UVvDD u+%^]UvDD t0+]UVWFH+@VDD u+VW_^]UVWNjƋDP\X3 tPzDD+D;Fu;6tǡNjƋD;Fr;6uvDD u P+DD+_ʡNjƋDP\X3 t PDD+5D;Fr);6uvDD u PDD+_^]UVW^ƋDPF@[;w v[?fÉWD+F[GWE[GW[^?ދFGVD[GFD_^]UVWLLF?FfP`DDƃu+5@RP+P@PXZƉߋFGWE[GEP DDf_^]UVWF-ƋDP\X3 tPDD;r9r9r 9v;r;r(DⓋPEⓋ[;w>+lDⓋP[;uVG[GVD[GV[V[EⓋ;uWD[GWE[GW[5>+_^]UVWvVDDFH+@FP3DDF u+R^;t8;s GP[N~uFNjF OPN[N~uvvf_^]UVWF F v~_^]UWV+V Fu أ.F^ ;wr ;vr+v@6>^_]ÃF FF2n=uDu&t t =ut u Etu Eut+؉^TV@^ RPFXY؃㓇ҋʋV҃VR ҃R FFufVVVV 3FFFFFߋOOO/ }^FuNfVVVF2n=uDutuEu=ut=tC^5VPF=uDuNu Eu:tV2u Eun=tuD\LE]M;} FNFTVTVTVVF2͈NV+=5vdE]M5r֊͊ߊĴt NuFu%VN^FF tFn^^^^N6V+VN^FsڃVuNJ݊Ίs^4u N6vF^NV t;#y ؃u3u ԊKs]UEË\ݱxT}`LTD| <$ Ċ֊tu"y؃33ҷt"ú"y@Bx"y"t -x@BËD-y-4|D$ \LU ֊͊ߊtEuDt]ENJ݊Ίu ]Mܓ3Dt̀24E3ۉ]]=t Dt]ËDEDEDEÁFsFuFuFF tFFF==|FtN2F4EF^NE] E%-D%-þB RPB BXZB R FFuþRs BuBuBFFGG uËGW/_uF ^VNNNð n3FtM]]ð3UVW؎~*ʋ~OvJsF_^]UVW؎~+ыv~tH@UVW؎~+ыv~t|&]awaawa:t밋W؎6*ыH_UVW؎N~vs_^]UVW؎~FNs_^]UVWv؎~F~ ī_^]UVW؎^vN ~s_^]û+VW؎6|*6Du6|OuA_^+_^$@Y@@@@j@.AcAחA7yACyCxDnF\)c=Hsȡ1I=P1PK?O8M20HwZ$gAAI0G+OI~.G ~0GIJuO=0tG^_ä.GI  u M O P W   # l & G H R *PRI*NTCOP*IESSTAT*USSTAR*TDEL*ETEH*ELPTER*MINATEALL*?*=*[*]* *,* *TAB*SFORM*SIZEPAGE*SIZEFOR*MATNOF*EEDMAR*GINNUM*BERPRI*NTERRES*ET**#-----------------------------------------------------------Print Manager Command Summary-----------------------------------------------------------Use the PRINTMGR command and one of the options listed below:PRINT filename filename filename ... [option, option, ...] Spools each file with the specified options. OPTION DEFAULT DESCRIPTION ------ ------- ----------- COPIES=n 1 Sets the number of copies to print. (n is 1 to 250). TAB=n 8 Sets tab position to every nth space. MARGIN=n 8 Sets the left-hand margin. NOFEED FORM FEED Prevent formfeeds before each copy. PRINTER=n CURRENT LST: Specifies the printer to print the file. FORMAT NO FORMAT Inserts page breaks. FORMSIZE=n 66 Sets the length of the paper in lines. PAGESIZE=n 60 Sets the number of lines printed per page. NUMBER NO NUMBERS Numbers each page sequentially.#STATUS Lists all the jobs on the spooler in order of job number.DELETE n Removes the specified job from the system. Replace the letter n with the job number you want to delete.RESET Removes the print manager from your system and does not save any of the jobs in progress.START n n n ... Loads the print manager system and enables printers on your system. Replace the letters n n n ... with the printer numbers you want to use.TERMINATE Removes the print manager from your system and saves any jobs in progress.HELP Prints this message.* Concurrent Print Manager Enter :You must enter a command or file name. See PRINTMGR HELPSpooling to printer number %d The Print Manager has been removed and all jobs were deleted. Type any key to continue.Spooling file UnsuccessfulSuccessfulJob %3d - The Print Manager has been removed and all jobs were saved.Attempting to delete job %d ... Print Manager System Status Report ----------------------------------No active jobsSpooling, currently receiving dataWaiting for printer %2d, Copies %d, Size %dk per copy Printing on printer %2d, Copies %d, Size %dk per copy Waiting for printer to become available againJob is being Deleted.Each job will print %d copies. Tabs will expand to %d spaces. Form size is set to %d lines. Page size is set to %d lines. Pages will be formated.Form feeds will not be inserted before each copy.The left margin is set to %d Pages will be numberedNo operation was takenCould not obtain access to a Print Manager in the systemYou used a key word incorrectly.You must supply a job number with DELETE, (0 to 253)Could not open file %s One of the options is unknown or is not used correctly.A print manager is already set up on this system.Formsize and Pagesize must not differ by more than 100.Formsize must be at least 2 lines greater than Pagesize.Severe Error - Restart the system.A file system error was encounterd while reading the fileThe printer requested is not set up for printmgr outputThe print manager encountered a file system error.Too many jobs were trying to access the print manager try againThe print manager system job limit was exceeded.Unable to make sense out of one of the options. See HELP.That job number does not refer to an active job.Concurrent Print Manager System Startup---------------------------------------Setting up printer %d for printmgr output ... ERROR: You must either run NETOFF or LOCAL each of the three queues MXSPL, SPLIN, and SPLOUTERROR: Your system does not support that printer number.ERROR: Valid printer numbers are from 0 to 15. before starting the Print Manager System.ERROR: You have not enabled any printers for Print Manager output. At least one printer must be included.ERROR: Either you do not have a copy of DSP and SPL or your system does not support that printer number.MXSPL CON:LST:CprogramRaw I/O<>.,=:|[]* : unmatched quoteCannot open Cannot append Cannot create : No matchStack Overflow $C RTL - program not linked for Program terminating $  ,f_^]Z[w7ZYX[GZ[YX[SPZ[YX+[SPUF UFF 3FFF tVV FV FtV t/<+tHu^GtG3Ҡ.!3|uVGOr dursuy window ch n=1 pr=8,pc=2,nr=16,nc=65,vr=9,vc=1,tr=Row,fg=white,bg=blue window ch n=2 pr=6,pc=6,nr=16,nc=65,vr=9,vc=1,tr=Row,fg=white,bg=red window ch n=3 pr=4,pc=10,nr=16,nc=65,vr=9,vc=1,tr=Row,fg=white,bg=green window ch n=4 pr=2,pc=14,nr=16,nc=65,vr=9,vc=1,tr=Row,fg=white,bg=yellow  t/<+tHu^GtG3Ҡ.!3|uVGOr dursuy  ~PPPPPP褻PPPФ{PPP踤cPPP蠤KPPP舤3PPPpPPPXPPP@~PPP(~PPP~PPP~f0~荟脟{riغ󟻜W~)MPZ@P Z3PZ&PZغ裟~}3}}}4}dݢ}Pd蹟غbB}bû}4}x衢}|PzPxP7j}vû`}W}dF}Ӟ7}N/} غ襞 }PP힋uغ胞|)u|~a|~û|D||@|;y ||y|ûo|Cg|a|H& T|>y F|:|.|û$|M|) |>xû{sS{Ù{{û{{{{{PbPgYHvغ,{P苝ʜs  kغ Y{SP3PPj 9{E '{P"auA  {PP蹍  zPPҜZغhzPǜuAzPP$^证zPPwغ qzdzp*Rz蔛t@zL.zP5PPz5غ褛zPPz>tywyPPJtyGygPPߚty |y8P P웻谚t!\y隻"My ؚ#w3P3?wP 3@w^uAw,BwPp3C|wP2DowûEewE_w2PP2FNw`P53GAwûH7wûK-wK$w 1Lw3Pm2MwP]2Nvc9uOv,PvP2QvP&2RvûSvSv?2ϙP'2TveP2UvûVvûY}vQYuv 肛Zdv3P1[UvP1\HvhP/2];vP1^.vûa$v5av )c vPd1duPz1euûhuahuiu>=uûju3P1kuP>PyluP0muûp~u{pvuqpu>=uûrUu3P0sFuP>Pt,uP>PuuPk0vuûytoytzt>=uû{t3P+0|t t }tP>{聗Py~tP>P_{tP>PEatP>P+GtP>P-tP>Pt P>Ps P>Ps P>Ps PkPs P>P~sP.sûszsts3PP3P QasPPPPAQHs3Pm?PP3PP9Q&sQ=t(s腀sw诀rڐrrPP P3PPPrUQ=t(r,r>Vr聐rrP荓P P3PPPtrP=t(fr]r~Jr(8r>rP 4PP3PP.PrP=t( rzr~qϏqq3P3P?ْPPMqOP=t.q&qM8~1~{JquqqSPZsqS PZ󒻲WqS PqZג;qSPUZ軒qSP=Z裒qS P!Z臒pS PZkpSPZOpPغ:pv@@p^PWZ}غkp3Q]p>SPsDZБ4p>SPJZ觑 p>SP!Z臑o>SPZgo>SPZGo>S PZ'o>S PrZbo>S PxIZՐ9o>S(POZ赐o@=oP'غ肐nP ڏغdn P輏غFn P螏غ(nûnyn 膓hnP3P3P>PLEn>ȋ>=#ȋ>=#s#mP3P3P>PJm>轏m>P>脐@@PP'mûmm菒qm>uû_mP3P3P>PKȋ>=#ȋ>=#s#lP3P3P>PIl>贎l>P>{@@PP&lûl?zl臑il]lQlElû;l2l?!l>ߡ l>uûk3PPPEHkHHP>讎@@PP&kP>舎@@PP%k+P>b@@PP%skCP><@@PP%MkWP>@@PPi%'kYP>@@P PC%kbP>ʍ@@P P%jlP>褍@@P P$jvP>~@@P(P$jûj|j艏kjPPPVj uIjPP5j)jPjPP j>u*iPPPni>iP%ii>i iPq% iû i i蘎ziPPPei tXiPPDi39iP,iPPi>u* iPPP~h>hP$hhNhhP$hûhh訍!hP3P3P蠋P>PF"_h"Yh>u##KhP3P3P>PD$(h> %h>P>ӊ@@PP'"&g>uû'g`(g3P3P3P>PE)gȊP蟉P>P苉Z̈t*xg^+pg>ȡ;#sz,Dg,>g>tû-,g3.!g/g/g̻0 gû7g7f9f3:fP4";f]"غY<fP9"=fF>fP"?f)"غ%@fP"A|fAvfdPPIBef!P3WP$ZJPZ=P蠉@ؿK!D!fDfP!E f덻FfFe3GeGeHeP^IePQJePPKePPLedP MeûNeNeУOyePpeQgeQae tRTeP#PmS@eP PWT*eûU eû\eغ衆]ePPe=t^dy_dPP==u`dPP!adPHPغ)bdPPغ cqd葇%=AP~P;؟Y se=dqf1ddh%dVidjdB=t8kd+pqlcJzpspbqmc跁cnc9coc3P3P3PPN@pc<qcPPPkrcbs~cdPtqc>=uuZcP)vMcwAcPax4cx.c3y%czc4{c{ cغ蘄|bl>u }b1n'u~b]bq u bbbPP@ؿ$K!bb}bgtbnbPabaXbdPKbBbPp5baa,bP껍bP?껎bPkbtPadPQaaaP5a u>a}P>aPa>hxPa!P}aPpaPcaУUadPHa2?a9aP5 u (aa3P =a3P?aP~?`Pq?`Pd?```~````P黭`P軮````PV黲z` P軳m`Wd`^`X`PK`5B`<`6`P)` ```>=ȁ>#s _Y_-# t8_3P:_3P._>_3_-ؿ2K!z_t_Pg_غV_PI_dP<_3_ t&_P_P _q u^h^غ耀^趀!u^3^'蒀u^^^^ tJ}^w^PPJf^dPY^"& P^J^D^P7^غ&^P^Pr ^غ] Pw]z]k]3]P]P]P]P]dP]3x]r]غ~a]~uO]F]~u -]$]~a~P~J~Y#s \o\P\~~u)\>u\\H\c~}u(z\>ul\3a\@R\PB\9\3\P&\P\Pr \UP[[PR[\P[nغj}[[P^[=t [ [_|u [m [aP |[h}P>X}HHY;y( X[P>8}HHC}غ|0[>}P }YHHP8݋ |P|Z{P|Z{غy|ZPP3P.ZZTZ2ZZZ=uZdZ=urZP#cZ=uUZPFZ@ZPغ{+ZZ"ZZPZPZP YPs!Yt{"YPP#YPP$YPcP%YP#&YdP'Y>um(zY3P>P>P)TY3*IY+@Y 57Y61Y6+Yt=uF7YPt8Yغz9XePy:Xk;X=X>X>XP u ?X AXP u BXCX>DXE}XYFuXGlXj tH_Xj>uYIIXPJ9u2K"X uLX4N XNXOWQWQWPPRWRWdP2SWTWVWVWP WW6غ2yXWPYWdPZ|WdPPO[kWû]dW]^WLe^SWe>d_8W>P*yPPGZcxt(`Wd>d3aVbVd>ydcVS@dV>PPywteV)fVP[ y;}gbVg\Vd>PGxbb>ch"Vc>ciV tmcjUkUVclU@9}mU:cnUcoUûqUqUP u rUsU>t}UutU[vlUwcUPxVUg tyIUg>uBz2U>9u'{U u| U(~U~TTTTbT`a>pbTEa>UbT*a>:bT)a>blT6`>`QTC`>a6TP`>P"v`^`>PP{v`b~`>PPYvaSeV`>faSr;`>KaSS`S@9}仐nS`eSSaZSûSSMSt>S8S>Pv@@PPW S>Pu@@PP3 R>Pu@@P P R>Pu@@P P RRP *غ&tRP}RqRkR@@@P [R غsJRDR(t@@PP QQQP>Nt@@PP _QaVQPQP>t@@PPp -Q/$QQP>s@@PP> PPPP>s@@PP PPPP>s@@P P PPPP>Ts@@P P ePh]PWPP>#s@@P Pw 4P7,P&PP>r@@P(PF POO =uOLO =P;Y#sOHH@O ;x.OOdP OpxpPs u fO0]OPP0ٻLOP3 ?O>P3PPѻ"O>PPPpѻO>P-PPRѻN>PEPP4ѻN>PYPPѻN>P[P PлN>PdP PлnN>PnP PлPN>PxP(Pл2N t#%N3P3P5*>ߡN3PPP[*M3P)MM tKM>nuM{M3P3P3PpPP)M|M3P3P3P>pPP)VM3P+JM3P>PP-M'M tLM>OnuLaLP3P3PpPPK)LLP3P3P>oPP')LP+LL tLL>mufLa^LP3P3ProPP(=L7LP3P3P>EoPP(LPz*LK tLK>%muKaKP3P3PnPP!(KKP3P3P>nPP'{KP)nKhKPP;ջWKP>JK3?K3K-K>uK3P܁>uRK t3JPPԻJ|JdP5JJJP u JJPJ(غ$l JPP[Ի wJP^ jJ3P3P>Pz& NJ3P3P3P>]mPP& (JP3P3P>6mPPz&JP3P3P>mPPS&IP3P3P>lPP,&I3P%I3P(IP(IP'IP'tI3P>P>PNI>u=IPPӻ,IPIIIk@@H? H!Hvj"H$H$HPPP<ܻ%HPPsܻ&H'Hӻ(Hӻ)Hһ*~H& j+oH-fH-`H>Dj.HH>P> k@@PP_/HPPۻ0 HPٻ1GPPۻ2GPgٻ3GPPۻ4G5Gû8G8GP>j@@PP9GP>_j@@PP:pGP>j@@PPl<*GP>i@@PPI=GP>i@@P P&>FP>i@@P P?FP>i@@P P@FP>ji@@P(PA{F>߸BdFiѻC[F>3DEFûJ>FJ8F1RmSLR>SKFcELFLE`SMEzRESlRE>SNEcEcEXY_^FFPøP[ttt3ӦզÎզӦÎզӦPQ#ȉ禱ãYXSFZR;sEӦ٦[ډPQRS٦ tF[ZYXbkUJV@o5 y e<r̋+@ 1> L=Bu @y ӎӦSR [KJ0K/AºA)FSC0s1u[[ZYRYZ[צRQ uڦCӻҥSӦ [PSצJCKtyDD[XP9:sG@P: `{ QYU \%X 龦< u X K x X+ۋ֬C y͓u È9!r ⦥[r⦦u tH<r**ÉߦݦùKc*ù[t,*QRSS!̬\x,̬[[ZY SRl̬Pk@XZ[SR̬lPk@馈à9 t4ùP$<Xs tQRS 9rh/.i+%bQYbc W&b̠hù6l馬z:t ;_[Ë]PQRS[ZYXS90[SuSwSy:r:s:PSblt7&C1t$/P./@uX/0 u[X&CWG $t<<HtF<:u 4,@IIt!F_'<.u# t_!+ 0u$_*Sk禉<[l u馋S &ډ{[S&[ &C4t&1t ./IyqR6{>&&릢[4**& 4t&hVF&&$&*Ŋ^W&FP֋߰h&CX@^Ryb1th/S  $u% ^_PXPXP̬A$xP'uHuXH@uð &CuQ*A C xKCYôAF xĪ'PQ*䑋YX֋P tPXuÊ :sC,0ttts ЊuҊtQR禶 &C&:rt uZY*QRY馫P$X$WGP$X$VXVXVXެ_H&릉lZYÀ>Wu Q 0Yû"Q-YQ%YÜPXRVWS[_^ZRVWRQnڜ>WtYpp>WtQ3Ӊ6SR>Wt'VW_^Z[ t QnuÀYZ[ X+Q!RV6ZY ô u0tVǩ:t u^*&Ʃ^*BSB'K'[/SA'C'[0uAuQRZY>Wu t:Dt t[uD Ê&E t:t=uEVQFଊȵA:tFxE tnDY^ QCuY0tPXtL*QRAZY>Wu tWu$QRZYð 0tQSRVW$>3/ ,>3,_^Z[Y>Wu+Ӧ>.> ÇÜP&XQ*@SRWE0tP&XQȵA&nY0t&$QV^Y_Z[Y$àa<r< t̬Ƞa<s< r <t,PŢX*r uPSЊȻrC0 |a<ut[SCr:tu*Zs؊Ƞ*sSBrZ̬C4PBX<t(P:s͊*̬CX<t BQR<ZYðP*sXŊrt :u̬C̬C* S[û tRS>ar-ȵ C<0u< t0Cu[+uC0KBZ[Zet?tTQS.C:turK%KKKfuCQNYsK:rՊ[YûSZËȵ+A< tBӈ/ItC<.u` tCuSQYs">t[Cue@u־֩%[`<0t` u tse uŠР`<t5ue$tR6eتtG0t u<ƩD;t]Tu)*»?uCC:ur tfa< r<u û xÊH:rKC,rt*rՊC*rCt:uCu bu/QSAK yu[YZZS]bu[1u,QRSP$X$t [ZYu  à t1u."txsϪ*"t \ubs CC uÊDtɋӪ":t CC uC/KuNӪ ":u; KK uúsBuSr[ËϪ:tCCuPSC y$F[X àewt [X*S[.+ZY[Xþ5fV0 tWچ>3,_^ËEGsEssH$uY^<P Xud /*sŊZP1t9RVڪڪu //$-/QY|^ZXûʫúUËʬÐzr`ڻSNrOZ̬S[CrA̫C)r7t'5< u<u<u<(uӱv*[ZΫË̫-C̫CCÊCsdt6JA8^(C bCopyright (c) 1982 Digital Research, Inc.Y_GG_YXlpp3.8\u nrr.\3jjp\YZbZd8&dfb&ffb>c&ffb>N&fb' lfnnZtt/t&bfZZZ8N&fb:b&bb&bb$9-zEq^t ױ!<u ZY[À>_tN7SQRXtl:t).Z^ӁÀ^7߹ZY[ø+T;Zr*ZX<t^Rщ^Z\7ǣ\)ZދZ_ )_VXQY OFYËXt:u%>TtUM À>`u:tEEEEú ^P.X$£ln tJ2v _VXQYR}Y>ut'vx2퉍ln\lnGø+T=sCVZu^`gZLw _ulvnxVXQYYÃQÃ)YP_t ``^_ÊtuuƅE (3E rdE <tt S][ Q\WúM3ҋʻ  E׹ ú(3ҋʻ ߹ *IZ;rS[Rڱ3EZÀ} u.W38E>tY88tS3QS  uYYQ u3u3u Y?9: ċ>>8u3F@H{2&H<uË uO33 tÃm8]:86D=rH3@HLE?;sËKۋ 0 u#>tË63E2MB}B0rá0{yz6~>~uCt:Kۋ 0 u %2x|0y}붠z uË6T 4"Ë6,=u||uH3~>}uEA8J95Ë6DHDu}MB>|uU2Ë3@6JE?;wÀ>u3U2uð Kۋ 0{~Ë6=u=u x@ Hx=2 u6z2(66vD6:DtND6v\ã3>{uKEA8z9>xu'6vVTBR6ZB^ 6TB;E?sj>{u@y>xuxvË6v961xvy>xtxv؋+ã@>{u+6+RJZB++W>{u6DJ86vD6+Dá++أ@Hvp>{u6vBv3@>{u6vJ6BJ}6D6v+DxU3U4DHDRQ؋+ã@)^D [މD DVW r  E4 _^u  u$L38E>tM88tGQY u$YzKK3BRZBtË?uY u܋>>8u3@HF 3H:Dt3ۋÀ>Gu6| u LA u!3HB\RZD;E?u@DmãsKۋ 0 u 6^=u =uH26DM?;s+DCt ֋D@D!6D66R6[~tB  6BJ 63@HD֋zD G D 4D G 6H6D>uË tۋ 0V63 ^ûJ9EA8>u3SË 66L&<u>Gu 3@أ@D@R ZR3 ZB3 E?;r D3B6) JN 63@֋6TBB 6B D Dv6HDhËU4 tU6U6s#  3DD D D @DE1DEBRQSP 6E2T X[ uD u YZe E8U:VWSQRZR>tHw E4ZY[_^ <tË6y R 3eEC- 3ҋʊMA tE?=s'<z<tEE1z úu<tEE B w u GE;DsE\ o tEv 7 u G}vM 1 teD@EËU> OU ËPP + 3GU2 uXË uA6| u XP tD@X tDOUoZ>Gtz>GuË Gu=à>:EAs#2W>? _WV>?^_=s=s2E&pjre&pYrSP&pF[Kr@ ;w9-Ⱥ3VM  W<0r-ID}ðUser Error ...... Check ACCESS MANAGER Manual$ACCESS MANAGER Internal Error ......$Copyright (c) 1982,1983 Digital Research, Inc.h *)E8E:GE6Y&6 t3 t 3dW_ú3ҋʻ2߹ÉQ!I#38Eu%8\yڃEJZuf"yZڃ YZ<tSA!uA#[QY0r*!t-"t(wt!tt&ttt0^_Z tROSRQڃ$:YZ[SQڃ$? u CgY[뼋ڀOY[i utI t &&tt% @@. 4-3GD>U2;uDuۉ ,6| uE<tD@E>FuEV<t%O>Ht EÀ>Ht>Ft3T ;t63É6D=r;r u Erá@+@+s{Af<t<t>Et ðÀ>EuB6e1;u :duFu 6RQ( 6;Ds66|uYZYZËD6tDVQ6|t;Ds76>t3H)6|t)D6Y^뤋D6zMAHpփЃðXڃWڃGVW69*8vP8Y _^VWRQS6z.89}=tE:rrwG[YZ_^ð*P͵Xrwȵ wr̋*t CF |t uWV^_I;raSE[Rڱ3ZÀ}u.=3d;tð*P2MAQzR l2EA8:sȋ9ZRy[YX89KK>?JAIIQWVzJW[t3^_YֻًzURQ'ڋYZlE;Wu D@@+]Mt]ËVWQJ+BY>t-->~t&>6_^á;s~u~HHDË4 us6D À}ut>*+II + F00-r3 t%< uFtNV@P@Y^-Gá!*+zÉváxà*á| tPGùZDvxz t |&Q (ZRZ1 XHHHPX HpyPX$'@'UÉ$&+ˉO$#rNˁsFs t(W+rw>GÉWډ#$tŹMOKK6;r$64 t;r;u L7E;tOËM+$Wr;s‹ uÀ>0À>YQ󥥥ËFFFF| ^rOcw|/uÊ u -0*xS1[ ߥ0 t@yـr$s Q*HY t*QـY*󪠓2xs) mr /FO**/G/G$>Pu>r<Pn t u$0E$,@y ??vCSW^B>*[CS t8P$tȾ>sXtȾ>'uY5~ t/KK/xùFOv]q%uZDS u0E(%Ay-AxC6B*/F/F/F/F/F/F//s6't떋W@[ $tF*㿏'JuBBӋCCCCӃ t-%:u:u t2r ðÇ ^P.$YQ S[^P.$CC^CC ^CC=P.$ -N2$2Ȫ%þ2$2ȪF$ Ȫà<s tyÿN-yȈ/þÊ'P'rC'$'Fá u' ĈGäÿ'''''''ËCC$t>t=SNSCC>u! t CS[J[ uÊr4 uYSN:ډtUP tBCC t+۬<#u"  > ʃwl  / u\> u, t2뺀>' u<.u<*u> t'' ?B t[[> t FI( XZY[PSX [  5r ( tO( tO > t +G!G.f Sr Yr tXEb 6 EOt[( ~ XZY[PS [ ` r u :tO T*} ZtS+A+jXYZQ5s+S܉ [S+A ZuB+.>  G!G0  ) > u ) tq  H % & &s A r <tV< tË tERCC  ڋ C*Êr rG}6 *à $t- %SQS< t[Y<,t$< t<2t/C܋ Qu0Y[û* <(  tH<"t1 ,. / "1 / 2. 1 < u < uE 1 :t$< t*/ C/ . uD< t<,u  u%* >1 u t t x uJú* t 7CCS. ޞRSCC-؉, Z7CYZ CBI u. tȺCBu* tG, * S ÇڟJJ[Su [C7C? t /C;Yt-Q[RS ؇[C7Z7C RS[ZCJ ur S"?[C7Ë uEN< u; r$<RWuP ڋ *ÊЊNJP  u"HXĞuXr "  ùWDu蠭Ȋr< ußP t ùREu_K s 6  $àr"S0[Ȱ"r꠭s. tKKS [K u r ڻ0ڇڹ!ًCB K $=  ùFEu2S8 2C7 ¹UCuډ [b 2C 8 SڊC? [t2 C2 *Ês8 S2C7 ¹UDuqډ -2qڻޞ։ [^RS[:RFt# 4 [t? ޞևڋ4 BCu;4  0)4  +S> [( G ?G?6 P xu XE~ZSt^l͊LQZ u t @ > $ É wtùFN[Hߋ > +AË C9 r RSSQڋSQr)x'SCCߣ ZYZYZ[[ à LSSR t5 t9Sڋ;_uZ[R[tr 2ðVt݇Lև;t#SR;rg[ t x؀'_St *[P;XùCA[TSދغ YKKá uQKKXY[Q x*S;vSRCCދأ ZZ[ ùSS݋Y[Q xS+v"SRCCXދأ ZZ[ X tuXZ[P x t uuj+SQ8J+v)Z;sSRCC݋أ Z)Z.[8  [* 0*SCC݋ZSʺ X< t*Ë t# xSta*:s'_CXSQCCU݋ZZSXHHÉ Y  QPMK  MtB 9 8 :t/ى <\uKF  CS"[r ; ~+S ) "XÉ    ; ~Ë  ,\ u s  @; sË    C' ?u0) _  ERROR $ AT IP $@PPimproper input - reenter $<  AA: CARDFILE.TRM@#003100333100333310000000000 CARDFILE.DIS00000000EX$Only one copy of CARDFILE can be runERROR: no file - CARDFILE.TRM001NAME.IDX'CARDFILE CANNOT FIND NAME.IDX ON DRIVE PHONE.IDX(CARDFILE CANNOT FIND PHONE.IDX ON DRIVE FIRST.IDX)CARDFILE CAN NOT FIND FIRST.IDX ON DRIVE BUSS.IDX(CARDFILE CAN NOT FIND BUSS.IDX ON DRIVE CARDFILE.DAT,CARDFILE CAN NOT FIND CARDFILE.DAT ON DRIVE FILE MAYBE CLOSED OR CORRUPT 1010DEnter to accept choice, arrow right/left for opposite, ESC means NO.  COLORCOLOR::#error drive specified can not existERROR OPENNING FILE ON DRIVE CHECK TO SEE IF DRIVE  EXISTS.?#RECORD:RECORD:Exit ?4Arrow up/down to change direction, any other to stop@Arrow right/left to change option, Enter to search, ESC to exit.Select:Printer is being used by another program. Any key to continue. Print labels?Labels, print all?Press ESC to stop printing  , Cards, print all ? NAME: BUSINESS: ADDRESS: CITY: STATE: ZIP: PHONE: () - FIRSTNAME: COMMENT: changesBESC to exit card, Enter for next line, Arrow up for previous line.Save ?Saving, please wait01Remove?Deleting, please wait01 new card new card ERROR: can't find record  associatde with %Program error, program is terminated.Error = line number=  ࢳд!T!!2ㆠ3+u ub t/<+tHu^GtG3Ҡ.!3|uVGOr dursuy Display Manager (tm). Patch this first 128 bytes of a display file with a copyright notice for the displays you have created. %DM80 V. 1.0!ӋFRolodex roll - with colorHelp screen - with color signon banner 10P0W11.-----------------------------------------------.0 44.------------------------------------------------. |0C  | NAME: >P 0 8 | |0B7 7.------------------------------------------------. | |0K  | NAME: >P 0" 6 | | |0L  | BUSINESS: >P 0$ 6 | | |0A;;.------------------------------------------------. | | |0P  | NAME: >P >. >5 0 9 | | | |0Q  | BUSINESS: >P 01 ) | | | |0R  | ADDRESS: >P 02 - | | | |0S  | CITY: >P 0/ )STATE: >1`P 03)  3 | | | |0T& &| ZIP: > .P 04 8 | | | |0U  | PHONE: > P 05 # | | | |0V  | FIRST NAME:> P 06$$ | | |-'0,99| COMMENT: | |--'0-66| |---'0Z| > (P( 08 |0O22`------------------------------------------------'SCROLLSEARCHUPDATE INSERT ( COPY/UPDT3DELETE<PRINTCommand: d A !NO%YES*` NAMEPHONE ! FIRSTNAME,BUSINESSNNPress: ? for help, ESC to exit, arrows to move, Enter to select option. 10P# -- HELP --AGeneral - position to an option with the arrow right/left keys. ;- scroll to next/previous card with the arrow down/up keys. &- select an option with the Enter key. 3- exit an option/program with the Escape key. (ESC)Scroll E- press Enter to start/stop scrolling continuously from current card.Search +- enter all or part of information to find. D- arrow right/left selects name, phone number, first name, business. .- arrow down/up keys finds next/previous card.Update 4- type in information to change all or part of card.0Copy/Updt - copy a card and modify new contents.Insert '- create new card with new information.Delete $- remove an existing card from file.Print *- print mailing label(s) or index card(s).Press: any key to return to main screend- 10PELECTRONIC CARD FILE!Concurrent DOS#Copyright (C) 1984 Digital Research0001101100010011&.2ұn-N% ࢵ&G> udXш&& ôP!3 ࢳд!T!!2ㆠ3+u ub t/<+tHu^GtG3Ҡ.!3|uVGOr dursuy :H:K:M:P:R:S /3ACABAEBLEFBLHBAACACACAACBLFJAAAAAABIFAAAAAY9AKAACCACBLHBBCHAADBCHEBCHDCFBCHFBCHCMAGAMAEIMACIPP48CIBLAAEBECEDEEAAAAAAAAR7 /2ACACAABEAAAAAHACBLGCAAACBLGDAAAGBLFJCACABLEKAACACACAACBLFJAAAAAABIFAAAAAALCIXXAAEBECEDEEAAAAAAAAJAMFDFAACGACACAABEAAAAAHACBLGCAAACBLZ3  t/<+tHu^GtG3Ҡ.!3|uVGOr dursuy %z)Q2PVZ ñ uPPt<vt Av +ێkOZero divide error$%Ë-++Ë6_Cr Ë6_+́;s;rÃԱi@t+ P X"r.t " t5 t 5t+Ɉz x XYZ+^gVDRQSVRSSSP6 [ZB;v Stack overflow. $+RSCP/M V1.11 8/27/84 SMALL Model CLEAR library. Copyright 1983,1984 Digital Research.$UWVVN~  *^_] +PPUP1Pb  utP P+PP 8:^P-P+PnP+P4PFF2FFFvDD~uF%vDDF^?[u. 8PvZ]U,^?uP|PF݉FvDDF^?tPvPv+ DDFdPvvvQDDF~uv DDv7DDF~u+PPvfP P^ՋG$FՃ~u]U*F߉Fݸ?Pva t*PvM tvDDF^?[tvvvFPDDF^?t ^?]tv8DDFFF2䓋FPv֊F2[؊[F܀~rv:DDFځ~uv DDv DDFځ~uPP~uPPvDP PdPPMP~P=PP-]UF FFF~|FvbPv{FP+PfPvF~uvDDFF?=tvbPv1FPF[؋FPF[؋GFPvPv-F~t\FF?u=FFPF[vDDF^?]t^?uFN^?,uFPPPPPPPP]UPdPvHFvP[Pv uvPvkvPv]Uv)DDFGFF$^P^[:u ^F5FF^?uԋFFPFF[^?u^F]U츔P PP PP PP PP P+P PNP PkP PP PP PP PyP PkP P]KP POP PAP P3P P%]UFFvDD=|vaP#F^?tvDD=}wvcPFFFPFF[^P^[:uݸP`PvFFFFFPFF[^?u^P|PS:P`PvF~uPvv]PxPPzP]Uv PeP P~u +PP]UCFFFF^?uF3^?uF&FFPFF[:tF^?uF]U#^?ar^?zwv^2- [F^?u]UFFFFÉF^?u/"^7v&=~^GFFF 9F~ָ]UFp^?*u/^?uF^?uo iFFF9^P^[:t^?u ~u+7F2FFFF^?u^P^[:u]UF^? t^? tF]U|zzPvzvzPIvDDzÉzzz[FFdžv~uv~ ^?t^?twfPv[7zPzzz=Pv[7^2[ÉxPx[7zP`zzz,vFvXzz]zz zz zz|P P ]U ^?*tFFPFF[F^?u؋F]U+P4P tFh^jhPP lltPPi^ džv&P DDrruPP7|PP/ ^PP! zzuPPz@zv&P. DDnnuPPrnG$nrvunpnP^[džx"nxP|Pzz[؊[xx$|džx!nPx-[P^x[xx|+PP4 zzt!nG$tPP p]UhP P FFPvF^FP P PDDFkP P v*DDPPF PvqDDPvF P]U+P Pg rF2;Fr F%;Ft+]Uv P1 F FF F~|FPP 2F~ ~FPFF[؊Fy^+PPk~~FPN^X SnP PF>F FF F~|FF=t= t=t=t~}Q+P PT2FF]UFF^?tFFP^2@[FF:FFv^2%[FFF~|FF.Fv^2%[FFF~|F]UFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF]UF FF* F PvvaF F PP:FPF2 [vPrF tFFPPFFFP f[PvvX t6+PP f[PvF tvPFi^FPF@[؊2HFvF2PF2PFFFFF~ }]vP2>rtr+]UF!PF^%[F"PF^%SP+PPXZ[F#PF^%SP+PPpXZ[]UFF2vPF2 [P)=uF2䓊F2+FF8FvƸ]U ^_FÉF^GF^GF?^2PF2X%F~u^?0t~u ^?1u+FN^?u]UFFPFF[FN u]U~ uv"P>rtr*vvvv!P>rtr+]UFF FFF PvvgF F PP@vP3r trF 2%uF2%tFFPPFFFF@?u&vvF tvPFUFFF?uP f[PvvyX tSvP f[PvF tvPJFP f[PLFFF^2PFF2[ÈFvF2PF2P>F~u:~tP PxFvPF2 [P_F~ }~t+v"PrF~tvP|FvPjr tr+]U ^_FÉF^GF^GFX^?XtJPF2XF^?0uv^2PF2[#[v^2PF2[ [FN^?u]U +PPvF tFF2%u+F~2PF}2[ÉF+PvvF tFTFFF*^2%=u^2%=t$FF~ }^?uȃ~ }+F둋]UWVNVU]^_]rj 2Z[w7ZYX[GUVV]U+FuFu@FF]UF^!F!^ ]UF^ F ^ ]UF^1F1^ ]UN^ F^ F]UN^ F^ F]Z[YX[SPZ[YX+[SPUF UFF 3FFF tVV FV FtVVFV F Fu3FFFFVV VVQvvvvYYs$QvvvvOYYYF^VV VVFu"F^Ft ]YSPF^ZX[؃SPZ[YX;[u;uPZ[YX;[u;u+PUN ;N|N;Nwr4F ]+׸ҸUVWFH+@VDD u+VWk_^]UVWr NjƋDP\X3 t PDD+5D;Fr);6r uvDD u PsDD+_^]UVW^ƋDPF[;w v[?fÉWD+F[GWE[GW[^?ދFGVD[GFr D_^]UVWLLF?FfPHDDƃu+5@RP+P@PXZƉߋFGWE[GEP DDr f_^]UVWF-ƋDP\X3 tPaDDr ;r9r9r 9v;r;r(DⓋPEⓋ[;w>r +lDⓋP[;uVG[GVD[GV[V[EⓋ;uWD[GWE[GW[5>r +_^]UVWvVDDFH+@FPDDF u+W^;t=;sGPF[N~uFNjF OPN[N~uvvf_^]+P P~ ] %+PP  @'  ~ = t=1t="t=1t:7 /-+ ="0t=" t="t=1t=1t=0t=0uz+PDP >~ t>~ t  +û+VW؎6|*6Du6|OuA_^+_^úUVW؎~*ʋ~OvҋsF_^]UVW؎~+ыv~tH@UVW؎~+ыv~t|&]awaawa:t밋W؎6*ыH_UVW؎*~V+ы~vOs\UVW؎+~V+чʋ~vss+UVW؎+~V+ыv~t H@F_^] Requires Concurrent DOS$Invalid parameterUse CMD or blank filetype in CHSET command lineInvalid filespecInvalid filespecInvalid syntax -- expected a '['Not a valid CHSET fieldNot a valid CHSET settingDuplicate fieldInvalid syntax -- expected a '='Invalid syntax -- expected ',' or ']'Wildcards are not allowed when using CHSET to change a settingInvalid filespecFile not foundToo many directory entries for querySpecified program cannot be set to shared code. Operation aborted. Password? set to .CMD \" !@#$%^&*()_+{}~:|<>?-=[]`;',./ =<>,|[]8*087SH*AREDSU*SPENDM*PMLOCKB*ANKF1F2F3F4ON*OF*FOP*TIONAL Syntax: CHSET {d:}filename{.CMD} CHSET {d:}filename{.CMD} [field=setting{,field=setting...}]  CHSET [HELP] Fields and Settings: 8087 ON or OPT or OFF SHARED ON or OFF SUSPEND ON or OFF MPMLOCK ON or OFF BANK ON or OFF Fx ON or OFF (where x is 1, 2, 3 or 4) Examples: CHSET qwe.cmd [shared=on] ; Sets the shared field of qwe.cmd CHSET editor [sus=on] ; Sets editor.cmd to suspend CHSET pie [80=opt] ; Sets the 8087 field to optional CHSET * ; Displays settings for all CMD files CHSET qwerty ; Display current settings of qwerty.cmd .; 1ar-l}  ?IOW`iorux{X100101010100110101010 File password protected in Write mode zzzzzzzz l l CprogramCON:LST:window ch n=1 pr=1,pc=1,nr=24,nc=80,vr=1,vc=1,tr=Row,fg=white,bg=black window ch n=2 pr=1,pc=1,nr=24,nc=80,vr=1,vc=1,tr=Row,fg=white,bg=black window ch n=3 pr=1,pc=1,nr=24,nc=80,vr=1,vc=1,tr=Row,fg=white,bg=black window ch n=4 pr=1,pc=1,nr=24,nc=80,vr=1,vc=1,tr=Row,fg=white,bg=black  t/<+tHu^GtG3Ҡ.!3|uVGOr dursuy MZ" P^?!/  h..@ $U~~;^_:u-^__* t^__* hucP Y, .+0tFF;F|=^9:t"u:uG* t* dwu.!!!!!!!!!!!!!F"FFFFWYsGaPF^Ó7*Pz B>,tPF^Ó7+PV F^Ó,RtR0R.RRP^{ #tP^7+P FvP Y>u>tkPPRP>tkPPWP>tkP* PDP>t0>tlPP+P>tmPP+Pr>t,#tRP+PVPP6.gF#thR.RP+>0u$+WuA+_AVW0_^>t +P Y>tF u>u  PV Y~tPj Y+Pc ]UVWFPY<u~`sP Y P P >/t/\PP~#~u PY+}ƅ G_^]UPVW~~G"t:u=:t(ePv^* t ^* SG+}5"t'P Y#tgPP*PGƄ Fƀ=tfPP+Pt_^Y]W>t !>tU>t >t +>*У(_UPVW>tu$+WuA+_AVWt_^ F>t FP0P6RvtRP ߃t tt$PtP0P+PdP0Y+#t tuJu PY+#t#6(6*S0P' ƖP0PYY먋_^Y]UhVW^FF:FF+NWuA+_A^VW~_^RVRYY>t1+^WuA+_AVW~_^vFPnYY&+NWuA+_A^VW~_^FPP+PVR#}jPFPW_+F;Fu;F u :uj Fv #t>t #t PY;t8>u#uFPPFYYUPVFPv>F#uW<FP PF#}=tjRRP3҃~}B_^]UVW+v}-FG+FtFrFtFwFtFdFPY_^]U^VW+:tuC0PPYY>uj+WuA+_AVWt_^F>t FP0P6RvtRP ߃t tt$PtP0P+PdP(Y#t ttu PY#uGu.u0FF:+WuA+_AVVW_^RVRC+0WuA+_AV0W~_^SFP FPFPFP( ƖP0P Y"_^]UPVWP+Pv#}jPvW+:u ;6t?t9>t FFP YPvvvw#u~uPhv P^#}tjP%PV)3#}B_^Y]Ã>u>uPYø&PYU"VWv vvt+NWuA+_A^VW~_^}XFPv6>"~u (PY7FPFPt v vFPL u6n*PsYuF룋_^]øPYøPYUVW~v^gw,gtdftjut:t.uet/Fhv;. E j u V:VR*P*PV[*PxP*P*PP*PvP *P *P.P*PvPuPhY#t*PPWYYV,VPG*PPPPP7gu *AP OP*AP P  *PPPPP. .P' *PFP *PP *PP *P&P *PtP *PP *PP *PP *P0P  uP YPY_]U>tP Y6FPk ]UWVVj౜GD_t GDGt+^_]UCVNF!s+~t~u]U!]U;V!s+]UVGVv!s+^]ø7!*UF.%#v!]UF.5$!..%$!]%$!%#!ӎ.....6.6<u%$!%#!ӎ.ϴL!UWj=t FG:Eu+ 3Ҁ~ vB_]UVW~v +F:t3}:u-* tV* t* -a^F^vv @@PF*PFP #u v Y#uy^ ?tWSY#uN+PPW F#~<t8+NWNuA+_AVCCVW_^^^ |t^aD:+_^]UPVW+^ ^ ^NWuA+_;uO#t^ߊ<;t:Fu^Ó?;u'v S P#uU#tO#t ^ߊ:FuA};^ߊ:FuG+FF^"t<;t } ^ ވFF |6+^ Ӌڈ;~^ފ^ވF~N+^Ӌڈ_^Y]UVW~+;v}G^F"u+F_^]UVW~+"t<.tFG=tG+=tFG~+_^]UVW~vG"u_^]UVW~vG"u_^]UVW~^* t'^:u^* t ^* -a+n WuA+_AVh Wz_^az3ҋ^:tB;tSRYY#t 9F%V+҉N ;u/^?t +WuA+_AVW|_^>tFtFtF : vY#tuvP6< P*PzP #udQ t2>t$>Z .tZ P: 9: ㉇YY>>tPZ PYY#t< +< P Y+_^]UVW~>u>t8: #t!㋗;u: P9Y#t: ㋇;u>: us: P: Pj#t u-vP6#t"PY#utu: < P*PzP  < P Y#uYQ t2>t$>Z .tZ P: : ㉇YY>>tPZ PYY#t< + +_^]UVW~^?u=.u(F.G=.t .F}CG F+}1"t <.t* t ݈GGG Fʀ=.uGF. },=t* t ݈GGG Fύ~+ }^^gu | PY7fPFPFPF=u6n~ PY~uF랋F#|F_^]UPVWvvYY#t8F*䓃t t ~O+ۃ }GF^ӋڈGċ^;Ó_^Y]UW~=t* t G_]XXL!UVW8 VRv~> +YY#tWVP +_^]UVW8 VRv@> +YY#t WVv+_^]UW~> FPv +YY_]U>VW~GF"ur<%t<+FFF FV-u FGF~0uF0=*u^FFGGF*FGF<0r<9wF V*Ѓ0Vۀ~.uD=*u^FFGGF*FGF<0r<9wF V*Ѓ0V3Ҁ~luBV#tGF^*Xt#dt utxt6~u^F/~tFFƒFWFVF‰F^F+҉FV^*Xt9ct^dtst:utxt Nvv vvPFP vvFP(+vWuA+_VFFFvшF+ƉFF;F}F~tFN;F~F  F"t'V;V}< u      FӃ~tFN;F   ~ u      F   _^]UVW~F F uO0s~ uFv vFP+WuA+_ڋNWuA+_AvW_'^ OFV FV uً_^]UW~^ OFVFV uً_]UVW+vFFF~t$Nj^,0<9v, +NNN_^]UVW+ WuA+_AV W~_^ WuA+_AV W~_^#t*F Ft"Ft FPFPBFPP:~^Nҍ~=0uG+WuA+_A^VW_^WuA+__^]UfVWv vvt+NWuA+_A^VW~_^^WRVR PFPqFP`+^WuA+_AVW~_^ }YFPFP6V~u PAY7FPFPv vFP헃 u6n PYuF뢋_+ ^]UV!VNN UV!O!s+]UW~"t<*t*&*?>*?u>**u..#*&,&3&"@$+>R0!1&33&=NOuL&}87uD&}=u=PW>*t2* O&=t&"t!G ! !_X&=u>1s 3R&-&+G+&-ϋ&"@@@+&.!v6 +P> t> ͫu ; u  ! ı=@r-@ =r--*UFF]ÌUf t6 d6 d6 L@6 L@f t 6 d6 L@]UP 6 K 6 vD  V6Y> uY]U+FFFF 6 +FFFFF; v6 ^@FF< t< u~tւ~uK`~"u~u~u~uHFF묂~\u!~tF; w6 x"uF"FF6 ^@FFn~t$6 ^@FF~^@6 ߉F; w*v @F@]HEAPCODEeach_item U 9v^#t!;wtVP v^Vv^Vv^VFF~u]each_free_itemU FF`vv| Ut VP JvD ;FtvP| F.v#t ;wtVP_ v^VFFvD F~u]remove_from_free_chainUv|r*| uD  vD t D v\ #tD G ]USY]insert_into_free_chainUPv^#t/ Uu); u6 vvD^G47v\SCv\#t>^ Uu5;6 u vDvD^G47^v#t\v{&v|r ^\ #tw vD 6 Y]search_free_chainUPU'P@FfFY]USvD^;GrwY]set_limits U" P" P]sysallocU>" u" " +ҋN+Nvz+;Vw u;Fs+" FV" F]add_new_chunk UPV;rЉVwDvxF#t7+v \D UVTD;t7F > u v Y]malloc2U> t FsF~v+F vF#uv[vF~uvPvD+FF= w DFFFvDD D< TVT vV^ VF#vDvvv^7\DD UD< TƗu; u6 v#F> t/F]zUSY]hmallocUPU)PvvF> t#tV#v  ʋ~FY]mallocUPv6 FY]errUSvtPUnfreeUP~uvFFF> t|v| Duv#t ;wtvD UV86 | Uu$v|>" t6 #tv> tfY]check_heap_integrityUU*P]USY]UU> *P]U>? t > *P? F> ]UvDDD]U@ P]PQRSPPVW*U~r66 64 FPuFPB P<6D #]_^[ZYXPQRSPPVW*UFPnnv&<u@ b P6D []_^[ZYXPQRSPPVW*U6> 6< FPs]_^[ZYXUPVRFV4 6 +PVRFV8 : #PVRFV< > +PS+RR+P+RP+P+P#P]U66 64 P6: 68 +P6> 6< #P]UvvDu b FvDtv|tDt+vvDte|}^DtP+PPDPv+DPtDP$Fv+T;uFb FvL vDDFF]U+Fj +ɋv++ًƋӹ F#|Z=Uv|tLvDt/Dt VFY vDt*vDu DutsYvDPvD b FF]UPFF p tj ; tPFYF=sF6 1YY]U]UPL FVL Y]UL ^.;t L L ]UFO ^ sN b +N R T ]UFFFN ^Vvv]UvT PZ P]UF*P >P]UFN LPv]Uvvc]UPF*R b ub N Y]U+PFPF*P]UPF*P N DPT uFT tFT tFFFY]UF*P F N FR FT BP]T FN FFV]UN P R T 6V >X 6\ 6Z !]ݏZ \ N P R T 6V >X ^ ]*.**.* %s*.**.*---rwd %s "%s" %s ...Invalid file name "%s" Invalid path or path not found "%s" Invalid character '%c' in passwordToo many characters in password (use at most %d) Invalid option '%c' in parameter Invalid parameter "%s" Drive %c: not ready Failed to get current path on drive %c: (OS error code %d) access denieddrive not readyfile already openOS error code %dIncorrect Concurrent DOS version File not found Path not found Insufficient memory Path too long Invalid password Only one of the options %cR (read), %cW (write), %cD (delete), %cP (path) or %cG (global) may be present on the command line at the same time. Invalid attempt to both set file protection level (with %c%c option) Invalid attempt to both set path password (with %cP option) Invalid attempt to both set global default password (with %cG option) and remove it with %cN option. Missing ':' in password parameter "%s" (use %c%c:password) %s ...the root directory cannot have a password %s ...protection level not changed: file has no password @%s ...path password? X%s ...file password? p Display or change password protection level V1.2 Digital Research (UK) Ltd (c) 1987. password [%cHelp] [d:][path][filename.ext] [%cR|W|D|P|G[:password]] [%cN] [%cS] Valid options are... %cR[:password] "password" will be required to read, write or delete the FILE %cW[:password] "password" will be required to write or delete the FILE %cD[:password] "password" will only be required to delete the FILE %cP[:password] "password" will be required for all access to the DIRECTORY %cG[:password] set global default password %cN remove password protection from file %cNP remove password protection from directory %cNG remove global default password %cS operate on files or directories in subdirectories *."/\[]:|<>+=;,d:..d:pathname.exta:*.*a:*.*a:a: 0123456789abcdef0123456789ABCDEF000000001000000001000000000000000000 S ((((( AAAAAABBBBBB   ,j v ***RANGE OR NIL CHECK ERROR*+ **!***QUOTIENT OVERFLOW ON DIVIDE***HEAPMGMT - heap error Aborting...)*** Cheap-heap linked in => no heap dump.&Cheap stack dump linked in => no dump.***Program aborted.******STACK/HEAP OVERFLOW***^.MetaWare High C Run-time Library Copyright (C) 1983-1986 Metaware Incorporated.. ࢳд!T!!2ㆠ3+u ub t/<+tHu^GtG3Ҡ.!3|uVGOr dursuy 11؎&F }t &@Ps <0rf6 [> t\>t#QSR>t< t<=u<:u<;tRuC89< t<uV\< t lO\u$$*[[P ۾t72 -=ls -N =s>< t l+tW> ۾u6>"56"_>> <"< t,P_X<=tI<:tE2 ߁N s + ȋ > l(1 S;s t:[Sw[7_[S2QPpX< u fY[2W;s t_W t_+_çy\1Dyyyy2R]fy-ñññ ñ ñ t þ~Ft þQ2 uþtþt 3#t-o1jR5dZt*R6UZt ñ7Gtñ8=tþ9*;%@tþ_UFt]U]ú Ï þ6IG5W>H.tlEkHH< t< t< t< t<:uH,@Oÿ= H<*uWQY_t 㨪I? Ë>IG ?ù +щù / +щfùQHYA rþ8ȸ! þ/ø8 #0t1þ/4Xu-ù +s QYQ YA:rþfhþu w  s QYQYA:rÎv6~t"5EWth!t &&]=xtpzthtrtt.t Sێv[0upÀ uP.V:XMÊȳ جд t0SRPAQ^ [X Î_áznãxv|&t&v& t|+~õ<&Dõ ~>v*XWv[L <t .; .x.xfhjl6r>t.p&n|zF~FvF؎мtn5%uz~YUtv;Yu~;Wu UwYtuV^6TVTzVtV6|tLÁ&t TTttt)tv~<t :`:Tu6VRt/6PQPM*[Yuπ+;tuýfY>Ou9WF_>t M<:u>Ou]W!_<:t>Ou<:t<+uOO<-uPSY u>Pu>uPP+u -u+ËX<+t<-tâPU^)RvDDDD]j_>rD\* u".;s u.\Ì \<tdء+rP\ tu u8\\.ru\t< u P=\~t? 8\X< uP+)rVj^ uK<t8tr.غRSr[ZJuSmu [ðþ B uAt> s:muþR FV:u QYt ^FB rXv&vÀ&?<t<@tPàS[CÀ>Eu tȳ DøÀ>uú+HËrJ?\M7Ë;s 6&þ< t< t < t< t< tP& t?ȵ&&VQS t ):UXY^V^U^Ft.-]UF^ ] "StG& t8t t:u&;\ut&;Lt ȵ΃lj6t U.]á6&ȵ&QVf^Y tS>& tCWȵ:u 6t__&E&E t>É&< u66E;v&< tW+rQ< u;6&6&:t%9rt9=&P X,ûQu tu, <,u U< t%롓=u;s5>>.6vﾕ*r+:t ;v6& t;u;wH< ul<*uI\Et< uqP\^>L\ESZM\IxEX< tÌ\Q\# tK|ؾ ع0ÿe= uOu u%+r>r ;v5Qv~=< t'5PX< t%< uUv~< ue(< tsS < uXPSP&+0X-B[XPS+ñ*7[XPSPzX/%[X tRa(XU)QKXrSt ,:XXP"#KXPXPr u'3XP.')[<t.6\< ul+ < tA&>Eu\\x&tQТS< t < u  >;>wRW[Se<t :T_9tt ;v~vDt ;u;TtIþQVDt$^YþDË>|t;u} u= suuRuN68p< tG<.u < tA<"uu?d< t's< u'u u s s>g [S<"t9P uۊX< t(< t<"u<"u[>;r+C;rQSWu _WU_[YGð&QԻS'!< u t~'&Qʠ>p羇PXPX>t<rá< tC\t7< u >Ru, < t< u \e u. uB7P%Xuz T< uPXâ9< th& '< uSZebOX<.u < te< u t I> rR< u t w͋S39tn< ug6VQ!Y^FFVQ Y^ ø+V^QVx^YNN&UF8wƊN^:uuڰ]U,P]U^?$t 7F]U~ v F, AF0Ph]UFPF$P]UvsFPP!]UFPFP]Uvs v6]UPDX&7rX]UX&P"yFvF$wF$xYQ"Ȉ}~Z"Јz{|]U}s P]UFFV7JV@V7<]U츗Pv]U츇Pv]U}svv]UvP&PsR&Gv]Uv+Pv]U}sPz]ðPa]U츧Pv']UX&70X]UX&7YX]U}s]]U~r F F]UX&7PX]UX&7^^X@PX]UXX&PX]UR&OX&R&G6X&76X]UX>vu 6xl]R&Os>xu >vu]À>vu3>xu X&?tX&7X&7R&GX>vuX&R&GPX6x.#P PP $P########6]Uzs6w,P],P6wd]U˷:prS^*p&FV>w$:wV7V PuX]U]UX& u sX]]U`6y]UX&"A6]U2]U']U]U]UX&?Ȱt@s]U3PP]UX&`Xs6`X&70:P6`>u]U}L]Urzs 6)]$+]UOzs 7]&]U,<]UzsP_]PK]U|sP]ð1PJ]UX&wjywX&$}6wp]UP\6y]U|UB]U}>wv]Szs6w& ]6w]U(]U>vu] 6wS]U>wv]]Uy wP]Uy>{u >}u]]Uc]U}]UrAq]Ud3P]U> u X&wX&w>u(㋇2PwƋP@> ucX&G$<v$ ,.=(Q9R2/(6(XBPwƋP@> w . )XSN ID0?6:<5B0H+k&t! 4W|wrmhc^.YFTjOrJxE@((((((((((((((((((((((((()`)) ))))s-]UFRT&XZT&OR&OR&OX&Ês%QP*Ps  R&G봀>u6 PPs R&O@6P.Pus R&O >}v R&OsX]U Pڰ P]U ]U?P>]UPH/]UE "2 Z wZ :FuZ u]UF,0< v@NAPv@Y ]UF,0< vF,A ]U[ 8 uN٢ Ɗ <@r6 Ts,>u   ][ s ] ]à[ s6 DsR6 UY [ q]UR> t> t]]U>u0\ F8\ w ^;u \ ^ F\ uհ]UPPGP]UPPGP]U츧PPP~s G]ð]U츗PPGPUs1GG uGGG ]ð]U츇PPGPs1GG uGGG ]ð]U:Fr0:Fw+] Ȋ] :wΊ^:u ] uް]U> uBPPPs G PPPsG  t]ð]UP> :t@Y"]UFO L O ]UP sj &PP *G]U> u> uG ]s&s t ËG G ]]UG s?:uG *FG?>+u *FG *FGs i:t]U% 6 PV! sd"   G% s# GG ]UGGGGGG G G G G G s]s]s]Cs]à:uAPPGP;s\ :taGG ]> :u G85G ]à :uPC]ËG]U& >,t]U9 G s]> t]Ur-=w%Ê:W u劏V X T ]]U,<v㋇F^ k8^ w<PP6s^ pW ]à^ u]UO R Q P > t>.u]_sPs>>V uQ sQ >V uR sR 6X -랰]]U6v]U_ O ȢO GOU ]è222223333UF5S T  U Pd>Y vPV>Y,  v PF]UFÊO s$ uF G X FT v]U? "D sFX FT 9 PV]U>4 w ' T 9 E X : T & P!]U]U>4 w 1 sX ]UJ P{2 s J Pk]UJ P_X $<u J PM]U>2 u >J v>2 u>J r2 ]]UM]Uu& Pnr]U>G w F E F 2 X ]U@ ". ]U@ "1 ]UD "1 P>4 w@P>G w@Y"Y"]U'B s],]UB s Pe]]U~J +ȁw@ sz@J +Q.]]U1 s=>: u? sX >J t@"@ s6X 6T & P]]Uj6X 6T 9 P~]U8P>G vD "+ s]J]U.> sX Ê : P]ðPX 9 P]U= sX 9  R> sX Ê : Pk]àX ]U]U>9 u = s]]UWos X Ts>X ~ u.c>2 u>J r>J rX & Pvs]U P]U Pz]U@ s"X J +Q]ðPX ]U>J w%@ s>J uP<]ðP4J P]]USk>7 @s&D "- s7 PX X$T 9 P]O]U9 B s X P]à@ s 6J ]]U. s>: u> s` >J w@ s` ` X 2 Pc>` uJ P]U>' u+ sa >7 w- sa jA sra  X E P>a u7 P]U5C s X 6J 6H ]ðPX []U~s X +]ys X +]ts P1J]]U. "2 "> s : PH]:s P]]U\tD "* ? "sX & T 9 >4 t= "1 sX 9 T & P]À>G uD ". s2 X 6J !>4 uA "1 sE X 67 ]|s'>4 w2  ' Pu]X ]Zs X j]]UF6v:P6i Px& Or>V vkV .;[' ?qzu~pkf a_\WRMVHC>19f4H/$;);.;3;8;=;B;G;L;Q;V;[;`;e;j;o;t;y;~;;;;']U|$}~[]??= $WORD $BYTE $K 68[|DTdt HOPHOHODE@AIJGDE@AIJGj=;:WV##U|)[euTqSwwstopvr    e?  e     e?H H H H HHe?     O O O O OOP P P P PPK     ########eeeeeeee????????yeWeW{z0+ 3& 21/(j j l l 9 9 9 9 979?<lllllll| kdia9 9 9 9 }~jj9999999999999999C C8699 h h$ $XY m!!!!!!!!cZ>>U)[ \>>bB"LNM 7   ?   U | 8}~'/! "VW#$ XYw%sr&vrZt'}|(~) [\*v]r+s^w,s-u.~_|/}`0q1{2y3upz4z5{ x ta678bc9:;<= >?de@ABfgChDEiFGH IJLMNO (jklmP 0BXBPSIDI,:+ [] ambiguous operand$BYTEWORDCMDSYM I =.,:;[]<> N LABELS VARIABLES@NUMBERSCODEDATAEXTRASTACKX1X2X3X4 05/07/85 SID-86 07 May 1985 286 Disassembler Version 2.4 Serial No. xxxx-0000-654321 All Rights Reserved Copyright (C) 1983,1984,1985 Digital Research, Inc. ------------------------------------------------------ CW SW TW IP OP ABCDSBSDCDSEIODITSZAPC CDESXXXX Cannot clos Insufficient memor No spac No fil Start En Verify error at Disk write erroPass Symbol Bad file nam Symbol table ful Symbol length erro Bad hex digi Empty fil Stop command? (Y/N) Nesting macros not allowed. Continue entering commands Macro overflow erro Macro already exist Enter commands, one to a line; terminate with an wmpty line Bad command or parameter; press ? for hel Macro name not foun Memory request denie? Help ?? Command formats :name Define a macro (You're prompted to enter the macro body) =name Invoke a macro = List all - defined macros. A Assemble into memory B Block compare D Display memory -D Set default nr of bytes to display E Load (for Execution) program & symbol file[s] F Fill memory G Go (with optional temporary breakpoints) H Hexadecimal arithmetic I Set up program arguments L List memory (disassemble) M Move (copy) memory block P Pass points (i.e., breakpoints) Q Direct I/O request R Read disk file S Set memory SR Search T Trace (single-step execution) U Untraced single-step execution V Verify values of last file loaded W Write disk file X Examine [or modify] CPU statIn the formats below, `s' means a full (base and offset) address, `f' is an offset, and `n' is a number. Brackets surround optional elements. A s Assemble into memory, at address s B s1,f,s2 Block compare memory at s1 (through f) vs block at s2 D[W]s[,f] Display memory (-D sets default nr of bytes to display) E file1 [[-]file2] Load files and symbols; E alone frees memory try `-' or `+' preceding file2 for `large' symbol addresses F[W]s,f,n Fill memory from s to f with n [-]G[s1][,s2[,s2]] Go at s1; s2 & s3 are breakpoints; `-' quiets it. H[n1[,n2]] Show symbols; show n1; show n1+n2, n1-n2, n1*n2 and n1/n2 Istring Set up command tail (command line arguments) [-]L[s[,f]] List memory (disassemble) from s to f; `-' won't show symbols Ms1,f,s2 Move (copy) memory block from s1 (through f) to s2 [-]P[s[,n]] Set/clear/list breakpoints (called "pass points" here) QI[W]n1 or QO[W]n1,n2 Input from (or output n2 to) port n1. Rfile Read disk file [-]S[W][s] Store into memory or enable/disable segment register display SRs,f,"string" Search through memory [-]T[W][n] Trace/step execution [-]U[W][n] Untraced step execution V Values of last file read Wfile[,s,f] Write memory (block from s to f) to disk file X[R|S] Examine CPU state [alter: R == registers; S == a state flag] Z Display 8087 Math Co-processor registerbzU_INJAJBJCJEJGJLJOJPJSJZORAAAAADAAMAASADCADDANDCBWCLCCLDCLICMCCMPCS:CWDDAADASDECDIVDS:ES:ESCHLTINCINTJAEJBEJGEJLEJMPJNAJNBJNCJNEJNGJNLJNOJNPJNSJNZJPEJPOLDSLEALESMOVMULNEGNOPNOTOUTPOPRCLRCRREPRETROLRORSALSARSBBSHLSHRSS:STCSTDSTISUBXORLARLSLLTRSTRCALLIDIVIMULINTOIRETJCXZJMPFJMPSJNAEJNBEJNGEJNLELAHFLOCKLOOPPOPFPUSHREPEREPZRETFSAHFTESTWAITXCHGXLATARPLLGDTLIDTLLDTLMSWSGDTSIDTSLDTSMSWVERRVERWPOPAINSWINSBCALLFCMPSBCMPSWLODSBLODSWLOOPELOOPZMOVSBMOVSWPUSHFREPNEREPNZSCASBSCASWSTOSBSTOSWENTERPUSHAOUTSBOUTSWLEAVEBOUNDLOOPNELOOPNZ I' U|AXCXDXBXSPBPSIDIALCLDLBLAHCHDHBHESCSSSDSH@XPEcho off del %1:\cdos\cdos$$$.bat >nul del %1:\cdos\endins.bat >nul cd o:=%1: >nul o: >nul cd \cdos >nul reboot p &.2ұn-N% ࢵ&G> udXш&& ôP!3 ࢳд!T!!2ㆠ3+u ub t/<+tHu^GtG3Ҡ.!3|uVGOr dursuy MZp P?/d !l22~~~ $U~uPQY^_:u-^__*t^__* hucPYPPXPVP P^w #tPY>XuXP P6VB#tPY>uPYHPLPYY;~| ^Ó:tPY^ÓF^"u:uF^*t ^* dv.7YaitFF^?:uFHPFPhYY#ub/F^?:uFLP PFP #u6PY&GP P6V #tPtYHPRPLPTP F>t FPXP6 RvRPk ރtt PYP YF#tu<u P#tPXP0 FYYPXP YY뻡 u PY~tPY+P]VW,Pj>-r2UPF^PZ P96tt2+uA+ыA 0+(uA+ыA+<uA+ыA2>C@>/t/\ PPGYY#u PY_^UTVW~PFY>t4+NWuA+_A^VW~_^vFPkYYn+JWuA+_AVFW~_^^VNWuA+_σWNuA+_AF݃NVW_^FPY>t+PPYY#u NPt++vEt';6t!R*$PFP;~F#u562FPe FYY#|TRRRPP #tvO Y~tPU*RVR@#t6PYPPY_^]UPVW~g*Pf*PRP~t P Y=uuJ F^*tF, F:gt F:ft #u+uuPB Y#t f*P^ g*PbP(YY_^Y]UVW~*䖱E$?*E*%^7_^]UVW~5E$*E$*^7_^]øPRYøPIYUVW~+߃ct_K v.hhhhhhvP]  P@ Y0P2 *P|P% *PPP>RP4QPP P P P 4P*PTP ">P*PP *PP *PP *PP #t)*P|P *PPP>RP4RPP~  uP YPY_^]U>tPGY6n FP9 ]UCVNF!s+~t~u]U!]U;V!s+]UVGVv!s+^]ø7!*UF.%#!]UF.5$!..%$!]%$!%#!ӎ.....6.6<u%$!%#!ӎ.ϴL!UV8!s+]UVW~v +F:t3}:u-*tV*t* -a^F^vv @@PF*PFP #u v Y#uy^ ?tWSY#uN+PPW1F#~<t8+NWNuA+_AVCCVW_^^^ |t^aD:+_^]UPVW+^ ^ ^NWuA+_;uO#t^ߊ<;t:Fu^Ó?;u'v S P#uU#tO#t ^ߊ:FuA};^ߊ:FuG+FF^"t<;t } ^ ވFF |6+^ Ӌڈ;~^ފ^ވF~N+^Ӌڈ_^Y]UVW~+;v}G^F"u+F_^]UVW~+"t<.tFG=tG+=tFG~+_^]UVW~vG"u_^]UVW~vG"u_^]UVW~^*t'^:u^*t ^* -a+jWuA+_AVdWv_^av3ҋ^:tB;tSR2 YY#t 9F%V+҉N ;u/^?t +WuA+_AVWx_^>tFtFtF 6vY#tuvP68P*PvP #udMt2>t$>V.tVP696㉇YY>>tPVPYY#t8+8P Y+_^]UVW~>u>t86#t!㋗;u6PJY#t6㋇;u>6 us6P6㉇- PP #t u-vP6#t"PY#utu68P*PvP  8P Y#uYMt2>t$>V.tVP66㉇YY>>tPVPYY#t8+ +_^]UVW~^?u=.u(F.G=.t .F}CG F+}1"t <.t*t ݈GGG Fʀ=.uGF. },=t*t ݈GGG Fύ~+ }^!s+]U*!^WG]U^W+!]U,!^͉W]U^͋W-!]UVW~5v WFP #t*P~P~ YY#~uvFPS YY#t^7*P~P~ YY#~uvFP YY#t^tt FFFFFFFvFFFFvPr cwlr:3w4F=r,= w'urrF=r ^p*;s^7FGFG+_^]U VW~vF+FF53WFPC#t*PPv~ YY#v~uvFP YY#t"tf*PPv~ YY#v~tJ^SFPYY#uO"t/*PPv~H YY#v~t^SFPYY#u~w~;w ~;w~cvFFDFDFD+_^]UV!u]ô!ô!ø3!˜UV3!]U0!^GgDQ!r^Gg^]UVW~+WuA+_:t^:t :Qt ވވA+WuA+_NWuA+_AFVW_^_^]UW~=t*t G_]XXL!UVW8VRv~>+YY#tWVPm+_^]UVW8VRv@>+YY#t WVv0+_^]UW~>FPv +YY_]U>VW~GF"ur<%t<+FFF FV-u FGF~0uF0=*u^FFGGF*FGF<0r<9wF V*Ѓ0Vۀ~.uD=*u^FFGGF*FGF<0r<9wF V*Ѓ0V3Ҁ~luBV#tGF^*Xt#dt utxt6~u^F/~tFFƒFWFVF‰F^F+҉FV^*Xt9ct^dtst:utxt Nvv vvPFP vvFP(+vWuA+_VFFFvшF+ƉFF;F}F~tFN;F~FF"t'V;V}< u  FӃ~tFN;F ~ u  F_^]UVW~F F uO0s~ uFv vFP+WuA+_ڋNWuA+_AvW_'^OFV FV uً_^]UW~^OFVFV uً_]UVW+vFFF~t$Nj^,0<9v, +NNN_^]UVW+WuA+_AVW~_^WuA+_AVW~_^#t*F Ft"Ft FPFPBFPP:~^Nҍ~=0uG+WuA+_A^VW_^WuA+__^]UV!VNN UV!O!s+]UW~"t<*t*&*?>*?u>**u..*&,&3&"@$+>R0!1&33&=NOuL&}87uD&}=u=PW>*t2* O&=t&"t!G ! !_X&=u>1s 3R&-&+G+&-ϋ&"@@@+&.=v6+P>t>#ͫu';%u ' ! ı=@r-@ =r--UFF]ÌUt6,d6.d6,L@6.L@t 60d60L@]UP 62K 62vD 2VY>2uY]U+FFFF6+FFFFF;v6 ^@FF< t< u~tւ~uK`~"u~u~u~uHFF묂~\u!~tF;w6 x"uF"FF6 ^@FFn~t$6 ^@FF~^@6߉F;w*v@F@]HEAPCODEeach_item U>9v^#t!;wtVP v^Vv^Vv^VFF~u]each_free_itemU<FF`vv| Ut VP JvD ;FtvP| F.v#t ;wtVP_ v^VFFvD F~u]remove_from_free_chainUv|r*| uD < vD t D v\ #tD G ]USY]insert_into_free_chainUPv^#t/ Uu);@u6@vvD^G47v\SCv\#t>^ Uu5;6@u@vDvD^G47^v#t\v{&v|r<^\ #tw vD 6<Y]search_free_chainUPUQ$P@FfFY]USvD^;GrwY]set_limits UBPBP]sysallocU>BuBB+ҋN+Nvz+;Vw u;Fs+BFVBF]add_new_chunk UPV;rЉVwDvxF#t7+v@\D UVTD;t7F@>>u>v Y]malloc2U>6t FsF~v+F vF#uv[vF~uvPvD+FF= w DFFFvDD D\TVT vV^ VF#vDvvv^7\DD UD\TƗu;@u6@v#F>6t/F]zUSY]hmallocUPUc&PvvF>8t#tV#v 7ʋ~FY]mallocUPv6:FY]errUSvtPUnfreeUP~uvFFF>6t|v| Duv#t ;wtvD UV86@| Uu$v|>Bt6@#tv>6tfY]check_heap_integrityUU'P]USY]UU^*P]U>_t ^*P_F^]UvDDD]U`P]PQRSPPVWU~r6V6TFPuFPbP<6d#]_^[ZYXPQRSPPVWUFPnnv&<u@ P6d[]_^[ZYXPQRSPPVWU6^6\FPs]_^[ZYXUPVRFVTV+PVRFVXZ#PVRFV\^+P(RR+P](RP+P(P#P]U6V6TP6Z6X+P6^6\#P]UvvDu FvDtv|tDt+vvDte|}^DtP+PPDPv+DPtDP$Fv+T;uFFvL vDDFF]U+F+ɋv++ًƋӹ F#|Z=Uv|tLvDt/Dt VFY vDt*vDu Dut3YvDPvD FF]UPFF t;0tPFYF=sF601YY]U]UPlFVlY]Ul+;t ll]UFo~sn+nrt]UFFFn^Vvv]UvtPzP]UF*p>P]UFnLPv]Uvvc]UPF*runY]U+PFPF*P]UPF*pnDPtuFttFttFFFY]UF*pF nFrFtBP]tFnFFV]Unprt6v>x6|6z!]ݏz|nprt6v>x~]hh:mm:ssdd/mm/yydd/mm/yydd/mm/yyyy/mm/ddyy/mm/ddmm/dd/yymm/dd/yya:a: (%c/%c)? %c%cYNInvalid path File not found Insufficient memory Invalid parameter: filename expected Invalid parameter: option expected Invalid number of parameters Invalid time Invalid date Path too long Change file time and date stamps V1.2 Digital Research (UK) Ltd (c)1987. touch [%cHelp] [d:][path]filename[.ext] [%cT:%s] [%cD:%s] [%cP][%cR][%cS] d: drive which touch is to search path directory where search is to begin filename.ext file to be touched (wildcards allowed) %cT:%s time to be set (24 hour) (default is current time) %cD:%s date to be set (default is current date) %cP prompt before touching each file %cR touch read-only files %cS touch files in sub-directories ...touch failedJ%s ...path password? b d:..d:pathname.exta:*.*a:*.*/.-:..,0123456789abcdef0123456789ABCDEF000000001000000001000000000000000000a:a: *."/\[]:|<>+=;,S ((((( AAAAAABBBBBB   ,d***RANGE OR NIL CHECK ERROR***!***QUOTIENT OVERFLOW ON DIVIDE***HEAPMGMT - heap error Aborting...)*** Cheap-heap linked in => no heap dump.&Cheap stack dump linked in => no dump.***Program aborted.******STACK/HEAP OVERFLOW***+MetaWare High C Run-time Library Copyright (C) 1983-1986 Metaware Incorporated.. t/<+tHu^GtG3Ҡ.!3|uVGOr dursuy . / / 0 0 1 1 2 2 3 3 4 4 5 5 6 6 7 7 8 8 9 9 : : ; ; < < = = > > ? ? @ @ A A B B C C D D E E F F G G H H I I J J K K L L M M N N O O